data_9LDH # _entry.id 9LDH # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.406 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9LDH pdb_00009ldh 10.2210/pdb9ldh/pdb WWPDB D_1300055430 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2025-11-12 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9LDH _pdbx_database_status.recvd_initial_deposition_date 2025-01-06 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBC _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible N # _pdbx_contact_author.id 4 _pdbx_contact_author.email ganjhh@fudan.edu.cn _pdbx_contact_author.name_first Jianhua _pdbx_contact_author.name_last Gan _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-8438-8852 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Cao, C.L.' 1 ? 'Yang, J.' 2 ? 'Zhang, W.Z.' 3 ? 'Gan, J.H.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title ;The complex structure of TkoKptA/2',3',5'-p-U ; _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Cao, C.L.' 1 ? primary 'Yang, J.' 2 ? primary 'Zhang, W.Z.' 3 ? primary 'Gan, J.H.' 4 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man ;Probable RNA 2'-phosphotransferase ; 20978.260 1 2.7.1.- ? ? ? 2 non-polymer syn 'SULFATE ION' 96.063 6 ? ? ? ? 3 non-polymer syn '[(2~{R},3~{R},4~{R},5~{R})-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-diphosphonooxy-oxolan-2-yl]methyl dihydrogen phosphate' 484.141 1 ? ? ? ? 4 water nat water 18.015 18 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MKPERKRVSKLMAYILRHSPEEFGLRPDVEGFVSLNELVNALKTVYPEVTEEFVREIVENDPKGRYEIRGDRIRARYGHS FPVSLDHEEDTESRFLYHGTPRRNLPSILKEGLKPMKRQYVHVSTDKIEALETGRRHGREVVLLVIDAECLRKRGFKIYK AGKNVRIVERVPPDCITLAV ; _entity_poly.pdbx_seq_one_letter_code_can ;MKPERKRVSKLMAYILRHSPEEFGLRPDVEGFVSLNELVNALKTVYPEVTEEFVREIVENDPKGRYEIRGDRIRARYGHS FPVSLDHEEDTESRFLYHGTPRRNLPSILKEGLKPMKRQYVHVSTDKIEALETGRRHGREVVLLVIDAECLRKRGFKIYK AGKNVRIVERVPPDCITLAV ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 '[(2~{R},3~{R},4~{R},5~{R})-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-diphosphonooxy-oxolan-2-yl]methyl dihydrogen phosphate' A1EJD 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LYS n 1 3 PRO n 1 4 GLU n 1 5 ARG n 1 6 LYS n 1 7 ARG n 1 8 VAL n 1 9 SER n 1 10 LYS n 1 11 LEU n 1 12 MET n 1 13 ALA n 1 14 TYR n 1 15 ILE n 1 16 LEU n 1 17 ARG n 1 18 HIS n 1 19 SER n 1 20 PRO n 1 21 GLU n 1 22 GLU n 1 23 PHE n 1 24 GLY n 1 25 LEU n 1 26 ARG n 1 27 PRO n 1 28 ASP n 1 29 VAL n 1 30 GLU n 1 31 GLY n 1 32 PHE n 1 33 VAL n 1 34 SER n 1 35 LEU n 1 36 ASN n 1 37 GLU n 1 38 LEU n 1 39 VAL n 1 40 ASN n 1 41 ALA n 1 42 LEU n 1 43 LYS n 1 44 THR n 1 45 VAL n 1 46 TYR n 1 47 PRO n 1 48 GLU n 1 49 VAL n 1 50 THR n 1 51 GLU n 1 52 GLU n 1 53 PHE n 1 54 VAL n 1 55 ARG n 1 56 GLU n 1 57 ILE n 1 58 VAL n 1 59 GLU n 1 60 ASN n 1 61 ASP n 1 62 PRO n 1 63 LYS n 1 64 GLY n 1 65 ARG n 1 66 TYR n 1 67 GLU n 1 68 ILE n 1 69 ARG n 1 70 GLY n 1 71 ASP n 1 72 ARG n 1 73 ILE n 1 74 ARG n 1 75 ALA n 1 76 ARG n 1 77 TYR n 1 78 GLY n 1 79 HIS n 1 80 SER n 1 81 PHE n 1 82 PRO n 1 83 VAL n 1 84 SER n 1 85 LEU n 1 86 ASP n 1 87 HIS n 1 88 GLU n 1 89 GLU n 1 90 ASP n 1 91 THR n 1 92 GLU n 1 93 SER n 1 94 ARG n 1 95 PHE n 1 96 LEU n 1 97 TYR n 1 98 HIS n 1 99 GLY n 1 100 THR n 1 101 PRO n 1 102 ARG n 1 103 ARG n 1 104 ASN n 1 105 LEU n 1 106 PRO n 1 107 SER n 1 108 ILE n 1 109 LEU n 1 110 LYS n 1 111 GLU n 1 112 GLY n 1 113 LEU n 1 114 LYS n 1 115 PRO n 1 116 MET n 1 117 LYS n 1 118 ARG n 1 119 GLN n 1 120 TYR n 1 121 VAL n 1 122 HIS n 1 123 VAL n 1 124 SER n 1 125 THR n 1 126 ASP n 1 127 LYS n 1 128 ILE n 1 129 GLU n 1 130 ALA n 1 131 LEU n 1 132 GLU n 1 133 THR n 1 134 GLY n 1 135 ARG n 1 136 ARG n 1 137 HIS n 1 138 GLY n 1 139 ARG n 1 140 GLU n 1 141 VAL n 1 142 VAL n 1 143 LEU n 1 144 LEU n 1 145 VAL n 1 146 ILE n 1 147 ASP n 1 148 ALA n 1 149 GLU n 1 150 CYS n 1 151 LEU n 1 152 ARG n 1 153 LYS n 1 154 ARG n 1 155 GLY n 1 156 PHE n 1 157 LYS n 1 158 ILE n 1 159 TYR n 1 160 LYS n 1 161 ALA n 1 162 GLY n 1 163 LYS n 1 164 ASN n 1 165 VAL n 1 166 ARG n 1 167 ILE n 1 168 VAL n 1 169 GLU n 1 170 ARG n 1 171 VAL n 1 172 PRO n 1 173 PRO n 1 174 ASP n 1 175 CYS n 1 176 ILE n 1 177 THR n 1 178 LEU n 1 179 ALA n 1 180 VAL n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 180 _entity_src_gen.gene_src_common_name 'Pyrococcus kodakaraensis (strain KOD1)' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'kptA, TK0302' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC BAA-918 / JCM 12380 / KOD1' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Thermococcus kodakarensis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 69014 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight A1EJD non-polymer . '[(2~{R},3~{R},4~{R},5~{R})-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-diphosphonooxy-oxolan-2-yl]methyl dihydrogen phosphate' '3h-Uridine tri-phosphate' 'C9 H15 N2 O15 P3' 484.141 