data_9J5F # _entry.id 9J5F # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.402 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9J5F pdb_00009j5f 10.2210/pdb9j5f/pdb WWPDB D_1300050375 ? ? BMRB 36688 ? 10.13018/BMR36688 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2025-02-19 ? 2 'Structure model' 1 1 2025-02-26 ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.year' 5 2 'Structure model' '_citation_author.identifier_ORCID' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr . _pdbx_database_status.entry_id 9J5F _pdbx_database_status.recvd_initial_deposition_date 2024-08-12 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs . _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'solution structure of disulfide-directed multicyclic peptides with n-terminal helix' _pdbx_database_related.db_id 36688 _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email chlwu@xmu.edu.cn _pdbx_contact_author.name_first wu _pdbx_contact_author.name_last chuanliu _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-2946-7299 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Fan, S.H.' 1 ? 'Wu, C.L.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Am.Chem.Soc. _citation.journal_id_ASTM JACSAT _citation.journal_id_CSD ? _citation.journal_id_ISSN 1520-5126 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 147 _citation.language ? _citation.page_first 4821 _citation.page_last 4832 _citation.title ;Disulfide-Directed Multicyclic Peptides with N-Terminally Extendable alpha-Helices for Recognition and Activation of G Protein-Coupled Receptors. ; _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/jacs.4c12808 _citation.pdbx_database_id_PubMed 39688263 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Fan, S.' 1 ? primary 'Li, J.' 2 ? primary 'Zhuang, J.' 3 ? primary 'Zhou, Q.' 4 ? primary 'Mai, Y.' 5 ? primary 'Lin, B.' 6 ? primary 'Wang, M.W.' 7 ? primary 'Wu, C.' 8 ? # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description m1-2 _entity.formula_weight 3558.159 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code RSFCAYWRMLLCPDSCSIEGGCPEVCTNTCPL _entity_poly.pdbx_seq_one_letter_code_can RSFCAYWRMLLCPDSCSIEGGCPEVCTNTCPL _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ARG n 1 2 SER n 1 3 PHE n 1 4 CYS n 1 5 ALA n 1 6 TYR n 1 7 TRP n 1 8 ARG n 1 9 MET n 1 10 LEU n 1 11 LEU n 1 12 CYS n 1 13 PRO n 1 14 ASP n 1 15 SER n 1 16 CYS n 1 17 SER n 1 18 ILE n 1 19 GLU n 1 20 GLY n 1 21 GLY n 1 22 CYS n 1 23 PRO n 1 24 GLU n 1 25 VAL n 1 26 CYS n 1 27 THR n 1 28 ASN n 1 29 THR n 1 30 CYS n 1 31 PRO n 1 32 LEU n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 32 _pdbx_entity_src_syn.organism_scientific 'synthetic construct' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 32630 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ARG 1 1 1 ARG ARG A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 PHE 3 3 3 PHE PHE A . n A 1 4 CYS 4 4 4 CYS CYS A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 TYR 6 6 6 TYR TYR A . n A 1 7 TRP 7 7 7 TRP TRP A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 MET 9 9 9 MET MET