data_9J6O # _entry.id 9J6O # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9J6O pdb_00009j6o 10.2210/pdb9j6o/pdb WWPDB D_1300050465 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2024-10-16 2 'Structure model' 1 1 2024-11-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation_author.identifier_ORCID' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9J6O _pdbx_database_status.recvd_initial_deposition_date 2024-08-16 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible N # _pdbx_contact_author.id 3 _pdbx_contact_author.email xu_yong@gibh.ac.cn _pdbx_contact_author.name_first Yong _pdbx_contact_author.name_last Xu _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-3601-0246 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Zhang, Y.' 1 ? 'Zhang, C.' 2 ? 'Chen, Z.' 3 ? 'Yang, H.' 4 ? 'Huang, X.' 5 ? 'Li, Y.' 6 ? 'Xu, Y.' 7 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Med.Chem. _citation.journal_id_ASTM JMCMAR _citation.journal_id_CSD 0151 _citation.journal_id_ISSN 0022-2623 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 67 _citation.language ? _citation.page_first 18606 _citation.page_last 18628 _citation.title ;Discovery of CZL-046 with an ( S )-3-Fluoropyrrolidin-2-one Scaffold as a p300 Bromodomain Inhibitor for the Treatment of Multiple Myeloma. ; _citation.year 2024 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.4c01984 _citation.pdbx_database_id_PubMed 39356741 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Chen, Z.' 1 ? primary 'Yang, H.' 2 ? primary 'Zhang, Y.' 3 ? primary 'Lyu, X.' 4 ? primary 'Shi, Q.' 5 ? primary 'Zhang, C.' 6 ? primary 'Wang, X.' 7 ? primary 'Wang, Z.' 8 ? primary 'Zhang, Y.' 9 ? primary 'Deng, Y.' 10 ? primary 'Wang, Y.' 11 ? primary 'Huang, Y.' 12 ? primary 'Xu, Y.' 13 ? primary 'Huang, X.' 14 ? primary 'Li, Y.' 15 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'CREB-binding protein' 15891.296 1 2.3.1.48 ? 'UNP RESIDUES 1081-1197' 'sequence from 1065-1080 are tags. MKKGHHHHHHLVPRGS' 2 non-polymer syn ;(3~{S},5~{S})-1-[3,4-bis(fluoranyl)phenyl]-5-[5-(3,5-dimethyl-1,2-oxazol-4-yl)-1-(4-methoxycyclohexyl)benzimidazol-2-yl]-3-fluoranyl-pyrrolidin-2-one ; 538.561 1 ? ? ? ? 3 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MKKGHHHHHHLVPRGSRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDT GQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG ; _entity_poly.pdbx_seq_one_letter_code_can ;MKKGHHHHHHLVPRGSRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDT GQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 ;(3~{S},5~{S})-1-[3,4-bis(fluoranyl)phenyl]-5-[5-(3,5-dimethyl-1,2-oxazol-4-yl)-1-(4-methoxycyclohexyl)benzimidazol-2-yl]-3-fluoranyl-pyrrolidin-2-one ; A1L3S 3 'CHLORIDE ION' CL # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LYS n 1 3 LYS n 1 4 GLY n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 LEU n 1 12 VAL n 1 13 PRO n 1 14 ARG n 1 15 GLY n 1 16 SER n 1 17 ARG n 1 18 LYS n 1 19 LYS n 1 20 ILE n 1 21 PHE n 1 22 LYS n 1 23 PRO n 1 24 GLU n 1 25 GLU n 1 26 LEU n 1 27 ARG n 1 28 GLN n 1 29 ALA n 1 30 LEU n 1 31 MET n 1 32 PRO n 1 33 THR n 1 34 LEU n 1 35 GLU n 1 36 ALA n 1 37 LEU n 1 38 TYR n 1 39 ARG n 1 40 GLN n 1 41 ASP n 1 42 PRO n 1 43 GLU n 1 44 SER n 1 45 LEU n 1 46 PRO n 1 47 PHE n 1 48 ARG n 1 49 GLN n 1 50 PRO n 1 51 VAL n 1 52 ASP n 1 53 PRO n 1 54 GLN n 1 55 LEU n 1 56 LEU n 1 57 GLY n 1 58 ILE n 1 59 PRO n 1 60 ASP n 1 61 TYR n 1 62 PHE n 1 63 ASP n 1 64 ILE n 1 65 VAL n 1 66 LYS n 1 67 ASN n 1 68 PRO n 1 69 MET n 1 70 ASP n 1 71 LEU n 1 72 SER n 1 73 THR n 1 74 ILE n 1 75 LYS n 1 76 ARG n 1 77 LYS n 1 78 LEU n 1 79 ASP n 1 80 THR n 1 81 GLY n 1 82 GLN n 1 83 TYR n 1 84 GLN n 1 85 GLU n 1 86 PRO n 1 87 TRP n 1 88 GLN n 1 89 TYR n 1 90 VAL n 1 91 ASP n 1 92 ASP n 1 93 VAL n 1 94 TRP n 1 95 LEU n 1 96 MET n 1 97 PHE n 1 98 ASN n 1 99 ASN n 1 100 ALA n 1 101 TRP n 1 102 LEU n 1 103 TYR n 1 104 ASN n 1 105 ARG n 1 106 LYS n 1 107 THR n 1 108 SER n 1 109 ARG n 1 110 VAL n 1 111 TYR n 1 112 LYS n 1 113 PHE n 1 114 CYS n 1 115 SER n 1 116 LYS n 1 117 LEU n 1 118 ALA n 1 119 GLU n 1 120 VAL n 1 121 PHE n 1 122 GLU n 1 123 GLN n 1 124 GLU n 1 125 ILE n 1 126 ASP n 1 127 PRO n 1 128 VAL n 1 129 MET n 1 130 GLN n 1 131 SER n 1 132 LEU n 1 133 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 133 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'CREBBP, CBP' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight A1L3S non-polymer . ;(3~{S},5~{S})-1-[3,4-bis(fluoranyl)phenyl]-5-[5-(3,5-dimethyl-1,2-oxazol-4-yl)-1-(4-methoxycyclohexyl)benzimidazol-2-yl]-3-fluoranyl-pyrrolidin-2-one ; ? 