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 LYS 2 2 2 LYS LYS A . n A 1 3 PRO 3 3 3 PRO PRO A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 ARG 5 5 5 ARG ARG A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 ARG 7 7 7 ARG ARG A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 MET 12 12 12 MET MET A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 TYR 14 14 14 TYR TYR A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 HIS 18 18 18 HIS HIS A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 PRO 20 20 20 PRO PRO A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 PHE 23 23 23 PHE PHE A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 PRO 27 27 27 PRO PRO A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 PHE 32 32 32 PHE PHE A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 ASN 36 36 36 ASN ASN A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 ASN 40 40 40 ASN ASN A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 TYR 46 46 46 TYR TYR A . n A 1 47 PRO 47 47 47 PRO PRO A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 ASN 60 60 60 ASN ASN A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 PRO 62 62 62 PRO PRO A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 ARG 65 65 65 ARG ARG A . n A 1 66 TYR 66 66 66 TYR TYR A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 ILE 68 68 68 ILE ILE A . n A 1 69 ARG 69 69 69 ARG ARG A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 ARG 72 72 72 ARG ARG A . n A 1 73 ILE 73 73 73 ILE ILE A . n A 1 74 ARG 74 74 74 ARG ARG A . n A 1 75 ALA 75 75 75 ALA ALA A . n A 1 76 ARG 76 76 76 ARG ARG A . n A 1 77 TYR 77 77 77 TYR TYR A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 HIS 79 79 79 HIS HIS A . n A 1 80 SER 80 80 80 SER SER A . n A 1 81 PHE 81 81 81 PHE PHE A . n A 1 82 PRO 82 82 82 PRO PRO A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 SER 84 84 84 SER SER A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 ASP 86 86 86 ASP ASP A . n A 1 87 HIS 87 87 87 HIS HIS A . n A 1 88 GLU 88 88 88 GLU GLU A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 ASP 90 90 90 ASP ASP A . n A 1 91 THR 91 91 91 THR THR A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 SER 93 93 93 SER SER A . n A 1 94 ARG 94 94 94 ARG ARG A . n A 1 95 PHE 95 95 95 PHE PHE A . n A 1 96 LEU 96 96 96 LEU LEU A . n A 1 97 TYR 97 97 97 TYR TYR A . n A 1 98 HIS 98 98 98 HIS HIS A . n A 1 99 GLY 99 99 99 GLY GLY A . n A 1 100 THR 100 100 100 THR THR A . n A 1 101 PRO 101 101 101 PRO PRO A . n A 1 102 ARG 102 102 102 ARG ARG A . n A 1 103 ARG 103 103 103 ARG ARG A . n A 1 104 ASN 104 104 104 ASN ASN A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 PRO 106 106 106 PRO PRO A . n A 1 107 SER 107 107 107 SER SER A . n A 1 108 ILE 108 108 108 ILE ILE A . n A 1 109 LEU 109 109 109 LEU LEU A . n A 1 110 LYS 110 110 110 LYS LYS A . n A 1 111 GLU 111 111 111 GLU GLU A . n A 1 112 GLY 112 112 112 GLY GLY A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 LYS 114 114 114 LYS LYS A . n A 1 115 PRO 115 115 115 PRO PRO A . n A 1 116 MET 116 116 116 MET MET A . n A 1 117 LYS 117 117 117 LYS LYS A . n A 1 118 ARG 118 118 118 ARG ARG A . n A 1 119 GLN 119 119 119 GLN GLN A . n A 1 120 TYR 120 120 120 TYR TYR A . n A 1 121 VAL 121 121 121 VAL VAL A . n A 1 122 HIS 122 122 122 HIS HIS A . n A 1 123 VAL 123 123 123 VAL VAL A . n A 1 124 SER 124 124 124 SER SER A . n A 1 125 THR 125 125 125 THR THR A . n A 1 126 ASP 126 126 126 ASP ASP A . n A 1 127 LYS 127 127 127 LYS LYS A . n A 1 128 ILE 128 128 128 ILE ILE A . n A 1 129 GLU 129 129 129 GLU GLU A . n A 1 130 ALA 130 130 130 ALA ALA A . n A 1 131 LEU 131 131 131 LEU LEU A . n A 1 132 GLU 132 132 132 GLU GLU A . n A 1 133 THR 133 133 133 THR THR A . n A 1 134 GLY 134 134 134 GLY GLY A . n A 1 135 ARG 135 135 135 ARG ARG A . n A 1 136 ARG 136 136 136 ARG ARG A . n A 1 137 HIS 137 137 137 HIS HIS A . n A 1 138 GLY 138 138 138 GLY GLY A . n A 1 139 ARG 139 139 139 ARG ARG A . n A 1 140 GLU 140 140 140 GLU GLU A . n A 1 141 VAL 141 141 141 VAL VAL A . n A 1 142 VAL 142 142 142 VAL VAL A . n A 1 143 LEU 143 143 143 LEU LEU A . n A 1 144 LEU 144 144 144 LEU LEU A . n A 1 145 VAL 145 145 145 VAL VAL A . n A 1 146 ILE 146 146 146 ILE ILE A . n A 1 147 ASP 147 147 147 ASP ASP A . n A 1 148 ALA 148 148 148 ALA ALA A . n A 1 149 GLU 149 149 149 GLU GLU A . n A 1 150 CYS 150 150 150 CYS CYS A . n A 1 151 LEU 151 151 151 LEU LEU A . n A 1 152 ARG 152 152 152 ARG ARG A . n A 1 153 LYS 153 153 153 LYS LYS A . n A 1 154 ARG 154 154 154 ARG ARG A . n A 1 155 GLY 155 155 155 GLY GLY A . n A 1 156 PHE 156 156 156 PHE PHE A . n A 1 157 LYS 157 157 157 LYS LYS A . n A 1 158 ILE 158 158 158 ILE ILE A . n A 1 159 TYR 159 159 159 TYR TYR A . n A 1 160 LYS 160 160 160 LYS LYS A . n A 1 161 ALA 161 161 161 ALA ALA A . n A 1 162 GLY 162 162 162 GLY GLY A . n A 1 163 LYS 163 163 163 LYS LYS A . n A 1 164 ASN 164 164 164 ASN ASN