A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 CYS 12 12 12 CYS CYS A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 CYS 16 16 16 CYS CYS A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 CYS 22 22 22 CYS CYS A . n A 1 23 PRO 23 23 23 PRO PRO A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 CYS 26 26 26 CYS CYS A . n A 1 27 THR 27 27 27 THR THR A . n A 1 28 ASN 28 28 28 ASN ASN A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 CYS 30 30 30 CYS CYS A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 LEU 32 32 32 LEU LEU A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9J5F _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 9J5F _struct.title 'Solution structure of disulfide-directed multicyclic peptides with n-terminal helix' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9J5F _struct_keywords.text 'disulfide-directed multicyclic peptides, UNKNOWN FUNCTION' _struct_keywords.pdbx_keywords 'UNKNOWN FUNCTION' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 9J5F _struct_ref.pdbx_db_accession 9J5F _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9J5F _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 32 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 9J5F _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 32 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 32 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'NMR Distance Restraints' _pdbx_struct_assembly_auth_evidence.details 'not applicable' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0 _pdbx_struct_oper_list.matrix[1][2] 0.0 _pdbx_struct_oper_list.matrix[1][3] 0.0 _pdbx_struct_oper_list.vector[1] 0.0 _pdbx_struct_oper_list.matrix[2][1] 0.0 _pdbx_struct_oper_list.matrix[2][2] 1.0 _pdbx_struct_oper_list.matrix[2][3] 0.0 _pdbx_struct_oper_list.vector[2] 0.0 _pdbx_struct_oper_list.matrix[3][1] 0.0 _pdbx_struct_oper_list.matrix[3][2] 0.0 _pdbx_struct_oper_list.matrix[3][3] 1.0 _pdbx_struct_oper_list.vector[3] 0.0 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id TYR _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 6 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id LEU _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 11 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id TYR _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 6 _struct_conf.end_auth_comp_id LEU _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 11 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 4 SG ? ? ? 1_555 A CYS 30 SG ? ? A CYS 4 A CYS 30 1_555 ? ? ? ? ? ? ? 2.031 ? ? disulf2 disulf ? ? A CYS 12 SG ? ? ? 1_555 A CYS 26 SG ? ? A CYS 12 A CYS 26 1_555 ? ? ? ? ? ? ? 2.034 ? ? disulf3 disulf ? ? A CYS 16 SG ? ? ? 1_555 A CYS 22 SG ? ? A CYS 16 A CYS 22 1_555 ? ? ? ? ? ? ? 2.035 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 4 ? CYS A 30 ? CYS A 4 ? 1_555 CYS A 30 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 12 ? CYS A 26 ? CYS A 12 ? 1_555 CYS A 26 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 16 ? CYS A 22 ? CYS A 16 ? 1_555 CYS A 22 ? 