'C29 H29 F3 N4 O3' 538.561 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1065 ? ? ? A . n A 1 2 LYS 2 1066 ? ? ? A . n A 1 3 LYS 3 1067 ? ? ? A . n A 1 4 GLY 4 1068 ? ? ? A . n A 1 5 HIS 5 1069 ? ? ? A . n A 1 6 HIS 6 1070 ? ? ? A . n A 1 7 HIS 7 1071 1071 HIS HIS A . n A 1 8 HIS 8 1072 1072 HIS HIS A . n A 1 9 HIS 9 1073 1073 HIS HIS A . n A 1 10 HIS 10 1074 1074 HIS HIS A . n A 1 11 LEU 11 1075 ? ? ? A . n A 1 12 VAL 12 1076 ? ? ? A . n A 1 13 PRO 13 1077 ? ? ? A . n A 1 14 ARG 14 1078 ? ? ? A . n A 1 15 GLY 15 1079 ? ? ? A . n A 1 16 SER 16 1080 ? ? ? A . n A 1 17 ARG 17 1081 ? ? ? A . n A 1 18 LYS 18 1082 1082 LYS LYS A . n A 1 19 LYS 19 1083 1083 LYS LYS A . n A 1 20 ILE 20 1084 1084 ILE ILE A . n A 1 21 PHE 21 1085 1085 PHE PHE A . n A 1 22 LYS 22 1086 1086 LYS LYS A . n A 1 23 PRO 23 1087 1087 PRO PRO A . n A 1 24 GLU 24 1088 1088 GLU GLU A . n A 1 25 GLU 25 1089 1089 GLU GLU A . n A 1 26 LEU 26 1090 1090 LEU LEU A . n A 1 27 ARG 27 1091 1091 ARG ARG A . n A 1 28 GLN 28 1092 1092 GLN GLN A . n A 1 29 ALA 29 1093 1093 ALA ALA A . n A 1 30 LEU 30 1094 1094 LEU LEU A . n A 1 31 MET 31 1095 1095 MET MET A . n A 1 32 PRO 32 1096 1096 PRO PRO A . n A 1 33 THR 33 1097 1097 THR THR A . n A 1 34 LEU 34 1098 1098 LEU LEU A . n A 1 35 GLU 35 1099 1099 GLU GLU A . n A 1 36 ALA 36 1100 1100 ALA ALA A . n A 1 37 LEU 37 1101 1101 LEU LEU A . n A 1 38 TYR 38 1102 1102 TYR TYR A . n A 1 39 ARG 39 1103 1103 ARG ARG A . n A 1 40 GLN 40 1104 1104 GLN GLN A . n A 1 41 ASP 41 1105 1105 ASP ASP A . n A 1 42 PRO 42 1106 1106 PRO PRO A . n A 1 43 GLU 43 1107 1107 GLU GLU A . n A 1 44 SER 44 1108 1108 SER SER A . n A 1 45 LEU 45 1109 1109 LEU LEU A . n A 1 46 PRO 46 1110 1110 PRO PRO A . n A 1 47 PHE 47 1111 1111 PHE PHE A . n A 1 48 ARG 48 1112 1112 ARG ARG A . n A 1 49 GLN 49 1113 1113 GLN GLN A . n A 1 50 PRO 50 1114 1114 PRO PRO A . n A 1 51 VAL 51 1115 1115 VAL VAL A . n A 1 52 ASP 52 1116 1116 ASP ASP A . n A 1 53 PRO 53 1117 1117 PRO PRO A . n A 1 54 GLN 54 1118 1118 GLN GLN A . n A 1 55 LEU 55 1119 1119 LEU LEU A . n A 1 56 LEU 56 1120 1120 LEU LEU A . n A 1 57 GLY 57 1121 1121 GLY GLY A . n A 1 58 ILE 58 1122 1122 ILE ILE A . n A 1 59 PRO 59 1123 1123 PRO PRO A . n A 1 60 ASP 60 1124 1124 ASP ASP A . n A 1 61 TYR 61 1125 1125 TYR TYR A . n A 1 62 PHE 62 1126 1126 PHE PHE A . n A 1 63 ASP 63 1127 1127 ASP ASP A . n A 1 64 ILE 64 1128 1128 ILE ILE A . n A 1 65 VAL 65 1129 1129 VAL VAL A . n A 1 66 LYS 66 1130 1130 LYS LYS A . n A 1 67 ASN 67 1131 1131 ASN ASN A . n A 1 68 PRO 68 1132 1132 PRO PRO A . n A 1 69 MET 69 1133 1133 MET MET A . n A 1 70 ASP 70 1134 1134 ASP ASP A . n A 1 71 LEU 71 1135 1135 LEU LEU A . n A 1 72 SER 72 1136 1136 SER SER A . n A 1 73 THR 73 1137 1137 THR THR A . n A 1 74 ILE 74 1138 1138 ILE ILE A . n A 1 75 LYS 75 1139 1139 LYS LYS A . n A 1 76 ARG 76 1140 1140 ARG ARG A . n A 1 77 LYS 77 1141 1141 LYS LYS A . n A 1 78 LEU 78 1142 1142 LEU LEU A . n A 1 79 ASP 79 1143 1143 ASP ASP A . n A 1 80 THR 80 1144 1144 THR THR A . n A 1 81 GLY 81 1145 1145 GLY GLY A . n A 1 82 GLN 82 1146 1146 GLN GLN A . n A 1 83 TYR 83 1147 1147 TYR TYR A . n A 1 84 GLN 84 1148 1148 GLN GLN A . n A 1 85 GLU 85 1149 1149 GLU GLU A . n A 1 86 PRO 86 1150 1150 PRO PRO A . n A 1 87 TRP 87 1151 1151 TRP TRP A . n A 1 88 GLN 88 1152 1152 GLN GLN A . n A 1 89 TYR 89 1153 1153 TYR TYR A . n A 1 90 VAL 90 1154 1154 VAL VAL A . n A 1 91 ASP 91 1155 1155 ASP ASP A . n A 1 92 ASP 92 1156 1156 ASP ASP A . n A 1 93 VAL 93 1157 1157 VAL VAL A . n A 1 94 TRP 94 1158 1158 TRP TRP A . n A 1 95 LEU 95 1159 1159 LEU LEU A . n A 1 96 MET 96 1160 1160 MET MET A . n A 1 97 PHE 97 1161 1161 PHE PHE A . n A 1 98 ASN 98 1162 1162 ASN ASN A . n A 1 99 ASN 99 1163 1163 ASN ASN A . n A 1 100 ALA 100 1164 1164 ALA ALA A . n A 1 101 TRP 101 1165 1165 TRP TRP A . n A 1 102 LEU 102 1166 1166 LEU LEU A . n A 1 103 TYR 103 1167 1167 TYR TYR A . n A 1 104 ASN 104 1168 1168 ASN ASN A . n A 1 105 ARG 105 1169 1169 ARG ARG A . n A 1 106 LYS 106 1170 1170 LYS LYS A . n A 1 107 THR 107 1171 1171 THR THR A . n A 1 108 SER 108 1172 1172 SER SER A . n A 1 109 ARG 109 1173 1173 ARG ARG A . n A 1 110 VAL 110 1174 1174 VAL VAL A . n A 1 111 TYR 111 1175 1175 TYR TYR A . n A 1 112 LYS 112 1176 1176 LYS LYS A . n A 1 113 PHE 113 1177 1177 PHE PHE A . n A 1 114 CYS 114 1178 1178 CYS CYS A . n A 1 115 SER 115 1179 1179 SER SER A . n A 1 116 LYS 116 1180 1180 LYS LYS A . n A 1 117 LEU 117 1181 1181 LEU LEU A . n A 1 118 ALA 118 1182 1182 ALA ALA A . n A 1 119 GLU 119 1183 1183 GLU GLU A . n A 1 120 VAL 120 1184 1184 VAL VAL A . n A 1 121 PHE 121 1185 1185 PHE PHE A . n A 1 122 GLU 122 1186 1186 GLU GLU A . n A 1 123 GLN 123 1187 1187 GLN GLN A . n A 1 124 GLU 124 1188 1188 GLU GLU A . n A 1 125 ILE 125 1189 1189 ILE ILE A . n A 1 126 ASP 126 1190 1190 ASP ASP A . n A 1 127 PRO 127 1191 1191 PRO PRO A . n A 1 128 VAL 128 1192 1192 VAL VAL A . n A 1 129 MET 129 1193 1193 MET MET A . n A 1 130 GLN 130 1194 1194 GLN GLN A . n A 1 131 SER 131 1195 1195 SER SER A . n A 1 132 LEU 132 1196 1196 LEU LEU A . n A 1 133 GLY 133 1197 ? ? ? A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id