A . n A 1 165 VAL 165 165 165 VAL VAL A . n A 1 166 ARG 166 166 166 ARG ARG A . n A 1 167 ILE 167 167 167 ILE ILE A . n A 1 168 VAL 168 168 168 VAL VAL A . n A 1 169 GLU 169 169 169 GLU GLU A . n A 1 170 ARG 170 170 170 ARG ARG A . n A 1 171 VAL 171 171 171 VAL VAL A . n A 1 172 PRO 172 172 172 PRO PRO A . n A 1 173 PRO 173 173 173 PRO PRO A . n A 1 174 ASP 174 174 174 ASP ASP A . n A 1 175 CYS 175 175 175 CYS CYS A . n A 1 176 ILE 176 176 176 ILE ILE A . n A 1 177 THR 177 177 177 THR THR A . n A 1 178 LEU 178 178 178 LEU LEU A . n A 1 179 ALA 179 179 179 ALA ALA A . n A 1 180 VAL 180 180 180 VAL VAL A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id A1EJD _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id A1EJD _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 201 1 SO4 SO4 A . C 2 SO4 1 202 2 SO4 SO4 A . D 2 SO4 1 203 3 SO4 SO4 A . E 2 SO4 1 204 4 SO4 SO4 A . F 2 SO4 1 205 5 SO4 SO4 A . G 2 SO4 1 206 6 SO4 SO4 A . H 3 A1EJD 1 207 201 A1EJD LIG A . I 4 HOH 1 301 21 HOH HOH A . I 4 HOH 2 302 28 HOH HOH A . I 4 HOH 3 303 5 HOH HOH A . I 4 HOH 4 304 26 HOH HOH A . I 4 HOH 5 305 23 HOH HOH A . I 4 HOH 6 306 1 HOH HOH A . I 4 HOH 7 307 6 HOH HOH A . I 4 HOH 8 308 27 HOH HOH A . I 4 HOH 9 309 12 HOH HOH A . I 4 HOH 10 310 14 HOH HOH A . I 4 HOH 11 311 19 HOH HOH A . I 4 HOH 12 312 22 HOH HOH A . I 4 HOH 13 313 10 HOH HOH A . I 4 HOH 14 314 18 HOH HOH A . I 4 HOH 15 315 8 HOH HOH A . I 4 HOH 16 316 17 HOH HOH A . I 4 HOH 17 317 13 HOH HOH A . I 4 HOH 18 318 20 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 2 ? CG ? A LYS 2 CG 2 1 Y 1 A LYS 2 ? CD ? A LYS 2 CD 3 1 Y 1 A LYS 2 ? CE ? A LYS 2 CE 4 1 Y 1 A LYS 2 ? NZ ? A LYS 2 NZ 5 1 Y 1 A GLU 4 ? CG ? A GLU 4 CG 6 1 Y 1 A GLU 4 ? CD ? A GLU 4 CD 7 1 Y 1 A GLU 4 ? OE1 ? A GLU 4 OE1 8 1 Y 1 A GLU 4 ? OE2 ? A GLU 4 OE2 9 1 Y 1 A ARG 5 ? CG ? A ARG 5 CG 10 1 Y 1 A ARG 5 ? CD ? A ARG 5 CD 11 1 Y 1 A ARG 5 ? NE ? A ARG 5 NE 12 1 Y 1 A ARG 5 ? CZ ? A ARG 5 CZ 13 1 Y 1 A ARG 5 ? NH1 ? A ARG 5 NH1 14 1 Y 1 A ARG 5 ? NH2 ? A ARG 5 NH2 15 1 Y 1 A LYS 117 ? CG ? A LYS 117 CG 16 1 Y 1 A LYS 117 ? CD ? A LYS 117 CD 17 1 Y 1 A LYS 117 ? CE ? A LYS 117 CE 18 1 Y 1 A LYS 117 ? NZ ? A LYS 117 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.19.1_4122: ???)' 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 9LDH _cell.details ? _cell.formula_units_Z ? _cell.length_a 58.450 _cell.length_a_esd ? _cell.length_b 58.450 _cell.length_b_esd ? _cell.length_c 222.890 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9LDH _symmetry.cell_setting ? _symmetry.Int_Tables_number 179 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 65 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9LDH _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.62 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 53.05 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;200 mM Ammonium sulfate 20% w/v PEG 3350 pH 6.0 ; _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 300 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2023-09-24 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.987 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL10U2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.987 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL10U2 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 9LDH _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.94 _reflns.d_resolution_low 29.23 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 17731 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.8 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 30.2 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 33.000 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.060 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1.000 _reflns.pdbx_CC_star 0.011 _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.059 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.94 _reflns_shell.d_res_low 1.99 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.60 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1233 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 19.6 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 1.308 _reflns_shell.pdbx_Rpim_I_all 0.292 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.812 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.273 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9LDH _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.94 _refine.ls_d_res_low 25.15 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 17632 _refine.ls_number_reflns_R_free 860 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.78 _refine.ls_percent_reflns_R_free 4.88 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2206 _refine.ls_R_factor_R_free 0.2652 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2183 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.36 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 27.72 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.20 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.94 _refine_hist.d_res_low 25.15 _refine_hist.number_atoms_solvent 18 _refine_hist.number_atoms_total 1525 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1448 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 59 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.010 ? 