1_555 SG SG . . . None 'Disulfide bridge' # _pdbx_entry_details.entry_id 9J5F _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 6 _pdbx_validate_close_contact.auth_atom_id_1 HG _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 SER _pdbx_validate_close_contact.auth_seq_id_1 2 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 LEU _pdbx_validate_close_contact.auth_seq_id_2 32 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.58 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 2 ? ? -68.20 -176.04 2 2 CYS A 12 ? ? -158.06 83.92 3 2 ASP A 14 ? ? -149.85 30.17 4 3 CYS A 12 ? ? -156.44 81.50 5 3 ASP A 14 ? ? -140.91 37.02 6 3 PRO A 23 ? ? -48.20 152.33 7 3 ASN A 28 ? ? -70.14 49.90 8 4 SER A 2 ? ? -67.81 -174.07 9 4 ASN A 28 ? ? -67.22 7.43 10 5 ASP A 14 ? ? -152.50 31.13 11 6 ASP A 14 ? ? -152.50 23.34 12 7 PRO A 31 ? ? -68.31 -163.86 13 8 SER A 2 ? ? -64.49 -172.67 14 8 ASP A 14 ? ? -140.03 21.78 15 8 ASN A 28 ? ? -65.76 63.38 16 8 PRO A 31 ? ? -68.39 56.56 17 9 PRO A 31 ? ? -54.15 100.35 18 11 SER A 2 ? ? -57.65 170.87 19 11 ASP A 14 ? ? -145.52 37.93 20 11 ASN A 28 ? ? -57.59 -5.22 21 12 CYS A 12 ? ? -158.39 85.68 22 12 ASP A 14 ? ? -142.09 29.73 23 12 ASN A 28 ? ? -70.11 29.02 24 13 CYS A 12 ? ? -155.93 76.31 25 13 ASN A 28 ? ? -71.11 39.67 26 14 SER A 2 ? ? -69.44 -173.88 27 14 CYS A 12 ? ? -156.53 77.75 28 14 ASN A 28 ? ? -72.67 34.30 29 15 SER A 2 ? ? -59.10 172.66 30 15 PRO A 23 ? ? -49.53 160.74 31 15 ASN A 28 ? ? -51.65 -9.85 # _pdbx_nmr_ensemble.entry_id 9J5F _pdbx_nmr_ensemble.conformers_calculated_total_number 150 _pdbx_nmr_ensemble.conformers_submitted_total_number 15 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 9J5F _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1 mM m1-2, 50% perdeuterated acetonitrile and 50% H2O' _pdbx_nmr_sample_details.solvent_system '50% perdeuterated acetonitrile and 50% H2O' _pdbx_nmr_sample_details.label m1-2 _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # _pdbx_nmr_exptl_sample.solution_id 1 _pdbx_nmr_exptl_sample.component m1-2 _pdbx_nmr_exptl_sample.concentration 1 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units 'Not defined' _pdbx_nmr_exptl_sample_conditions.label c1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-13C HSQC' 1 anisotropic 2 1 1 '2D 1H-15N HSQC' 1 anisotropic 3 1 1 '2D 1H-1H NOESY' 1 anisotropic 4 1 1 '2D 1H-1H TOCSY' 1 anisotropic # _pdbx_nmr_refine.entry_id 9J5F _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 2 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'chemical shift assignment' NMRFAM-SPARKY ? 'Lee W, Tonelli M, Markley JL' 2 'structure calculation' CNS ? 'Brunger, Adams, Clore, Gros, Nilges and Read' 3 refinement ARIA ? ;Linge, O'Donoghue and Nilges ; 4 processing TopSpin ? 