A1L3S _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id A1L3S _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 A1L3S 1 1201 1201 A1L3S DRG A . C 3 CL 1 1202 1 CL CL A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A HIS 1071 ? CG ? A HIS 7 CG 2 1 Y 1 A HIS 1071 ? ND1 ? A HIS 7 ND1 3 1 Y 1 A HIS 1071 ? CD2 ? A HIS 7 CD2 4 1 Y 1 A HIS 1071 ? CE1 ? A HIS 7 CE1 5 1 Y 1 A HIS 1071 ? NE2 ? A HIS 7 NE2 6 1 Y 1 A HIS 1074 ? ND1 ? A HIS 10 ND1 7 1 Y 1 A HIS 1074 ? CD2 ? A HIS 10 CD2 8 1 Y 1 A HIS 1074 ? CE1 ? A HIS 10 CE1 9 1 Y 1 A HIS 1074 ? NE2 ? A HIS 10 NE2 10 1 Y 1 A LYS 1082 ? CG ? A LYS 18 CG 11 1 Y 1 A LYS 1082 ? CD ? A LYS 18 CD 12 1 Y 1 A LYS 1082 ? CE ? A LYS 18 CE 13 1 Y 1 A LYS 1082 ? NZ ? A LYS 18 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0258 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MERLOT ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 9J6O _cell.details ? _cell.formula_units_Z ? _cell.length_a 38.379 _cell.length_a_esd ? _cell.length_b 60.637 _cell.length_b_esd ? _cell.length_c 61.177 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9J6O _symmetry.cell_setting ? _symmetry.Int_Tables_number 18 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 2 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9J6O _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.24 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 45.08 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M Potassium sulfate, 20% w/v Polyethylene glycol 3,350' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 277 # _diffrn.ambient_environment ? _diffrn.ambient_temp 80 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2024-06-21 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97918 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL02U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97918 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL02U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 9J6O _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.67 _reflns.d_resolution_low 61.18 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 4375 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.6 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.8 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 9.3 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.97 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.178 _reflns.pdbx_Rpim_I_all 0.073 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 25281 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.992 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.162 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.67 _reflns_shell.d_res_low 2.80 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all 2861 _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 564 _reflns_shell.percent_possible_obs 99.8 _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 5.1 _reflns_shell.pdbx_chi_squared 0.78 _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs 2.7 _reflns_shell.pdbx_Rrim_I_all 0.732 _reflns_shell.pdbx_Rpim_I_all 0.323 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.820 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.654 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] -1.64 _refine.aniso_B[1][2] -0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][2] 2.98 _refine.aniso_B[2][3] -0.00 _refine.aniso_B[3][3] -1.34 _refine.B_iso_max ? _refine.B_iso_mean 39.397 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.914 _refine.correlation_coeff_Fo_to_Fc_free 0.882 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9J6O _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.67 _refine.ls_d_res_low 43.07 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 4082 _refine.ls_number_reflns_R_free 264 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.36 _refine.ls_percent_reflns_R_free 6.1 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.23803 _refine.ls_R_factor_R_free 0.28962 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.23438 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 7XH6 _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free 0.399 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 16.690 _refine.overall_SU_ML 0.335 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.details ? _refine_hist.d_res_high 2.67 _refine_hist.d_res_low 43.07 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1038 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 998 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 40 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.005 0.013 1070 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.002 0.018 964 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.306 1.720 1458 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.106 1.631 2248 