1531 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.199 ? 2076 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 6.786 ? 224 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.072 ? 223 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.017 ? 265 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.94 2.06 . . 131 2683 99.00 . . . . 0.2520 . . . . . . . . . . . 0.2962 'X-RAY DIFFRACTION' 2.06 2.22 . . 128 2725 100.00 . . . . 0.2474 . . . . . . . . . . . 0.3079 'X-RAY DIFFRACTION' 2.22 2.44 . . 152 2750 100.00 . . . . 0.2521 . . . . . . . . . . . 0.2904 'X-RAY DIFFRACTION' 2.44 2.80 . . 137 2769 100.00 . . . . 0.2517 . . . . . . . . . . . 0.3085 'X-RAY DIFFRACTION' 2.80 3.52 . . 162 2805 100.00 . . . . 0.2408 . . . . . . . . . . . 0.2934 'X-RAY DIFFRACTION' 3.52 25.15 . . 150 3040 100.00 . . . . 0.1919 . . . . . . . . . . . 0.2309 # _struct.entry_id 9LDH _struct.title ;The complex structure of TkoKptA/2',3',5'-p-U ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9LDH _struct_keywords.text ;Kpta, complex, 2', 3', 5'-p-U, TRANSFERASE ; _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 2 ? F N N 2 ? G N N 2 ? H N N 3 ? I N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code KPTA_THEKO _struct_ref.pdbx_db_accession Q5JFX3 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MKPERKRVSKLMAYILRHSPEEFGLRPDVEGFVSLNELVNALKTVYPEVTEEFVREIVENDPKGRYEIRGDRIRARYGHS FPVSLDHEEDTESRFLYHGTPRRNLPSILKEGLKPMKRQYVHVSTDKIEALETGRRHGREVVLLVIDAECLRKRGFKIYK AGKNVRIVERVPPDCITLAV ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9LDH _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 180 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q5JFX3 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 180 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 180 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H,I # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LYS A 2 ? HIS A 18 ? LYS A 2 HIS A 18 1 ? 17 HELX_P HELX_P2 AA2 SER A 19 ? GLY A 24 ? SER A 19 GLY A 24 5 ? 6 HELX_P HELX_P3 AA3 LEU A 35 ? THR A 44 ? LEU A 35 THR A 44 1 ? 10 HELX_P HELX_P4 AA4 THR A 50 ? ASP A 61 ? THR A 50 ASP A 61 1 ? 12 HELX_P HELX_P5 AA5 ASN A 104 ? GLY A 112 ? ASN A 104 GLY A 112 1 ? 9 HELX_P HELX_P6 AA6 ASP A 126 ? ARG A 136 ? ASP A 126 ARG A 136 1 ? 11 HELX_P HELX_P7 AA7 ALA A 148 ? ARG A 154 ? ALA A 148 ARG A 154 1 ? 7 HELX_P HELX_P8 AA8 PRO A 172 ? ASP A 174 ? PRO A 172 ASP A 174 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 150 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 175 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 150 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 175 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.206 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id CYS _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 150 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 175 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id CYS _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 150 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 175 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom SG _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id . _pdbx_modification_feature.ref_pcm_id . _pdbx_modification_feature.ref_comp_id . _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Disulfide bridge' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 3 ? AA3 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 33 ? SER A 34 ? VAL A 33 SER A 34 AA1 2 ARG A 72 ? ALA A 75 ? ARG A 72 ALA A 75 AA1 3 TYR A 66 ? ARG A 69 ? TYR A 66 ARG A 69 AA2 1 PHE A 95 ? PRO A 101 ? PHE A 95 PRO A 101 AA2 2 VAL A 141 ? ASP A 147 ? VAL A 141 ASP A 147 AA2 3 ILE A 176 ? ALA A 179 ? ILE A 176 ALA A 179 AA3 1 VAL A 121 ? SER A 124 ? VAL A 121 SER A 124 AA3 2 VAL A 165 ? VAL A 168 ? VAL A 165 VAL A 168 AA3 3 TYR A 159 ? LYS A 160 ? TYR A 159 LYS A 160 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N VAL A 33 ? N VAL A 33 O ILE A 73 ? O ILE A 73 AA1 2 3 O ARG A 74 ? O ARG A 74 N GLU A 67 ? N GLU A 67 AA2 1 2 N THR A 100 ? N THR A 100 O VAL A 142 ? O VAL A 142 AA2 2 3 N VAL A 145 ? N VAL A 145 O THR A 177 ? O THR A 177 AA3 1 2 N VAL A 121 ? N VAL A 121 O VAL A 168 ? O VAL A 168 AA3 2 3 O ILE A 167 ? O ILE A 167 N TYR A 159 ? N TYR A 159 # _pdbx_entry_details.entry_id 9LDH _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 18 ? ? -120.37 -59.49 2 1 MET A 116 ? ? -116.99 -80.35 3 1 LYS A 163 ? ? 52.30 -114.46 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 1 _pdbx_validate_planes.auth_comp_id ARG _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 135 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.167 _pdbx_validate_planes.type 'SIDE CHAIN' # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 25.4812 _pdbx_refine_tls.origin_y -13.9113 _pdbx_refine_tls.origin_z 2.8241 _pdbx_refine_tls.T[1][1] 0.3532 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] 0.0229 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] 0.0497 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.2672 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] 0.0661 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.3056 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 3.8563 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] 1.9954 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] 2.9744 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 3.2678 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] 1.8407 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 3.6103 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] -0.1036 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] -0.1403 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] 0.1026 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] 0.0824 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] -0.0276 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] 0.1509 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] -0.0319 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] -0.1436 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] 0.1223 _pdbx_refine_tls.S[3][3]_esd ? # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.beg_auth_asym_id ? _pdbx_refine_tls_group.beg_auth_seq_id ? _pdbx_refine_tls_group.beg_PDB_ins_code ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id ? _pdbx_refine_tls_group.end_auth_seq_id ? _pdbx_refine_tls_group.end_PDB_ins_code ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details all # _pdbx_unobs_or_zero_occ_residues.id 1 _pdbx_unobs_or_zero_occ_residues.PDB_model_num 1 _pdbx_unobs_or_zero_occ_residues.polymer_flag Y _pdbx_unobs_or_zero_occ_residues.occupancy_flag 1 _pdbx_unobs_or_zero_occ_residues.auth_asym_id A _pdbx_unobs_or_zero_occ_residues.auth_comp_id MET _pdbx_unobs_or_zero_occ_residues.auth_seq_id 1 _pdbx_unobs_or_zero_occ_residues.PDB_ins_code ? _pdbx_unobs_or_zero_occ_residues.label_asym_id A _pdbx_unobs_or_zero_occ_residues.label_comp_id MET _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal A1EJD C4 C N N 1 A1EJD C6 C N R 2 A1EJD C8 C N R 3 A1EJD C15 C N R 4 A1EJD C21 C N R 5 A1EJD C2 C N N 6 A1EJD C27 C N N 7 A1EJD C3 C N N 8 A1EJD C9 C N N 9 A1EJD N29 N N N 10 A1EJD N5 N N N 11 A1EJD O1 O N N 12 A1EJD O10 O N N 13 A1EJD O12 O N N 14 A1EJD O13 O N N 15 A1EJD O14 O N N 16 A1EJD O16 O N N 17 A1EJD O18 O N N 18 A1EJD O19 O N N 19 A1EJD O20 O N N 20 A1EJD O22 O N N 21 A1EJD O24 O N N 22 A1EJD O25 O N N 23 A1EJD O26 O N N 24 A1EJD O28 O N N 25 A1EJD O7 O N N 26 A1EJD P11 P N N 27 A1EJD P17 P N N 28 A1EJD P23 P N N 29 A1EJD H1 H N N 30 A1EJD H2 H N N 31 A1EJD H3 H N N 32 A1EJD H4 H N N 33 A1EJD H5 H N N 34 A1EJD H6 H N N 35 A1EJD H7 H N N 36 A1EJD H8 H N N 37 A1EJD H9 H N N 38 A1EJD H10 H N N 39 A1EJD H11 H N N 40 A1EJD H12 H N N 41 A1EJD H13 H N N 42 A1EJD H14 H N N 43 A1EJD H15 H N N 44 ALA N N N N 45 ALA CA C N S 46 ALA C C N N 47 ALA O O N N 48 ALA CB C N N 49 ALA OXT O N N 50 ALA H H N N 51 ALA H2 H N N 52 ALA HA H N N 53 ALA HB1 H N N 54 ALA HB2 H N N 55 ALA HB3 H N N 56 ALA HXT H N N 57 ARG N N N N 58 ARG CA C N S 59 ARG C C N N 60 ARG O O N N 61 ARG CB C N N 62 ARG CG C N N 63 ARG CD C N N 64 ARG NE N N N 65 ARG CZ C N N 66 ARG NH1 N N N 67 ARG NH2 N N N 68 ARG OXT O N N 69 ARG H H N N 70 ARG H2 H N N 71 ARG HA H N N 72 ARG HB2 H N N 73 ARG HB3 H N N 74 ARG HG2 H N N 75 ARG HG3 H N N 76 ARG HD2 H N N 77 ARG HD3 H N N 78 ARG HE H N N 79 ARG HH11 H N N 80 ARG HH12 H N N 81 ARG HH21 H N N 82 ARG HH22 H N N 83 ARG HXT H N N 84 ASN N N N N 85 ASN CA C N S 86 ASN C C N N 87 ASN O O N N 88 ASN CB C N N 89 ASN CG C N N 90 ASN OD1 O N N 91 ASN ND2 N N N 92 ASN OXT O N N 93 ASN H H N N 94 ASN H2 H N N 95 ASN HA H N N 96 ASN HB2 H N N 97 ASN HB3 H N N 98 ASN HD21 H N N 99 ASN HD22 H N N 100 ASN HXT H N N 101 ASP N N N N 102 ASP CA C N S 103 ASP C C N N 104 ASP O O N N 105 ASP CB C N N 106 ASP CG C N N 107 ASP OD1 O N N 108 ASP OD2 O N N 109 ASP OXT O N N 110 ASP H H N N 111 ASP H2 H N N 112 ASP HA H N N 113 ASP HB2 H N N 114 ASP HB3 H N N 115 ASP HD2 H N N 116 ASP HXT H N N 117 CYS N N N N 118 CYS CA C N R 119 CYS C C N N 120 CYS O O N N 121 CYS CB C N N 122 CYS SG S N N 123 CYS OXT O N N 124 CYS H H N N 125 CYS H2 H N N 126 CYS HA H N N 127 CYS HB2 H N N 128 CYS HB3 H N N 129 CYS HG H N N 130 CYS HXT H N N 131 GLN N N N N 132 GLN CA C N S 133 GLN C C N N 134 GLN O O N N 135 GLN CB C N N 136 GLN CG C N N 137 GLN CD C N N 