'Bruker Biospin' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLU N N N N 88 GLU CA C N S 89 GLU C C N N 90 GLU O O N N 91 GLU CB C N N 92 GLU CG C N N 93 GLU CD C N N 94 GLU OE1 O N N 95 GLU OE2 O N N 96 GLU OXT O N N 97 GLU H H N N 98 GLU H2 H N N 99 GLU HA H N N 100 GLU HB2 H N N 101 GLU HB3 H N N 102 GLU HG2 H N N 103 GLU HG3 H N N 104 GLU HE2 H N N 105 GLU HXT H N N 106 GLY N N N N 107 GLY CA C N N 108 GLY C C N N 109 GLY O O N N 110 GLY OXT O N N 111 GLY H H N N 112 GLY H2 H N N 113 GLY HA2 H N N 114 GLY HA3 H N N 115 GLY HXT H N N 116 ILE N N N N 117 ILE CA C N S 118 ILE C C N N 119 ILE O O N N 120 ILE CB C N S 121 ILE CG1 C N N 122 ILE CG2 C N N 123 ILE CD1 C N N 124 ILE OXT O N N 125 ILE H H N N 126 ILE H2 H N N 127 ILE HA H N N 128 ILE HB H N N 129 ILE HG12 H N N 130 ILE HG13 H N N 131 ILE HG21 H N N 132 ILE HG22 H N N 133 ILE HG23 H N N 134 ILE HD11 H N N 135 ILE HD12 H N N 136 ILE HD13 H N N 137 ILE HXT H N N 138 LEU N N N N 139 LEU CA C N S 140 LEU C C N N 141 LEU O O N N 142 LEU CB C N N 143 LEU CG C N N 144 LEU CD1 C N N 145 LEU CD2 C N N 146 LEU OXT O N N 147 LEU H H N N 148 LEU H2 H N N 149 LEU HA H N N 150 LEU HB2 H N N 151 LEU HB3 H N N 152 LEU HG H N N 153 LEU HD11 H N N 154 LEU HD12 H N N 155 LEU HD13 H N N 156 LEU HD21 H N N 157 LEU HD22 H N N 158 LEU HD23 H N N 159 LEU HXT H N N 160 MET N N N N 161 MET CA C N S 162 MET C C N N 163 MET O O N N 164 MET CB C N N 165 MET CG C N N 166 MET SD S N N 167 MET CE C N N 168 MET OXT O N N 169 MET H H N N 170 MET H2 H N N 171 MET HA H N N 172 MET HB2 H N N 173 MET HB3 H N N 174 MET HG2 H N N 175 MET HG3 H N N 176 MET HE1 H N N 177 MET HE2 H N N 178 MET HE3 H N N 179 MET HXT H N N 180 PHE N N N N 181 PHE CA C N S 182 PHE C C N N 183 PHE O O N N 184 PHE CB C N N 185 PHE CG C Y N 186 PHE CD1 C Y N 187 PHE CD2 C Y N 188 PHE CE1 C Y N 189 PHE CE2 C Y N 190 PHE CZ C Y N 191 PHE OXT O N N 192 PHE H H N N 193 PHE H2 H N N 194 PHE HA H N N 195 PHE HB2 H N N 196 PHE HB3 H N N 197 PHE HD1 H N N 198 PHE HD2 H N N 199 PHE HE1 H N N 200 PHE HE2 H N N 201 PHE HZ H N N 202 PHE HXT H N N 203 PRO N N N N 204 PRO CA C N S 205 PRO C C N N 206 PRO O O N N 207 PRO CB C N N 208 PRO CG C N N 209 PRO CD C N N 210 PRO OXT O N N 211 PRO H H N N 212 PRO HA H N N 213 PRO HB2 H N N 214 PRO HB3 H N N 215 PRO HG2 H N N 216 PRO HG3 H N N 217 PRO HD2 H N N 218 PRO HD3 H N N 219 PRO HXT H N N 220 SER N N N N 221 SER CA C N S 222 SER C C N N 223 SER O O N N 224 SER CB C N N 225 SER OG O N N 226 SER OXT O N N 227 SER H H N N 228 SER H2 H N N 229 SER HA H N N 230 SER HB2 H N N 231 SER HB3 H N N 232 SER HG H N N 233 SER HXT H N N 234 THR N N N N 235 THR CA C N S 236 THR C C N N 237 THR O O N N 238 THR CB C N R 239 THR OG1 O N N 240 THR CG2 C N N 241 THR OXT O N N 242 THR H H N N 243 THR H2 H N N 244 THR HA H N N 245 THR HB H N N 246 THR HG1 H N N 247 THR HG21 H N N 248 THR HG22 H N N 249 THR HG23 H N N 250 THR HXT H N N 251 TRP N N N N 252 TRP CA C N S 253 TRP C C N N 254 TRP O O N N 255 TRP CB C N N 256 TRP CG C Y N 257 TRP CD1 C Y N 258 TRP CD2 C Y N 259 TRP NE1 N Y N 260 TRP CE2 C Y N 261 TRP CE3 C Y N 262 TRP CZ2 C Y N 263 TRP CZ3 C Y N 264 TRP CH2 C Y N 265 TRP OXT O N N 266 TRP H H N N 267 TRP H2 H N N 268 TRP HA H N N 269 TRP HB2 H N N 270 TRP HB3 H N N 271 TRP HD1 H N N 272 TRP HE1 H N N 273 TRP HE3 H N N 274 TRP HZ2 H N N 275 TRP HZ3 H N N 276 TRP HH2 H N N 277 TRP HXT H N N 278 TYR N N N N 279 TYR CA C N S 280 TYR C C N N 281 TYR O O N N 282 TYR CB C N N 283 TYR CG C Y N 284 TYR CD1 C Y N 285 TYR CD2 C Y N 286 TYR CE1 C Y N 287 TYR CE2 C Y N 288 TYR CZ C Y N 289 TYR OH O N N 