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 5.454 5.000 117 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 38.845 23.051 59 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 18.111 15.000 180 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 18.517 15.000 6 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.051 0.200 130 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 0.020 1152 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 219 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 1.318 4.127 474 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 1.319 4.127 473 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 2.217 6.186 589 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 2.215 6.186 590 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 1.436 4.336 596 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 1.434 4.336 597 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 2.497 6.432 870 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 3.995 45.481 1180 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 3.994 45.470 1181 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.67 _refine_ls_shell.d_res_low 2.737 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 21 _refine_ls_shell.number_reflns_R_work 284 _refine_ls_shell.percent_reflns_obs 99.67 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.243 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used ? _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? _refine_ls_shell.R_factor_R_free 0.428 # _struct.entry_id 9J6O _struct.title 'Crystal Structure of bromodomain of human CBP in complex with the inhibitor CZL-046' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9J6O _struct_keywords.text 'bromodomain, CBP, inhibitor, PROTEIN BINDING' _struct_keywords.pdbx_keywords 'PROTEIN BINDING' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CBP_HUMAN _struct_ref.pdbx_db_accession Q92793 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;RKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLM FNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG ; _struct_ref.pdbx_align_begin 1081 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9J6O _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 17 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 133 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q92793 _struct_ref_seq.db_align_beg 1081 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1197 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1081 _struct_ref_seq.pdbx_auth_seq_align_end 1197 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9J6O MET A 1 ? UNP Q92793 ? ? 'expression tag' 1065 1 1 9J6O LYS A 2 ? UNP Q92793 ? ? 'expression tag' 1066 2 1 9J6O LYS A 3 ? UNP Q92793 ? ? 'expression tag' 1067 3 1 9J6O GLY A 4 ? UNP Q92793 ? ? 'expression tag' 1068 4 1 9J6O HIS A 5 ? UNP Q92793 ? ? 'expression tag' 1069 5 1 9J6O HIS A 6 ? UNP Q92793 ? ? 'expression tag' 1070 6 1 9J6O HIS A 7 ? UNP Q92793 ? ? 'expression tag' 1071 7 1 9J6O HIS A 8 ? UNP Q92793 ? ? 'expression tag' 1072 8 1 9J6O HIS A 9 ? UNP Q92793 ? ? 'expression tag' 1073 9 1 9J6O HIS A 10 ? UNP Q92793 ? ? 'expression tag' 1074 10 1 9J6O LEU A 11 ? UNP Q92793 ? ? 'expression tag' 1075 11 1 9J6O VAL A 12 ? UNP Q92793 ? ? 'expression tag' 1076 12 1 9J6O PRO A 13 ? UNP Q92793 ? ? 'expression tag' 1077 13 1 9J6O ARG A 14 ? UNP Q92793 ? ? 'expression tag' 1078 14 1 9J6O GLY A 15 ? UNP Q92793 ? ? 'expression tag' 1079 15 1 9J6O SER A 16 ? UNP Q92793 ? ? 'expression tag' 1080 16 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 70 ? 1 MORE -3 ? 1 'SSA (A^2)' 7610 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LYS A 22 ? GLN A 40 ? LYS A 1086 GLN A 1104 1 ? 19 HELX_P HELX_P2 AA2 SER A 44 ? ARG A 48 ? SER A 1108 ARG A 1112 5 ? 5 HELX_P HELX_P3 AA3 ASP A 60 ? ILE A 64 ? ASP A 1124 ILE A 1128 5 ? 5 HELX_P HELX_P4 AA4 ASP A 70 ? THR A 80 ? ASP A 1134 THR A 1144 1 ? 11 HELX_P HELX_P5 AA5 GLU A 85 ? ASN A 104 ? GLU A 1149 ASN A 1168 1 ? 20 HELX_P HELX_P6 AA6 SER A 108 ? SER A 131 ? SER A 1172 SER A 1195 1 ? 24 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ASP _struct_mon_prot_cis.label_seq_id 41 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ASP _struct_mon_prot_cis.auth_seq_id 1105 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 42 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 1106 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 5.61 # _pdbx_entry_details.entry_id 9J6O _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 1072 ? ? -162.13 113.46 2 1 PRO A 1123 ? ? -66.00 2.34 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1065 ? A MET 1 2 1 Y 1 A LYS 1066 ? A LYS 2 3 1 Y 1 A LYS 1067 ? A LYS 3 4 1 Y 1 A GLY 1068 ? A GLY 4 5 1 Y 1 A HIS 1069 ? A HIS 5 6 1 Y 1 A HIS 1070 ? A HIS 6 7 1 Y 1 A LEU 1075 ? A LEU 11 8 1 Y 1 A VAL 1076 ? A VAL 