138 GLN OE1 O N N 139 GLN NE2 N N N 140 GLN OXT O N N 141 GLN H H N N 142 GLN H2 H N N 143 GLN HA H N N 144 GLN HB2 H N N 145 GLN HB3 H N N 146 GLN HG2 H N N 147 GLN HG3 H N N 148 GLN HE21 H N N 149 GLN HE22 H N N 150 GLN HXT H N N 151 GLU N N N N 152 GLU CA C N S 153 GLU C C N N 154 GLU O O N N 155 GLU CB C N N 156 GLU CG C N N 157 GLU CD C N N 158 GLU OE1 O N N 159 GLU OE2 O N N 160 GLU OXT O N N 161 GLU H H N N 162 GLU H2 H N N 163 GLU HA H N N 164 GLU HB2 H N N 165 GLU HB3 H N N 166 GLU HG2 H N N 167 GLU HG3 H N N 168 GLU HE2 H N N 169 GLU HXT H N N 170 GLY N N N N 171 GLY CA C N N 172 GLY C C N N 173 GLY O O N N 174 GLY OXT O N N 175 GLY H H N N 176 GLY H2 H N N 177 GLY HA2 H N N 178 GLY HA3 H N N 179 GLY HXT H N N 180 HIS N N N N 181 HIS CA C N S 182 HIS C C N N 183 HIS O O N N 184 HIS CB C N N 185 HIS CG C Y N 186 HIS ND1 N Y N 187 HIS CD2 C Y N 188 HIS CE1 C Y N 189 HIS NE2 N Y N 190 HIS OXT O N N 191 HIS H H N N 192 HIS H2 H N N 193 HIS HA H N N 194 HIS HB2 H N N 195 HIS HB3 H N N 196 HIS HD1 H N N 197 HIS HD2 H N N 198 HIS HE1 H N N 199 HIS HE2 H N N 200 HIS HXT H N N 201 HOH O O N N 202 HOH H1 H N N 203 HOH H2 H N N 204 ILE N N N N 205 ILE CA C N S 206 ILE C C N N 207 ILE O O N N 208 ILE CB C N S 209 ILE CG1 C N N 210 ILE CG2 C N N 211 ILE CD1 C N N 212 ILE OXT O N N 213 ILE H H N N 214 ILE H2 H N N 215 ILE HA H N N 216 ILE HB H N N 217 ILE HG12 H N N 218 ILE HG13 H N N 219 ILE HG21 H N N 220 ILE HG22 H N N 221 ILE HG23 H N N 222 ILE HD11 H N N 223 ILE HD12 H N N 224 ILE HD13 H N N 225 ILE HXT H N N 226 LEU N N N N 227 LEU CA C N S 228 LEU C C N N 229 LEU O O N N 230 LEU CB C N N 231 LEU CG C N N 232 LEU CD1 C N N 233 LEU CD2 C N N 234 LEU OXT O N N 235 LEU H H N N 236 LEU H2 H N N 237 LEU HA H N N 238 LEU HB2 H N N 239 LEU HB3 H N N 240 LEU HG H N N 241 LEU HD11 H N N 242 LEU HD12 H N N 243 LEU HD13 H N N 244 LEU HD21 H N N 245 LEU HD22 H N N 246 LEU HD23 H N N 247 LEU HXT H N N 248 LYS N N N N 249 LYS CA C N S 250 LYS C C N N 251 LYS O O N N 252 LYS CB C N N 253 LYS CG C N N 254 LYS CD C N N 255 LYS CE C N N 256 LYS NZ N N N 257 LYS OXT O N N 258 LYS H H N N 259 LYS H2 H N N 260 LYS HA H N N 261 LYS HB2 H N N 262 LYS HB3 H N N 263 LYS HG2 H N N 264 LYS HG3 H N N 265 LYS HD2 H N N 266 LYS HD3 H N N 267 LYS HE2 H N N 268 LYS HE3 H N N 269 LYS HZ1 H N N 270 LYS HZ2 H N N 271 LYS HZ3 H N N 272 LYS HXT H N N 273 MET N N N N 274 MET CA C N S 275 MET C C N N 276 MET O O N N 277 MET CB C N N 278 MET CG C N N 279 MET SD S N N 280 MET CE C N N 281 MET OXT O N N 282 MET H H N N 283 MET H2 H N N 284 MET HA H N N 285 MET HB2 H N N 286 MET HB3 H N N 287 MET HG2 H N N 288 MET HG3 H N N 289 MET HE1 H N N 290 MET HE2 H N N 291 MET HE3 H N N 292 MET HXT H N N 293 PHE N N N N 294 PHE CA C N S 295 PHE C C N N 296 PHE O O N N 297 PHE CB C N N 298 PHE CG C Y N 299 PHE CD1 C Y N 300 PHE CD2 C Y N 301 PHE CE1 C Y N 302 PHE CE2 C Y N 303 PHE CZ C Y N 304 PHE OXT O N N 305 PHE H H N N 306 PHE H2 H N N 307 PHE HA H N N 308 PHE HB2 H N N 309 PHE HB3 H N N 310 PHE HD1 H N N 311 PHE HD2 H N N 312 PHE HE1 H N N 313 PHE HE2 H N N 314 PHE HZ H N N 315 PHE HXT H N N 316 PRO N N N N 317 PRO CA C N S 318 PRO C C N N 319 PRO O O N N 320 PRO CB C N N 321 PRO CG C N N 322 PRO CD C N N 323 PRO OXT O N N 324 PRO H H N N 325 PRO HA H N N 326 PRO HB2 H N N 327 PRO HB3 H N N 328 PRO HG2 H N N 329 PRO HG3 H N N 330 PRO HD2 H N N 331 PRO HD3 H N N 332 PRO HXT H N N 333 SER N N N N 334 SER CA C N S 335 SER C C N N 336 SER O O N N 337 SER CB C N N 338 SER OG O N N 339 SER OXT O N N 340 SER H H N N 341 SER H2 H N N 342 SER HA H N N 343 SER HB2 H N N 344 SER HB3 H N N 345 SER HG H N N 346 SER HXT H N N 347 SO4 S S N N 348 SO4 O1 O N N 349 SO4 O2 O N N 350 SO4 O3 O N N 351 SO4 O4 O N N 352 THR N N N N 353 THR CA C N S 354 THR C C N N 355 THR O O N N 356 THR CB C N R 357 THR OG1 O N N 358 THR CG2 C N N 359 THR OXT O N N 360 THR H H N N 361 THR H2 H N N 362 THR HA H N N 363 THR HB H N N 364 THR HG1 H N N 365 THR HG21 H N N 366 THR HG22 H N N 367 THR HG23 H N N 368 THR HXT H N N 369 TYR N N N N 370 TYR CA C N S 371 TYR C C N N 372 TYR O O N N 373 TYR CB C N N 374 TYR CG C Y N 375 TYR CD1 C Y N 376 TYR CD2 C Y N 377 TYR CE1 C Y N 378 TYR CE2 C Y N 379 TYR CZ C Y N 380 TYR OH O N N 381 TYR OXT O N N 382 TYR H H N N 383 TYR H2 H N N 384 TYR HA H N N 385 TYR HB2 H N N 386 TYR HB3 H N N 387 TYR HD1 H N N 388 TYR HD2 H N N 389 TYR HE1 H N N 390 TYR HE2 H N N 391 TYR HH H N N 392 TYR HXT H N N 393 VAL N N N N 394 VAL CA C N S 395 VAL C C N N 396 VAL O O N N 397 VAL CB C N N 398 VAL CG1 C N N 399 VAL CG2 C N N 400 VAL OXT O N N 401 VAL H H N N 402 VAL H2 H N N 403 VAL HA H N N 404 VAL HB H N N 405 VAL HG11 H N N 406 VAL HG12 H N N 407 VAL HG13 H N N 408 VAL HG21 H N N 409 VAL HG22 H N N 410 VAL HG23 H N N 411 VAL HXT H N N 412 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal A1EJD O20 P17 doub N N 1 A1EJD O14 P11 doub N N 2 A1EJD O13 P11 sing N N 3 A1EJD O18 P17 sing N N 4 A1EJD O26 P23 doub N N 5 A1EJD P17 O19 sing N N 6 A1EJD P17 O16 sing N N 7 A1EJD P11 O10 sing N N 8 A1EJD P11 O12 sing N N 9 A1EJD O10 C9 sing N N 10 A1EJD O16 C15 sing N N 11 A1EJD C15 C21 sing N N 12 A1EJD C15 C8 sing N N 13 A1EJD P23 O24 sing N N 14 A1EJD P23 O22 sing N N 15 A1EJD P23 O25 sing N N 16 A1EJD C9 C8 sing N N 17 A1EJD O22 C21 sing N N 18 A1EJD C21 C6 sing N N 19 A1EJD C8 O7 sing N N 20 A1EJD O7 C6 sing N N 21 A1EJD C6 N5 sing N N 22 A1EJD C4 N5 sing N N 23 A1EJD C4 C3 doub N N 24 A1EJD N5 C27 sing N N 25 A1EJD C3 C2 sing N N 26 A1EJD C27 O28 doub N N 27 A1EJD C27 N29 sing N N 28 A1EJD C2 N29 sing N N 29 A1EJD C2 O1 doub N N 30 A1EJD C4 H1 sing N N 31 A1EJD C6 H2 sing N N 32 A1EJD C8 H3 sing N N 33 A1EJD C15 H4 sing N N 34 A1EJD C21 H5 sing N N 35 A1EJD C3 H6 sing N N 36 A1EJD C9 H7 sing N N 37 A1EJD C9 H8 sing N N 38 A1EJD N29 H9 sing N N 39 A1EJD O12 H10 sing N N 40 A1EJD O13 H11 sing N N 41 A1EJD O18 H12 sing N N 42 A1EJD O19 H13 sing N N 43 A1EJD O24 H14 sing N N 44 A1EJD O25 H15 sing N N 45 ALA N CA sing N N 46 ALA N H sing N N 47 ALA N H2 sing N N 48 ALA CA C sing N N 49 ALA CA CB sing N N 50 ALA CA HA sing N N 51 ALA C O doub N N 52 ALA C OXT sing N N 53 ALA CB HB1 sing N N 54 ALA CB HB2 sing N N 55 ALA CB HB3 sing N N 56 ALA OXT HXT sing N N 57 ARG N CA sing N N 58 ARG N H sing N N 59 ARG N H2 sing N N 60 ARG CA C sing N N 61 ARG CA CB sing N N 62 ARG CA HA sing N N 63 ARG C O doub N N 64 ARG C OXT sing N N 65 ARG CB CG sing N N 66 ARG CB HB2 sing N N 67 ARG CB HB3 sing N N 68 ARG CG CD sing N N 69 ARG CG HG2 sing N N 70 ARG CG HG3 sing N N 71 ARG CD NE sing N N 72 ARG CD HD2 sing N N 73 ARG CD HD3 sing N N 74 ARG NE CZ sing N N 75 ARG NE HE sing N N 76 ARG CZ NH1 sing N N 77 ARG CZ NH2 doub N N 78 ARG NH1 HH11 sing N N 79 ARG NH1 HH12 sing N N 80 ARG NH2 HH21 sing N N 81 ARG NH2 HH22 sing N N 82 ARG OXT HXT sing N N 83 ASN N CA sing N N 84 ASN N H sing N N 85 ASN N H2 sing N N 86 ASN CA C sing N N 87 ASN CA CB sing N N 88 ASN CA HA sing N N 89 ASN C O doub N N 90 ASN C OXT sing N N 91 ASN CB CG sing N N 92 ASN CB HB2 sing N N 93 ASN CB HB3 sing N N 94 ASN CG OD1 doub N N 95 ASN CG ND2 sing N N 96 ASN ND2 HD21 sing N N 97 ASN ND2 HD22 sing N N 98 ASN OXT HXT sing N N 99 ASP N CA sing N N 100 ASP N H sing N N 101 ASP N H2 sing N N 102 ASP CA C sing N N 103 ASP CA CB sing N N 104 ASP CA HA sing N N 105 ASP C O doub N N 106 ASP C OXT sing N N 107 ASP CB CG sing N N 108 ASP CB HB2 sing N N 109 ASP CB HB3 sing N N 110 ASP CG OD1 doub N N 111 ASP CG OD2 sing N N 112 ASP OD2 HD2 sing N N 113 ASP OXT HXT sing N N 114 CYS N CA sing N N 115 CYS N H sing N N 116 CYS N H2 sing N N 117 CYS CA C sing N N 118 CYS CA CB sing N N 119 CYS CA HA sing N N 120 CYS C O doub N N 121 CYS C OXT sing N N 122 CYS CB SG sing N N 123 CYS CB HB2 sing N N 124 CYS CB HB3 sing N N 125 CYS SG HG sing N N 126 CYS OXT HXT sing N N 127 GLN N CA sing N N 128 GLN N H sing N N 129 GLN N H2 sing N N 130 GLN CA C sing N N 131 GLN CA CB sing N N 132 GLN CA HA sing N N 133 GLN C O doub N N 134 GLN C OXT sing N N 135 GLN CB CG sing N N 136 GLN CB HB2 sing N N 137 GLN CB HB3 sing N N 138 GLN CG CD sing N N 139 GLN CG HG2 sing N N 140 GLN CG HG3 sing N N 141 GLN CD OE1 doub N N 142 GLN CD NE2 sing N N 143 GLN NE2 HE21 sing N N 144 GLN NE2 HE22 sing N N 145 GLN OXT HXT sing N N 146 GLU N CA sing N N 147 GLU N H sing N N 148 GLU N H2 sing N N 149 GLU CA C sing N N 150 GLU CA CB sing N N 151 GLU CA HA sing N N 152 GLU C O doub N N 153 GLU C OXT sing N N 154 GLU CB CG sing N N 155 GLU CB HB2 sing N N 156 GLU CB HB3 sing N N 157 GLU CG CD sing N N 158 GLU CG HG2 sing N N 159 GLU CG HG3 sing N N 160 GLU CD OE1 doub N N 161 GLU CD OE2 sing N N 162 GLU OE2 HE2 sing N N 163 GLU OXT HXT sing N N 164 GLY N CA sing N N 165 GLY N H sing N N 166 GLY N H2 sing N N 167 GLY CA C sing N N 168 GLY CA HA2 sing N N 169 GLY CA HA3 sing N N 170 GLY C O doub N N 171 GLY C OXT sing N N 172 GLY OXT HXT sing N N 173 HIS N CA sing N N 174 HIS N H sing N N 175 HIS N H2 sing N N 176 HIS CA C sing N N 177 HIS CA CB sing N N 178 HIS CA HA sing N N 179 HIS C O doub N N 180 HIS C OXT sing N N 181 HIS CB CG sing N N 182 HIS CB HB2 sing N N 183 HIS CB HB3 sing N N 184 HIS CG ND1 sing Y N 185 HIS CG CD2 doub Y N 186 HIS ND1 CE1 doub Y N 187 HIS ND1 HD1 sing N N 188 HIS CD2 NE2 sing Y N 189 HIS CD2 HD2 sing N N 190 HIS CE1 NE2 sing Y N 191 HIS CE1 HE1 sing N N 192 HIS NE2 HE2 sing N N 193 HIS OXT HXT sing N N 194 HOH O H1 sing N N 195 HOH O H2 sing N N 196 ILE N CA sing N N 197 ILE N H sing N N 198 ILE N H2 sing N N 199 ILE CA C sing N N 200 ILE CA CB sing N N 201 ILE CA HA sing N N 202 ILE C O doub N N 203 ILE C OXT sing N N 204 ILE CB CG1 sing N N 205 ILE CB CG2 sing N N 206 ILE CB HB sing N N 207 ILE CG1 CD1 sing N N 208 ILE CG1 HG12 sing N N 209 ILE CG1 HG13 sing N N 210 ILE CG2 HG21 sing N N 211 ILE CG2 HG22 sing N N 212 ILE CG2 HG23 sing N N 213 ILE CD1 HD11 sing N N 214 ILE CD1 HD12 sing N N 215 ILE CD1 HD13 sing N N 216 ILE OXT HXT sing N N 217 LEU N CA sing N N 218 LEU N H sing N N 219 LEU N H2 sing N N 220 LEU CA C sing N N 221 LEU CA CB sing N N 222 LEU CA HA sing N N 223 LEU C O doub N N 224 LEU C OXT sing N N 225 LEU CB CG sing N N 226 LEU CB HB2 sing N N 227 LEU CB HB3 sing N N 228 LEU CG CD1 sing N N 229 LEU CG CD2 sing N N 230 LEU CG HG sing N N 231 LEU CD1 HD11 sing N N 232 LEU CD1 HD12 sing N N 233 LEU CD1 HD13 sing N N 234 LEU CD2 HD21 sing N N 235 LEU CD2 HD22 sing N N 236 LEU CD2 HD23 sing N N 237 LEU OXT HXT sing N N 238 LYS N CA sing N N 239 LYS N H sing N N 240 LYS N H2 sing N N 241 LYS CA C sing N N 242 LYS CA CB sing N N 243 LYS CA HA sing N N 244 LYS C O doub N N 245 LYS C OXT sing N N 246 LYS CB CG sing N N 247 LYS CB HB2 sing N N 248 LYS CB HB3 sing N N 249 LYS CG CD sing N N 250 LYS CG HG2 sing N N 251 LYS CG HG3 sing N N 252 LYS CD CE sing N N 253 LYS CD HD2 sing N N 254 LYS CD HD3 sing N N 255 LYS CE NZ sing N N 256 LYS CE HE2 sing N N 257 LYS CE HE3 sing N N 258 LYS NZ HZ1 sing N N 259 LYS NZ HZ2 sing N N 260 LYS NZ HZ3 sing N N 261 LYS OXT HXT sing N N 262 MET N CA sing N N 263 MET N H sing N N 264 MET N H2 sing N N 265 MET CA C sing N N 266 MET CA CB sing N N 267 MET CA HA sing N N 268 MET C O doub N N 269 MET C OXT sing N N 270 MET CB CG sing N N 271 MET CB HB2 sing N N 272 MET CB HB3 sing N N 273 MET CG SD sing N N 274 MET CG HG2 sing N N 275 MET CG HG3 sing N N 276 MET SD CE sing N N 277 MET CE HE1 sing N N 278 MET CE HE2 sing N N 279 MET CE HE3 sing N N 280 MET OXT HXT sing N N 281 PHE N CA sing N N 282 PHE N H sing N N 283 PHE N H2 sing N N 284 PHE CA C sing N N 285 PHE CA CB sing N N 286 PHE CA HA sing N N 287 PHE C O doub N N 288 PHE C OXT sing N N 289 PHE CB CG sing N N 290 PHE CB HB2 sing N N 291 PHE CB HB3 sing N N 292 PHE CG CD1 doub Y N 293 PHE CG CD2 sing Y N 294 PHE CD1 CE1 sing Y N 295 PHE CD1 HD1 sing N N 296 PHE CD2 CE2 doub Y N 297 PHE CD2 HD2 sing N N 298 PHE CE1 CZ doub Y N 299 PHE CE1 HE1 sing N N 300 PHE CE2 CZ sing Y N 301 PHE CE2 HE2 sing N N 302 PHE CZ HZ sing N N 303 PHE OXT HXT sing N N 304 PRO N CA sing N N 305 PRO N CD sing N N 306 PRO N H sing N N 307 PRO CA C sing N N 308 PRO CA CB sing N N 309 PRO CA HA sing N N 310 PRO C O doub N N 311 PRO C OXT sing N N 312 PRO CB CG sing N N 313 PRO CB HB2 sing N N 314 PRO CB HB3 sing N N 315 PRO CG CD sing N N 316 PRO CG HG2 sing N N 317 PRO CG HG3 sing N N 318 PRO CD HD2 sing N N 319 PRO CD HD3 sing N N 320 PRO OXT HXT sing N N 321 SER N CA sing N N 322 SER N H sing N N 323 SER N H2 sing N N 324 SER CA C sing N N 325 SER CA CB sing N N 326 SER CA HA sing N N 327 SER C O doub N N 328 SER C OXT sing N N 329 SER CB OG sing N N 330 SER CB HB2 sing N N 331 SER CB HB3 sing N N 332 SER OG HG sing N N 333 SER OXT HXT sing N N 334 SO4 S O1 doub N N 335 SO4 S O2 doub N N 336 SO4 S O3 sing N N 337 SO4 S O4 sing N N 338 THR N CA sing N N 339 THR N H sing N N 340 THR N H2 sing N N 341 THR CA C sing N N 342 THR CA CB sing N N 343 THR CA HA sing N N 344 THR C O doub N N 345 THR C OXT sing N N 346 THR CB OG1 sing N N 347 THR CB CG2 sing N N 348 THR CB HB sing N N 349 THR OG1 HG1 sing N N 350 THR CG2 HG21 sing N N 351 THR CG2 HG22 sing N N 352 THR CG2 HG23 sing N N 353 THR OXT HXT sing N N 354 TYR N CA sing N N 355 TYR N H sing N N 356 TYR N H2 sing N N 357 TYR CA C sing N N 358 TYR CA CB sing N N 359 TYR CA HA sing N N 360 TYR C O doub N N 361 TYR C OXT sing N N 362 TYR CB CG sing N N 363 TYR CB HB2 sing N N 364 TYR CB HB3 sing N N 365 TYR CG CD1 doub Y N 366 TYR CG CD2 sing Y N 367 TYR CD1 CE1 sing Y N 368 TYR CD1 HD1 sing N N 369 TYR CD2 CE2 doub Y N 370 TYR CD2 HD2 sing N N 371 TYR CE1 CZ doub Y N 372 TYR CE1 HE1 sing N N 373 TYR CE2 CZ sing Y N 374 TYR CE2 HE2 sing N N 375 TYR CZ OH sing N N 376 TYR OH HH sing N N 377 TYR OXT HXT sing N N 378 VAL N CA sing N N 379 VAL N H sing N N 380 VAL N H2 sing N N 381 VAL CA C sing N N 382 VAL CA CB sing N N 383 VAL CA HA sing N N 384 VAL C O doub N N 385 VAL C OXT sing N N 386 VAL CB CG1 sing N N 387 VAL CB CG2 sing N N 388 VAL CB HB sing N N 389 VAL CG1 HG11 sing N N 390 VAL CG1 HG12 sing N N 391 VAL CG1 HG13 sing N N 392 VAL CG2 HG21 sing N N 393 VAL CG2 HG22 sing N N 394 VAL CG2 HG23 sing N N 395 VAL OXT HXT sing N N 396 # _pdbx_audit_support.funding_organization 'National Natural Science Foundation of China (NSFC)' _pdbx_audit_support.country China _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'in silico model' _pdbx_initial_refinement_model.source_name AlphaFold _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 9LDH _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.017109 _atom_sites.fract_transf_matrix[1][2] 0.009878 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.019755 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.004487 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O P S # loop_ # loop_ #