290 TYR OXT O N N 291 TYR H H N N 292 TYR H2 H N N 293 TYR HA H N N 294 TYR HB2 H N N 295 TYR HB3 H N N 296 TYR HD1 H N N 297 TYR HD2 H N N 298 TYR HE1 H N N 299 TYR HE2 H N N 300 TYR HH H N N 301 TYR HXT H N N 302 VAL N N N N 303 VAL CA C N S 304 VAL C C N N 305 VAL O O N N 306 VAL CB C N N 307 VAL CG1 C N N 308 VAL CG2 C N N 309 VAL OXT O N N 310 VAL H H N N 311 VAL H2 H N N 312 VAL HA H N N 313 VAL HB H N N 314 VAL HG11 H N N 315 VAL HG12 H N N 316 VAL HG13 H N N 317 VAL HG21 H N N 318 VAL HG22 H N N 319 VAL HG23 H N N 320 VAL HXT H N N 321 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLU N CA sing N N 83 GLU N H sing N N 84 GLU N H2 sing N N 85 GLU CA C sing N N 86 GLU CA CB sing N N 87 GLU CA HA sing N N 88 GLU C O doub N N 89 GLU C OXT sing N N 90 GLU CB CG sing N N 91 GLU CB HB2 sing N N 92 GLU CB HB3 sing N N 93 GLU CG CD sing N N 94 GLU CG HG2 sing N N 95 GLU CG HG3 sing N N 96 GLU CD OE1 doub N N 97 GLU CD OE2 sing N N 98 GLU OE2 HE2 sing N N 99 GLU OXT HXT sing N N 100 GLY N CA sing N N 101 GLY N H sing N N 102 GLY N H2 sing N N 103 GLY CA C sing N N 104 GLY CA HA2 sing N N 105 GLY CA HA3 sing N N 106 GLY C O doub N N 107 GLY C OXT sing N N 108 GLY OXT HXT sing N N 109 ILE N CA sing N N 110 ILE N H sing N N 111 ILE N H2 sing N N 112 ILE CA C sing N N 113 ILE CA CB sing N N 114 ILE CA HA sing N N 115 ILE C O doub N N 116 ILE C OXT sing N N 117 ILE CB CG1 sing N N 118 ILE CB CG2 sing N N 119 ILE CB HB sing N N 120 ILE CG1 CD1 sing N N 121 ILE CG1 HG12 sing N N 122 ILE CG1 HG13 sing N N 123 ILE CG2 HG21 sing N N 124 ILE CG2 HG22 sing N N 125 ILE CG2 HG23 sing N N 126 ILE CD1 HD11 sing N N 127 ILE CD1 HD12 sing N N 128 ILE CD1 HD13 sing N N 129 ILE OXT HXT sing N N 130 LEU N CA sing N N 131 LEU N H sing N N 132 LEU N H2 sing N N 133 LEU CA C sing N N 134 LEU CA CB sing N N 135 LEU CA HA sing N N 136 LEU C O doub N N 137 LEU C OXT sing N N 138 LEU CB CG sing N N 139 LEU CB HB2 sing N N 140 LEU CB HB3 sing N N 141 LEU CG CD1 sing N N 142 LEU CG CD2 sing N N 143 LEU CG HG sing N N 144 LEU CD1 HD11 sing N N 145 LEU CD1 HD12 sing N N 146 LEU CD1 HD13 sing N N 147 LEU CD2 HD21 sing N N 148 LEU CD2 HD22 sing N N 149 LEU CD2 HD23 sing N N 150 LEU OXT HXT sing N N 151 MET N CA sing N N 152 MET N H sing N N 153 MET N H2 sing N N 154 MET CA C sing N N 155 MET CA CB sing N N 156 MET CA HA sing N N 157 MET C O doub N N 158 MET C OXT sing N N 159 MET CB CG sing N N 160 MET CB HB2 sing N N 161 MET CB HB3 sing N N 162 MET CG SD sing N N 163 MET CG HG2 sing N N 164 MET CG HG3 sing N N 165 MET SD CE sing N N 166 MET CE HE1 sing N N 167 MET CE HE2 sing N N 168 MET CE HE3 sing N N 169 MET OXT HXT sing N N 170 PHE N CA sing N N 171 PHE N H sing N N 172 PHE N H2 sing N N 173 PHE CA C sing N N 174 PHE CA CB sing N N 175 PHE CA HA sing N N 176 PHE C O doub N N 177 PHE C OXT sing N N 178 PHE CB CG sing N N 179 PHE CB HB2 sing N N 180 PHE CB HB3 sing N N 181 PHE CG CD1 doub Y N 182 PHE CG CD2 sing Y N 183 PHE CD1 CE1 sing Y N 184 PHE CD1 HD1 sing N N 185 PHE CD2 CE2 doub Y N 186 PHE CD2 HD2 sing N N 187 PHE CE1 CZ doub Y N 188 PHE CE1 HE1 sing N N 189 PHE CE2 CZ sing Y N 190 PHE CE2 