12 9 1 Y 1 A PRO 1077 ? A PRO 13 10 1 Y 1 A ARG 1078 ? A ARG 14 11 1 Y 1 A GLY 1079 ? A GLY 15 12 1 Y 1 A SER 1080 ? A SER 16 13 1 Y 1 A ARG 1081 ? A ARG 17 14 1 Y 1 A GLY 1197 ? A GLY 133 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal A1L3S CBG C N N 1 A1L3S CBH C N N 2 A1L3S CBI C N N 3 A1L3S OBL O N N 4 A1L3S CBM C N N 5 A1L3S CBJ C N N 6 A1L3S CBK C N N 7 A1L3S CAQ C N N 8 A1L3S NAP N Y N 9 A1L3S CAK C Y N 10 A1L3S CAL C Y N 11 A1L3S CAM C Y N 12 A1L3S CAH C Y N 13 A1L3S CAA C Y N 14 A1L3S CAE C Y N 15 A1L3S CAG C N N 16 A1L3S OAD O Y N 17 A1L3S NAC N Y N 18 A1L3S CAB C Y N 19 A1L3S CAF C N N 20 A1L3S CAI C Y N 21 A1L3S CAJ C Y N 22 A1L3S NAN N Y N 23 A1L3S CAO C Y N 24 A1L3S CAR C N S 25 A1L3S CAV C N N 26 A1L3S CAU C N S 27 A1L3S FBF F N N 28 A1L3S CAT C N N 29 A1L3S OAW O N N 30 A1L3S NAS N N N 31 A1L3S CAX C Y N 32 A1L3S CBC C Y N 33 A1L3S CBB C Y N 34 A1L3S FBE F N N 35 A1L3S CBA C Y N 36 A1L3S FBD F N N 37 A1L3S CAZ C Y N 38 A1L3S CAY C Y N 39 A1L3S H1 H N N 40 A1L3S H2 H N N 41 A1L3S H3 H N N 42 A1L3S H4 H N N 43 A1L3S H5 H N N 44 A1L3S H6 H N N 45 A1L3S H7 H N N 46 A1L3S H8 H N N 47 A1L3S H9 H N N 48 A1L3S H10 H N N 49 A1L3S H11 H N N 50 A1L3S H12 H N N 51 A1L3S H13 H N N 52 A1L3S H14 H N N 53 A1L3S H15 H N N 54 A1L3S H16 H N N 55 A1L3S H17 H N N 56 A1L3S H18 H N N 57 A1L3S H19 H N N 58 A1L3S H20 H N N 59 A1L3S H21 H N N 60 A1L3S H22 H N N 61 A1L3S H23 H N N 62 A1L3S H24 H N N 63 A1L3S H25 H N N 64 A1L3S H26 H N N 65 A1L3S H27 H N N 66 A1L3S H28 H N N 67 A1L3S H29 H N N 68 ALA N N N N 69 ALA CA C N S 70 ALA C C N N 71 ALA O O N N 72 ALA CB C N N 73 ALA OXT O N N 74 ALA H H N N 75 ALA H2 H N N 76 ALA HA H N N 77 ALA HB1 H N N 78 ALA HB2 H N N 79 ALA HB3 H N N 80 ALA HXT H N N 81 ARG N N N N 82 ARG CA C N S 83 ARG C C N N 84 ARG O O N N 85 ARG CB C N N 86 ARG CG C N N 87 ARG CD C N N 88 ARG NE N N N 89 ARG CZ C N N 90 ARG NH1 N N N 91 ARG NH2 N N N 92 ARG OXT O N N 93 ARG H H N N 94 ARG H2 H N N 95 ARG HA H N N 96 ARG HB2 H N N 97 ARG HB3 H N N 98 ARG HG2 H N N 99 ARG HG3 H N N 100 ARG HD2 H N N 101 ARG HD3 H N N 102 ARG HE H N N 103 ARG HH11 H N N 104 ARG HH12 H N N 105 ARG HH21 H N N 106 ARG HH22 H N N 107 ARG HXT H N N 108 ASN N N N N 109 ASN CA C N S 110 ASN C C N N 111 ASN O O N N 112 ASN CB C N N 113 ASN CG C N N 114 ASN OD1 O N N 115 ASN ND2 N N N 116 ASN OXT O N N 117 ASN H H N N 118 ASN H2 H N N 119 ASN HA H N N 120 ASN HB2 H N N 121 ASN HB3 H N N 122 ASN HD21 H N N 123 ASN HD22 H N N 124 ASN HXT H N N 125 ASP N N N N 126 ASP CA C N S 127 ASP C C N N 128 ASP O O N N 129 ASP CB C N N 130 ASP CG C N N 131 ASP OD1 O N N 132 ASP OD2 O N N 133 ASP OXT O N N 134 ASP H H N N 135 ASP H2 H N N 136 ASP HA H N N 137 ASP HB2 H N N 138 ASP HB3 H N N 139 ASP HD2 H N N 140 ASP HXT H N N 141 CL CL CL N N 142 CYS N N N N 143 CYS CA C N R 144 CYS C C N N 145 CYS O O N N 146 CYS CB C N N 147 CYS SG S N N 148 CYS OXT O N N 149 CYS H H N N 150 CYS H2 H N N 151 CYS HA H N N 152 CYS HB2 H N N 153 CYS HB3 H N N 154 CYS HG H N N 155 CYS HXT H N N 156 GLN N N N N 157 GLN CA C N S 158 GLN C C N N 159 GLN O O N N 160 GLN CB C N N 161 GLN CG C N N 162 GLN CD C N N 163 GLN OE1 O N N 164 GLN NE2 N N N 165 GLN OXT O N N 166 GLN H H N N 167 GLN H2 H N N 168 GLN HA H N N 169 GLN HB2 H N N 170 GLN HB3 H N N 171 GLN HG2 H N N 172 GLN HG3 H N N 173 GLN HE21 H N N 174 GLN HE22 H N N 175 GLN HXT H N N 176 GLU N N N N 177 GLU CA C N S 178 GLU C C N N 179 GLU O O N N 180 GLU CB C N N 181 GLU CG C N N 182 GLU CD C N N 183 GLU OE1 O N N 184 GLU OE2 O N N 185 GLU OXT O N N 186 GLU H H N N 187 GLU H2 H N N 188 GLU HA H N N 189 GLU HB2 H N N 190 GLU HB3 H N N 191 GLU HG2 H N N 192 GLU HG3 H N N 193 GLU HE2 H N N 194 GLU HXT H N N 195 GLY N N N N 196 GLY CA C N N 197 GLY C C N N 198 GLY O O N N 199 GLY OXT O N N 200 GLY H H N N 201 GLY H2 H N N 202 GLY HA2 H N N 203 GLY HA3 H N N 204 GLY HXT H N N 205 HIS N N N N 206 HIS CA C N S 207 HIS C C N N 208 HIS O O N N 209 HIS CB C N N 210 HIS CG C Y N 211 HIS ND1 N Y N 212 HIS CD2 C Y N 213 HIS CE1 C Y N 214 HIS NE2 N Y N 215 HIS OXT O N N 216 HIS H H N N 217 HIS H2 H N N 218 HIS HA H N N 219 HIS HB2 H N N 220 HIS HB3 H N N 221 HIS HD1 H N N 222 HIS HD2 H N N 223 HIS HE1 H N N 224 HIS HE2 H N N 225 HIS HXT H N N 226 ILE N N N N 227 ILE CA C N S 228 ILE C C N N 229 ILE O O N N 230 ILE CB C N S 231 ILE CG1 C N N 232 ILE CG2 C N N 233 ILE CD1 C N N 234 ILE OXT O N N 235 ILE H H N N 236 ILE H2 H N N 237 ILE HA H N N 238 ILE HB H N N 239 ILE HG12 H N N 240 ILE HG13 H N N 241 ILE HG21 H N N 242 ILE HG22 H N N 243 ILE HG23 H N N 244 ILE HD11 H N N 245 ILE HD12 H N N 246 ILE HD13 H N N 247 ILE HXT H N N 248 LEU N N N N 249 LEU CA C N S 250 LEU C C N N 251 LEU O O N N 252 LEU CB C N N 253 LEU CG C N N 254 LEU CD1 C N N 255 LEU CD2 C N N 256 LEU OXT O N N 257 LEU H H N N 258 LEU H2 H N N 259 LEU HA H N N 260 LEU HB2 H N N 261 LEU HB3 H N N 262 LEU HG H N N 263 LEU HD11 H N N 264 LEU HD12 H N N 265 LEU HD13 H N N 266 LEU HD21 H N N 267 LEU HD22 H N N 268 LEU HD23 H N N 269 LEU HXT H N N 270 LYS N N N N 271 LYS CA C N S 272 LYS C C N N 273 LYS O O N N 274 LYS CB C N N 275 LYS CG C N N 276 LYS CD C N N 277 LYS CE C N N 278 LYS NZ N N N 279 LYS OXT O N N 280 LYS H H N N 281 LYS H2 H N N 282 LYS HA H N N 283 LYS HB2 H N N 284 LYS HB3 H N N 285 LYS HG2 H N N 286 LYS HG3 H N N 287 LYS HD2 H N N 288 LYS HD3 H N N 289 LYS HE2 H N N 290 LYS HE3 H N N 291 LYS HZ1 H N N 292 LYS HZ2 H N N 293 LYS HZ3 H N N 294 LYS HXT H N N 295 MET N N N N 296 MET CA C N S 297 MET C C N N 298 MET O O N N 299 MET CB C N N 300 MET CG C N N 301 MET SD S N N 302 MET CE C N N 303 MET OXT O N N 304 MET H H N N 305 MET H2 H N N 306 MET HA H N N 307 MET HB2 H N N 308 MET HB3 H N N 309 MET HG2 H N N 310 MET HG3 H N N 311 MET HE1 H N N 312 MET HE2 H N N 313 MET HE3 H N N 314 MET HXT H N N 315 PHE N N N N 316 PHE CA C N S 317 PHE C C N N 318 PHE O O N N 319 PHE CB C N N 320 PHE CG C Y N 321 PHE CD1 C Y N 322 PHE CD2 C Y N 323 PHE CE1 C Y N 324 PHE CE2 C Y N 325 PHE CZ C Y N 326 PHE OXT O N N 327 PHE H H N N 328 PHE H2 H N N 329 PHE HA H N N 330 PHE HB2 H N N 331 PHE HB3 H N N 332 PHE HD1 H N N 333 PHE HD2 H N N 334 PHE HE1 H N N 335 PHE HE2 H N N 336 PHE HZ H N N 337 PHE HXT H N N 338 PRO N N N N 339 PRO CA C N S 340 PRO C C N N 341 PRO O O N N 342 PRO CB C N N 343 PRO CG C N N 344 PRO CD C N N 345 PRO OXT O N N 346 PRO H H N N 347 PRO HA H N N 348 PRO HB2 H N N 349 PRO HB3 H N N 350 PRO HG2 H N N 351 PRO HG3 H N N 352 PRO HD2 H N N 353 PRO HD3 H N N 354 PRO HXT H N N 355 SER N N N N 356 SER CA C N S 357 SER C C N N 358 SER O O N N 359 SER CB C N N 360 SER OG O N N 361 SER OXT O N N 362 SER H H N N 363 SER H2 H N N 364 SER HA H N N 365 SER HB2 H N N 366 SER HB3 H N N 367 SER HG H N N 368 SER HXT H N N 369 THR N N N N 370 THR CA C N S 371 THR C C N N 372 THR O O N N 373 THR CB C N R 374 THR OG1 O N N 375 THR CG2 C N N 376 THR OXT O N N 377 THR H H N N 378 THR H2 H N N 379 THR HA H N N 380 THR HB H N N 381 THR HG1 H N N 382 THR HG21 H N N 383 THR HG22 H N N 384 THR HG23 H N N 385 THR HXT H N N 386 TRP N N N N 387 TRP CA C N S 388 TRP C C N N 389 TRP O O N N 390 TRP CB C N N 391 TRP CG C Y N 392 TRP CD1 C Y N 393 TRP CD2 C Y N 394 TRP NE1 N Y N 395 TRP CE2 C Y N 396 TRP CE3 C Y N 397 TRP CZ2 C Y N 398 TRP CZ3 C Y N 399 TRP CH2 C Y N 400 TRP OXT O N N 401 TRP H H N N 402 TRP H2 H N N 403 TRP HA H N N 404 TRP HB2 H N N 405 TRP HB3 H N N 406 TRP HD1 H N N 407 TRP HE1 H N N 408 TRP HE3 H N N 409 TRP HZ2 H N N 410 TRP HZ3 H N N 411 TRP HH2 H N N 412 TRP HXT H N N 413 TYR N N N N 414 TYR CA C N S 415 TYR C C N N 416 TYR O O N N 417 TYR CB C N N 418 TYR CG C Y N 419 TYR CD1 C Y N 420 TYR CD2 C Y N 421 TYR CE1 C Y N 422 TYR CE2 C Y N 423 TYR CZ C Y N 424 TYR OH O N N 425 TYR OXT O N N 426 TYR H H N N 427 TYR H2 H N N 428 TYR HA H N N 429 TYR HB2 H N N 430 TYR HB3 H N N 431 TYR HD1 H N N 432 TYR HD2 H N N 433 TYR HE1 H N N 434 TYR HE2 H N N 435 TYR HH H N N 436 TYR HXT H N N 437 VAL N N N N 438 VAL CA C N S 439 VAL C C N N 440 VAL O O N N 441 VAL CB C N N 442 VAL CG1 C N N 443 VAL CG2 C N N 444 VAL OXT O N N 445 VAL H H N N 446 VAL H2 H N N 447 VAL HA H N N 448 VAL HB H N N 449 VAL HG11 H N N 450 VAL HG12 H N N 451 VAL HG13 H N N 452 VAL HG21 H N N 453 VAL HG22 H N N 454 VAL HG23 H N N 455 VAL HXT H N N 456 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal A1L3S CAF CAB sing N N 1 A1L3S NAC CAB doub Y N 2 A1L3S NAC OAD sing Y N 3 A1L3S CAB CAA sing Y N 4 A1L3S FBD CBA sing N N 5 A1L3S CBM OBL sing N N 6 A1L3S FBE CBB sing N N 7 A1L3S OAD CAE sing Y N 8 A1L3S CAM CAH doub Y N 9 A1L3S CAM CAL sing Y N 10 A1L3S CAA CAH sing N N 11 A1L3S CAA CAE doub Y N 12 A1L3S CBA CBB doub Y N 13 A1L3S CBA CAZ sing Y N 14 A1L3S OBL CBI sing N N 15 A1L3S CBB CBC sing Y N 16 A1L3S CAH CAI sing Y N 17 A1L3S CAL CAK doub Y N 18 A1L3S CBI CBH sing N N 19 A1L3S CBI CBJ sing N N 20 A1L3S CBH CBG sing N N 21 A1L3S CBG CAQ sing N N 22 A1L3S CAE CAG sing N N 23 A1L3S CAZ CAY doub Y N 24 A1L3S CAK CAJ sing Y N 25 A1L3S CAK NAP sing Y N 26 A1L3S CAI CAJ doub Y N 27 A1L3S CBC CAX doub Y N 28 A1L3S CBJ CBK sing N N 29 A1L3S CAQ CBK sing N N 30 A1L3S CAQ NAP sing N N 31 A1L3S CAJ NAN sing Y N 32 A1L3S NAP CAO sing Y N 33 A1L3S CAY CAX sing Y N 34 A1L3S CAX NAS sing N N 35 A1L3S NAN CAO doub Y N 36 A1L3S CAO CAR sing N N 37 A1L3S NAS CAR sing N N 38 A1L3S NAS CAT sing N N 39 A1L3S CAR CAV sing N N 40 A1L3S OAW CAT doub N N 41 A1L3S CAT CAU sing N N 42 A1L3S CAV CAU sing N N 43 A1L3S FBF CAU sing N N 44 A1L3S CBG H1 sing N N 45 A1L3S CBG H2 sing N N 46 A1L3S CBH H3 sing N N 47 A1L3S CBH H4 sing N N 48 A1L3S CBI H5 sing N N 49 A1L3S CBM H6 sing N N 50 A1L3S CBM H7 sing N N 51 A1L3S CBM H8 sing N N 52 A1L3S CBJ H9 sing N N 53 A1L3S CBJ H10 sing N N 54 A1L3S CBK H11 sing N N 55 A1L3S CBK H12 sing N N 56 A1L3S CAQ H13 sing N N 57 A1L3S CAL H14 sing N N 58 A1L3S CAM H15 sing N N 59 A1L3S CAG H16 sing N N 60 A1L3S CAG H17 sing N N 61 A1L3S CAG H18 sing N N 62 A1L3S CAF H19 sing N N 63 A1L3S CAF H20 sing N N 64 A1L3S CAF H21 sing N N 65 A1L3S CAI H22 sing N N 66 A1L3S CAR H23 sing N N 67 A1L3S CAV H24 sing N N 68 A1L3S CAV H25 sing N N 69 A1L3S CAU H26 sing N N 70 A1L3S CBC H27 sing N N 71 A1L3S CAZ H28 sing N N 72 A1L3S CAY H29 sing N N 73 ALA N CA sing N N 74 ALA N H sing N N 75 ALA N H2 sing N N 76 ALA CA C sing N N 77 ALA CA CB sing N N 78 ALA CA HA sing N N 79 ALA C O doub N N 80 ALA C OXT sing N N 81 ALA CB HB1 sing N N 82 ALA CB HB2 sing N N 83 ALA CB HB3 sing N N 84 ALA OXT HXT sing N N 85 ARG N CA sing N N 86 ARG N H sing N N 87 ARG N H2 sing N N 88 ARG CA C sing N N 89 ARG CA CB sing N N 90 ARG CA HA sing N N 91 ARG C O doub N N 92 ARG C OXT sing N N 93 ARG CB CG sing N N 94 ARG CB HB2 sing N N 95 ARG CB HB3 sing N N 96 ARG CG CD sing N N 97 ARG CG HG2 sing N N 98 ARG CG HG3 sing N N 99 ARG CD NE sing N N 100 ARG CD HD2 sing N N 101 ARG CD HD3 sing N N 102 ARG NE CZ sing N N 103 ARG NE HE sing N N 104 ARG CZ NH1 sing N N 105 ARG CZ NH2 doub N N 106 ARG NH1 HH11 sing N N 107 ARG NH1 HH12 sing N N 108 ARG NH2 HH21 sing N N 109 ARG NH2 HH22 sing N N 110 ARG OXT HXT sing N N 111 ASN N CA sing N N 112 ASN N H sing N N 113 ASN N H2 sing N N 114 ASN CA C sing N N 115 ASN CA CB sing N N 116 ASN CA HA sing N N 117 ASN C O doub N N 118 ASN C OXT sing N N 119 ASN CB CG sing N N 120 ASN CB HB2 sing N N 121 ASN CB HB3 sing N N 122 ASN CG OD1 doub N N 123 ASN CG ND2 sing N N 124 ASN ND2 HD21 sing N N 125 ASN ND2 HD22 sing N N 126 ASN OXT HXT sing N N 127 ASP N CA sing N N 128 ASP N H sing N N 129 ASP N H2 sing N N 130 ASP CA C sing N N 131 ASP CA CB sing N N 132 ASP CA HA sing N N 133 ASP C O doub N N 134 ASP C OXT sing N N 135 ASP CB CG sing N N 136 ASP CB HB2 sing N N 137 ASP CB HB3 sing N N 138 ASP CG OD1 doub N N 139 ASP CG OD2 sing N N 140 ASP OD2 HD2 sing N N 141 ASP OXT HXT sing N N 142 CYS N CA sing N N 143 CYS N H sing N N 144 CYS N H2 sing N N 145 CYS CA C sing N N 146 CYS CA CB sing N N 147 CYS CA HA sing N N 148 CYS C O doub N N 149 CYS C OXT sing N N 150 CYS CB SG sing N N 151 CYS CB HB2 sing N N 152 CYS CB HB3 sing N N 153 CYS SG HG sing N N 154 CYS OXT HXT sing N N 155 GLN N CA sing N N 156 GLN N H sing N N 157 GLN N H2 sing N N 158 GLN CA C sing N N 159 GLN CA CB sing N N 160 GLN CA HA sing N N 161 GLN C O doub N N 162 GLN C OXT sing N N 163 GLN CB CG sing N N 164 GLN CB HB2 sing N N 165 GLN CB HB3 sing N N 166 GLN CG CD sing N N 167 GLN CG HG2 sing N N 168 GLN CG HG3 sing N N 169 GLN CD OE1 doub N N 170 GLN CD NE2 sing N N 171 GLN NE2 HE21 sing N N 172 GLN NE2 HE22 sing N N 173 GLN OXT HXT sing N N 174 GLU N CA sing N N 175 GLU N H sing N N 176 GLU N H2 sing N N 177 GLU CA C sing N N 178 GLU CA CB sing N N 179 GLU CA HA sing N N 180 GLU C O doub N N 181 GLU C OXT sing N N 182 GLU CB CG sing N N 183 GLU CB HB2 sing N N 184 GLU CB HB3 sing N N 185 GLU CG CD sing N N 186 GLU CG HG2 sing N N 187 GLU CG HG3 sing N N 188 GLU CD OE1 doub N N 189 GLU CD OE2 sing N N 190 GLU OE2 HE2 sing N N 191 GLU OXT HXT sing N N 192 GLY N CA sing N N 193 GLY N H sing N N 194 GLY N H2 sing N N 195 GLY CA C sing N N 196 GLY CA HA2 sing N N 197 GLY CA HA3 sing N N 198 GLY C O doub N N 199 GLY C OXT sing N N 200 GLY OXT HXT sing N N 201 HIS N CA sing N N 202 HIS N H sing N N 203 HIS N H2 sing N N 204 HIS CA C sing N N 205 HIS CA CB sing N N 206 HIS CA HA sing N N 207 HIS C O doub N N 208 HIS C OXT sing N N 209 HIS CB CG sing N N 210 HIS CB HB2 sing N N 211 HIS CB HB3 sing N N 212 HIS CG ND1 sing Y N 213 HIS CG CD2 doub Y N 214 HIS ND1 CE1 doub Y N 215 HIS ND1 HD1 sing N N 216 HIS CD2 NE2 sing Y N 217 HIS CD2 HD2 sing N N 218 HIS CE1 NE2 sing Y N 219 HIS CE1 HE1 sing N N 220 HIS NE2 HE2 sing N N 221 HIS OXT HXT sing N N 222 ILE N CA sing N N 223 ILE N H sing N N 224 ILE N H2 sing N N 225 ILE CA C sing N N 226 ILE CA CB sing N N 227 ILE CA HA sing N N 228 ILE C O doub N N 229 ILE C OXT sing N N 230 ILE CB CG1 sing N N 231 ILE CB CG2 sing N N 232 ILE CB HB sing N N 233 ILE CG1 CD1 sing N N 234 ILE CG1 HG12 sing N N 235 ILE CG1 HG13 sing N N 236 ILE CG2 HG21 sing N N 237 ILE CG2 HG22 sing N N 238 ILE CG2 HG23 sing N N 239 ILE CD1 HD11 sing N N 240 ILE CD1 HD12 sing N N 241 ILE CD1 HD13 sing N N 242 ILE OXT HXT sing N N 243 LEU N CA sing N N 244 LEU N H sing N N 245 LEU N H2 sing N N 246 LEU CA C sing N N 247 LEU CA CB sing N N 248 LEU CA HA sing N N 249 LEU C O doub N N 250 LEU C OXT sing N N 251 LEU CB CG sing N N 252 LEU CB HB2 sing N N 253 LEU CB HB3 sing N N 254 LEU CG CD1 sing N N 255 LEU CG CD2 sing N N 256 LEU CG HG sing N N 257 LEU CD1 HD11 sing N N 258 LEU CD1 HD12 sing N N 259 LEU CD1 HD13 sing N N 260 LEU CD2 HD21 sing N N 261 LEU CD2 HD22 sing N N 262 LEU CD2 HD23 sing N N 263 LEU OXT HXT sing N N 264 LYS N CA sing N N 265 LYS N H sing N N 266 LYS N H2 sing N N 267 LYS CA C sing N N 268 LYS CA CB sing N N 269 LYS CA HA sing N N 270 LYS C O doub N N 271 LYS C OXT sing N N 272 LYS CB CG sing N N 273 LYS CB HB2 sing N N 274 LYS CB HB3 sing N N 275 LYS CG CD sing N N 276 LYS CG HG2 sing N N 277 LYS CG HG3 sing N N 278 LYS CD CE sing N N 279 LYS CD HD2 sing N N 280 LYS CD HD3 sing N N 281 LYS CE NZ sing N N 282 LYS CE HE2 sing N N 283 LYS CE HE3 sing N N 284 LYS NZ HZ1 sing N N 285 LYS NZ HZ2 sing N N 286 LYS NZ HZ3 sing N N 287 LYS OXT HXT sing N N 288 MET N CA sing N N 289 MET N H sing N N 290 MET N H2 sing N N 291 MET CA C sing N N 292 MET CA CB sing N N 293 MET CA HA sing N N 294 MET C O doub N N 295 MET C OXT sing N N 296 MET CB CG sing N N 297 MET CB HB2 sing N N 298 MET CB HB3 sing N N 299 MET CG SD sing N N 300 MET CG HG2 sing N N 301 MET CG HG3 sing N N 302 MET SD CE sing N N 303 MET CE HE1 sing N N 304 MET CE HE2 sing N N 305 MET CE HE3 sing N N 306 MET OXT HXT sing N N 307 PHE N CA sing N N 308 PHE N H sing N N 309 PHE N H2 sing N N 310 PHE CA C sing N N 311 PHE CA CB sing N N 312 PHE CA HA sing N N 313 PHE C O doub N N 314 PHE C OXT sing N N 315 PHE CB CG sing N N 316 PHE CB HB2 sing N N 317 PHE CB HB3 sing N N 318 PHE CG CD1 doub Y N 319 PHE CG CD2 sing Y N 320 PHE CD1 CE1 sing Y N 321 PHE CD1 HD1 sing N N 322 PHE CD2 CE2 doub Y N 323 PHE CD2 HD2 sing N N 324 PHE CE1 CZ doub Y N 325 PHE CE1 HE1 sing N N 326 PHE CE2 CZ sing Y N 327 PHE CE2 HE2 sing N N 328 PHE CZ HZ sing N N 329 PHE OXT HXT sing N N 330 PRO N CA sing N N 331 PRO N CD sing N N 332 PRO N H sing N N 333 PRO CA C sing N N 334 PRO CA CB sing N N 335 PRO CA HA sing N N 336 PRO C O doub N N 337 PRO C OXT sing N N 338 PRO CB CG sing N N 339 PRO CB HB2 sing N N 340 PRO CB HB3 sing N N 341 PRO CG CD sing N N 342 PRO CG HG2 sing N N 343 PRO CG HG3 sing N N 344 PRO CD HD2 sing N N 345 PRO CD HD3 sing N N 346 PRO OXT HXT sing N N 347 SER N CA sing N N 348 SER N H sing N N 349 SER N H2 sing N N 350 SER CA C sing N N 351 SER CA CB sing N N 352 SER CA HA sing N N 353 SER C O doub N N 354 SER C OXT sing N N 355 SER CB OG sing N N 356 SER CB HB2 sing N N 357 SER CB HB3 sing N N 358 SER OG HG sing N N 359 SER OXT HXT sing N N 360 THR N CA sing N N 361 THR N H sing N N 362 THR N H2 sing N N 363 THR CA C sing N N 364 THR CA CB sing N N 365 THR CA HA sing N N 366 THR C O doub N N 367 THR C OXT sing N N 368 THR CB OG1 sing N N 369 THR CB CG2 sing N N 370 THR CB HB sing N N 371 THR OG1 HG1 sing N N 372 THR CG2 HG21 sing N N 373 THR CG2 HG22 sing N N 374 THR CG2 HG23 sing N N 375 THR OXT HXT sing N N 376 TRP N CA sing N N 377 TRP N H sing N N 378 TRP N H2 sing N N 379 TRP CA C sing N N 380 TRP CA CB sing N N 381 TRP CA HA sing N N 382 TRP C O doub N N 383 TRP C OXT sing N N 384 TRP CB CG sing N N 385 TRP CB HB2 sing N N 386 TRP CB HB3 sing N N 387 TRP CG CD1 doub Y N 388 TRP CG CD2 sing Y N 389 TRP CD1 NE1 sing Y N 390 TRP CD1 HD1 sing N N 391 TRP CD2 CE2 doub Y N 392 TRP CD2 CE3 sing Y N 393 TRP NE1 CE2 sing Y N 394 TRP NE1 HE1 sing N N 395 TRP CE2 CZ2 sing Y N 396 TRP CE3 CZ3 doub Y N 397 TRP CE3 HE3 sing N N 398 TRP CZ2 CH2 doub Y N 399 TRP CZ2 HZ2 sing N N 400 TRP CZ3 CH2 sing Y N 401 TRP CZ3 HZ3 sing N N 402 TRP CH2 HH2 sing N N 403 TRP OXT HXT sing N N 404 TYR N CA sing N N 405 TYR N H sing N N 406 TYR N H2 sing N N 407 TYR CA C sing N N 408 TYR CA CB sing N N 409 TYR CA HA sing N N 410 TYR C O doub N N 411 TYR C OXT sing N N 412 TYR CB CG sing N N 413 TYR CB HB2 sing N N 414 TYR CB HB3 sing N N 415 TYR CG CD1 doub Y N 416 TYR CG CD2 sing Y N 417 TYR CD1 CE1 sing Y N 418 TYR CD1 HD1 sing N N 419 TYR CD2 CE2 doub Y N 420 TYR CD2 HD2 sing N N 421 TYR CE1 CZ doub Y N 422 TYR CE1 HE1 sing N N 423 TYR CE2 CZ sing Y N 424 TYR CE2 HE2 sing N N 425 TYR CZ OH sing N N 426 TYR OH HH sing N N 427 TYR OXT HXT sing N N 428 VAL N CA sing N N 429 VAL N H sing N N 430 VAL N H2 sing N N 431 VAL CA C sing N N 432 VAL CA CB sing N N 433 VAL CA HA sing N N 434 VAL C O doub N N 435 VAL C OXT sing N N 436 VAL CB CG1 sing N N 437 VAL CB CG2 sing N N 438 VAL CB HB sing N N 439 VAL CG1 HG11 sing N N 440 VAL CG1 HG12 sing N N 441 VAL CG1 HG13 sing N N 442 VAL CG2 HG21 sing N N 443 VAL CG2 HG22 sing N N 444 VAL CG2 HG23 sing N N 445 VAL OXT HXT sing N N 446 # _pdbx_audit_support.funding_organization 'Ministry of Science and Technology (MoST, China)' _pdbx_audit_support.country China _pdbx_audit_support.grant_number 2022YFE0210600 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 7xh6 _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 9J6O _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.026056 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016492 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.016346 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C CL F N O S # loop_ #