HE2 sing N N 191 PHE CZ HZ sing N N 192 PHE OXT HXT sing N N 193 PRO N CA sing N N 194 PRO N CD sing N N 195 PRO N H sing N N 196 PRO CA C sing N N 197 PRO CA CB sing N N 198 PRO CA HA sing N N 199 PRO C O doub N N 200 PRO C OXT sing N N 201 PRO CB CG sing N N 202 PRO CB HB2 sing N N 203 PRO CB HB3 sing N N 204 PRO CG CD sing N N 205 PRO CG HG2 sing N N 206 PRO CG HG3 sing N N 207 PRO CD HD2 sing N N 208 PRO CD HD3 sing N N 209 PRO OXT HXT sing N N 210 SER N CA sing N N 211 SER N H sing N N 212 SER N H2 sing N N 213 SER CA C sing N N 214 SER CA CB sing N N 215 SER CA HA sing N N 216 SER C O doub N N 217 SER C OXT sing N N 218 SER CB OG sing N N 219 SER CB HB2 sing N N 220 SER CB HB3 sing N N 221 SER OG HG sing N N 222 SER OXT HXT sing N N 223 THR N CA sing N N 224 THR N H sing N N 225 THR N H2 sing N N 226 THR CA C sing N N 227 THR CA CB sing N N 228 THR CA HA sing N N 229 THR C O doub N N 230 THR C OXT sing N N 231 THR CB OG1 sing N N 232 THR CB CG2 sing N N 233 THR CB HB sing N N 234 THR OG1 HG1 sing N N 235 THR CG2 HG21 sing N N 236 THR CG2 HG22 sing N N 237 THR CG2 HG23 sing N N 238 THR OXT HXT sing N N 239 TRP N CA sing N N 240 TRP N H sing N N 241 TRP N H2 sing N N 242 TRP CA C sing N N 243 TRP CA CB sing N N 244 TRP CA HA sing N N 245 TRP C O doub N N 246 TRP C OXT sing N N 247 TRP CB CG sing N N 248 TRP CB HB2 sing N N 249 TRP CB HB3 sing N N 250 TRP CG CD1 doub Y N 251 TRP CG CD2 sing Y N 252 TRP CD1 NE1 sing Y N 253 TRP CD1 HD1 sing N N 254 TRP CD2 CE2 doub Y N 255 TRP CD2 CE3 sing Y N 256 TRP NE1 CE2 sing Y N 257 TRP NE1 HE1 sing N N 258 TRP CE2 CZ2 sing Y N 259 TRP CE3 CZ3 doub Y N 260 TRP CE3 HE3 sing N N 261 TRP CZ2 CH2 doub Y N 262 TRP CZ2 HZ2 sing N N 263 TRP CZ3 CH2 sing Y N 264 TRP CZ3 HZ3 sing N N 265 TRP CH2 HH2 sing N N 266 TRP OXT HXT sing N N 267 TYR N CA sing N N 268 TYR N H sing N N 269 TYR N H2 sing N N 270 TYR CA C sing N N 271 TYR CA CB sing N N 272 TYR CA HA sing N N 273 TYR C O doub N N 274 TYR C OXT sing N N 275 TYR CB CG sing N N 276 TYR CB HB2 sing N N 277 TYR CB HB3 sing N N 278 TYR CG CD1 doub Y N 279 TYR CG CD2 sing Y N 280 TYR CD1 CE1 sing Y N 281 TYR CD1 HD1 sing N N 282 TYR CD2 CE2 doub Y N 283 TYR CD2 HD2 sing N N 284 TYR CE1 CZ doub Y N 285 TYR CE1 HE1 sing N N 286 TYR CE2 CZ sing Y N 287 TYR CE2 HE2 sing N N 288 TYR CZ OH sing N N 289 TYR OH HH sing N N 290 TYR OXT HXT sing N N 291 VAL N CA sing N N 292 VAL N H sing N N 293 VAL N H2 sing N N 294 VAL CA C sing N N 295 VAL CA CB sing N N 296 VAL CA HA sing N N 297 VAL C O doub N N 298 VAL C OXT sing N N 299 VAL CB CG1 sing N N 300 VAL CB CG2 sing N N 301 VAL CB HB sing N N 302 VAL CG1 HG11 sing N N 303 VAL CG1 HG12 sing N N 304 VAL CG1 HG13 sing N N 305 VAL CG2 HG21 sing N N 306 VAL CG2 HG22 sing N N 307 VAL CG2 HG23 sing N N 308 VAL OXT HXT sing N N 309 # _pdbx_audit_support.funding_organization 'Other government' _pdbx_audit_support.country China _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE III' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 850 _pdbx_nmr_spectrometer.details ? # _atom_sites.entry_id 9J5F _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ #