data_9MGU # _entry.id 9MGU # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.406 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9MGU pdb_00009mgu 10.2210/pdb9mgu/pdb WWPDB D_1000289483 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2025-09-03 ? 2 'Structure model' 1 1 2025-09-17 ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' 12 2 'Structure model' '_citation_author.identifier_ORCID' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9MGU _pdbx_database_status.recvd_initial_deposition_date 2024-12-11 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email Albert.berguis@mcgill.ca _pdbx_contact_author.name_first Albert _pdbx_contact_author.name_last Berghuis _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-2663-025X # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Hemmings, M.' 1 0009-0009-2849-4894 'Blanchet, J.' 2 ? 'Zielinski, M.' 3 ? 'Golkar, T.' 4 ? 'Berghuis, A.M.' 5 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Commun Chem' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2399-3669 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 8 _citation.language ? _citation.page_first 258 _citation.page_last 258 _citation.title 'Enzyme-mediated aminoglycoside resistance without target mimicry.' _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s42004-025-01666-0 _citation.pdbx_database_id_PubMed 40855189 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Hemmings, M.' 1 0009-0009-2849-4894 primary 'Zielinski, M.' 2 ? primary 'Golkar, T.' 3 ? primary 'Blanchet, J.' 4 ? primary 'Pistofidis, A.' 5 ? primary 'Munro, K.' 6 ? primary 'Schmeing, T.M.' 7 0000-0002-8061-0436 primary 'Bohle, D.S.' 8 ? primary 'Berghuis, A.M.' 9 0000-0002-2663-025X # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Aminoglycoside acetyltransferase' 16931.188 1 ? ? ? ? 2 non-polymer syn 'COENZYME A' 767.534 1 ? ? ? ? 3 water nat water 18.015 29 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGIIRTCRLGPDQVKSMRAALDLFGREFGGVATYSQHQPDSDYLGNLLRSKTFIALAAFDQEAVVGALAAYVLPKFEQAR SEIYIYDLAVSGEHRRQGIATALINLLKHEANALGAYVIYVQADYGDDPAVALYTKLGIREEVMHFDIDPSTAT ; _entity_poly.pdbx_seq_one_letter_code_can ;MGIIRTCRLGPDQVKSMRAALDLFGREFGGVATYSQHQPDSDYLGNLLRSKTFIALAAFDQEAVVGALAAYVLPKFEQAR SEIYIYDLAVSGEHRRQGIATALINLLKHEANALGAYVIYVQADYGDDPAVALYTKLGIREEVMHFDIDPSTAT ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'COENZYME A' COA 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 ILE n 1 4 ILE n 1 5 ARG n 1 6 THR n 1 7 CYS n 1 8 ARG n 1 9 LEU n 1 10 GLY n 1 11 PRO n 1 12 ASP n 1 13 GLN n 1 14 VAL n 1 15 LYS n 1 16 SER n 1 17 MET n 1 18 ARG n 1 19 ALA n 1 20 ALA n 1 21 LEU n 1 22 ASP n 1 23 LEU n 1 24 PHE n 1 25 GLY n 1 26 ARG n 1 27 GLU n 1 28 PHE n 1 29 GLY n 1 30 GLY n 1 31 VAL n 1 32 ALA n 1 33 THR n 1 34 TYR n 1 35 SER n 1 36 GLN n 1 37 HIS n 1 38 GLN n 1 39 PRO n 1 40 ASP n 1 41 SER n 1 42 ASP n 1 43 TYR n 1 44 LEU n 1 45 GLY n 1 46 ASN n 1 47 LEU n 1 48 LEU n 1 49 ARG n 1 50 SER n 1 51 LYS n 1 52 THR n 1 53 PHE n 1 54 ILE n 1 55 ALA n 1 56 LEU n 1 57 ALA n 1 58 ALA n 1 59 PHE n 1 60 ASP n 1 61 GLN n 1 62 GLU n 1 63 ALA n 1 64 VAL n 1 65 VAL n 1 66 GLY n 1 67 ALA n 1 68 LEU n 1 69 ALA n 1 70 ALA n 1 71 TYR n 1 72 VAL n 1 73 LEU n 1 74 PRO n 1 75 LYS n 1 76 PHE n 1 77 GLU n 1 78 GLN n 1 79 ALA n 1 80 ARG n 1 81 SER n 1 82 GLU n 1 83 ILE n 1 84 TYR n 1 85 ILE n 1 86 TYR n 1 87 ASP n 1 88 LEU n 1 89 ALA n 1 90 VAL n 1 91 SER n 1 92 GLY n 1 93 GLU n 1 94 HIS n 1 95 ARG n 1 96 ARG n 1 97 GLN n 1 98 GLY n 1 99 ILE n 1 100 ALA n 1 101 THR n 1 102 ALA n 1 103 LEU n 1 104 ILE n 1 105 ASN n 1 106 LEU n 1 107 LEU n 1 108 LYS n 1 109 HIS n 1 110 GLU n 1 111 ALA n 1 112 ASN n 1 113 ALA n 1 114 LEU n 1 115 GLY n 1 116 ALA n 1 117 TYR n 1 118 VAL n 1 119 ILE n 1 120 TYR n 1 121 VAL n 1 122 GLN n 1 123 ALA n 1 124 ASP n 1 125 TYR n 1 126 GLY n 1 127 ASP n 1 128 ASP n 1 129 PRO n 1 130 ALA n 1 131 VAL n 1 132 ALA n 1 133 LEU n 1 134 TYR n 1 135 THR n 1 136 LYS n 1 137 LEU n 1 138 GLY n 1 139 ILE n 1 140 ARG n 1 141 GLU n 1 142 GLU n 1 143 VAL n 1 144 MET n 1 145 HIS n 1 146 PHE n 1 147 ASP n 1 148 ILE n 1 149 ASP n 1 150 PRO n 1 151 SER n 1 152 THR n 1 153 ALA n 1 154 THR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 154 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene aac1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Acinetobacter baumannii' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 470 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ;Escherichia coli 'BL21-Gold(DE3)pLysS AG' ; _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 866768 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 COA non-polymer . 'COENZYME A' ? 'C21 H36 N7 O16 P3 S' 767.534 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 24 ? ? ? A . n A 1 2 GLY 2 25 25 GLY GLY A . n A 1 3 ILE 3 26 26 ILE ILE A . n A 1 4 ILE 4 27 27 ILE ILE A . n A 1 5 ARG 5 28 28 ARG ARG A . n A 1 6 THR 6 29 29 THR THR A . n A 1 7 CYS 7 30 30 CYS CYS A . n A 1 8 ARG 8 31 31 ARG ARG A . n A 1 9 LEU 9 32 32 LEU LEU A . n A 1 10 GLY 10 33 33 GLY GLY A . n A 1 11 PRO 11 34 34 PRO PRO A . n A 1 12 ASP 12 35 35 ASP ASP A . n A 1 13 GLN 13 36 36 GLN GLN A . n A 1 14 VAL 14 37 37 VAL VAL A . n A 1 15 LYS 15 38 38 LYS LYS A . n A 1 16 SER 16 39 39 SER SER A . n A 1 17 MET 17 40 40 MET MET A . n A 1 18 ARG 18 41 41 ARG ARG A . n A 1 19 ALA 19 42 42 ALA ALA A . n A 1 20 ALA 20 43 43 ALA ALA A . n A 1 21 LEU 21 44 44 LEU LEU A . n A 1 22 ASP 22 45 45 ASP ASP A . n A 1 23 LEU 23 46 46 LEU LEU A . n A 1 24 PHE 24 47 47 PHE PHE A . n A 1 25 GLY 25 48 48 GLY GLY A . n A 1 26 ARG 26 49 49 ARG ARG A . n A 1 27 GLU 27 50 50 GLU GLU A . n A 1 28 PHE 28 51 51 PHE PHE A . n A 1 29 GLY 29 52 52 GLY GLY A . n A 1 30 GLY 30 53 53 GLY GLY A . n A 1 31 VAL 31 54 54 VAL VAL A . n A 1 32 ALA 32 55 ? ? ? A . n A 1 33 THR 33 56 56 THR THR A . n A 1 34 TYR 34 57 57 TYR TYR A . n A 1 35 SER 35 58 58 SER SER A . n A 1 36 GLN 36 59 59 GLN GLN A . n A 1 37 HIS 37 60 60 HIS HIS A . n A 1 38 GLN 38 61 61 GLN GLN A . n A 1 39 PRO 39 62 62 PRO PRO A . n A 1 40 ASP 40 63 63 ASP ASP A . n A 1 41 SER 41 64 64 SER SER A . n A 1 42 ASP 42 65 65 ASP ASP A . n A 1 43 TYR 43 66 66 TYR TYR A . n A 1 44 LEU 44 67 67 LEU LEU A . n A 1 45 GLY 45 68 68 GLY GLY A . n A 1 46 ASN 46 69 69 ASN ASN A . n A 1 47 LEU 47 70 70 LEU LEU A . n A 1 48 LEU 48 71 71 LEU LEU A . n A 1 49 ARG 49 72 72 ARG ARG A . n A 1 50 SER 50 73 73 SER SER A . n A 1 51 LYS 51 74 74 LYS LYS A . n A 1 52 THR 52 75 75 THR THR A . n A 1 53 PHE 53 76 76 PHE PHE A . n A 1 54 ILE 54 77 77 ILE ILE A . n A 1 55 ALA 55 78 78 ALA ALA A . n A 1 56 LEU 56 79 79 LEU LEU A . n A 1 57 ALA 57 80 80 ALA ALA A . n A 1 58 ALA 58 81 81 ALA ALA A . n A 1 59 PHE 59 82 82 PHE PHE A . n A 1 60 ASP 60 83 83 ASP ASP A . n A 1 61 GLN 61 84 84 GLN GLN A . n A 1 62 GLU 62 85 85 GLU GLU A . n A 1 63 ALA 63 86 86 ALA ALA A . n A 1 64 VAL 64 87 87 VAL VAL A . n A 1 65 VAL 65 88 88 VAL VAL A . n A 1 66 GLY 66 89 89 GLY GLY A . n A 1 67 ALA 67 90 90 ALA ALA A . n A 1 68 LEU 68 91 91 LEU LEU A . n A 1 69 ALA 69 92 92 ALA ALA A . n A 1 70 ALA 70 93 93 ALA ALA A . n A 1 71 TYR 71 94 94 TYR TYR A . n A 1 72 VAL 72 95 95 VAL VAL A . n A 1 73 LEU 73 96 96 LEU LEU A . n A 1 74 PRO 74 97 97 PRO PRO A . n A 1 75 LYS 75 98 98 LYS LYS A . n A 1 76 PHE 76 99 99 PHE PHE A . n A 1 77 GLU 77 100 100 GLU GLU A . n A 1 78 GLN 78 101 101 GLN GLN A . n A 1 79 ALA 79 102 102 ALA ALA A . n A 1 80 ARG 80 103 103 ARG ARG A . n A 1 81 SER 81 104 104 SER SER A . n A 1 82 GLU 82 105 105 GLU GLU A . n A 1 83 ILE 83 106 106 ILE ILE A . n A 1 84 TYR 84 107 107 TYR TYR A . n A 1 85 ILE 85 108 108 ILE ILE A . n A 1 86 TYR 86 109 109 TYR TYR A . n A 1 87 ASP 87 110 110 ASP ASP A . n A 1 88 LEU 88 111 111 LEU LEU A . n A 1 89 ALA 89 112 112 ALA ALA A . n A 1 90 VAL 90 113 113 VAL VAL A . n A 1 91 SER 91 114 114 SER SER A . n A 1 92 GLY 92 115 115 GLY GLY A . n A 1 93 GLU 93 116 116 GLU GLU A . n A 1 94 HIS 94 117 117 HIS HIS A . n A 1 95 ARG 95 118 118 ARG ARG A . n A 1 96 ARG 96 119 119 ARG ARG A . n A 1 97 GLN 97 120 120 GLN GLN A . n A 1 98 GLY 98 121 121 GLY GLY A . n A 1 99 ILE 99 122 122 ILE ILE A . n A 1 100 ALA 100 123 123 ALA ALA A . n A 1 101 THR 101 124 124 THR THR A . n A 1 102 ALA 102 125 125 ALA ALA A . n A 1 103 LEU 103 126 126 LEU LEU A . n A 1 104 ILE 104 127 127 ILE ILE A . n A 1 105 ASN 105 128 128 ASN ASN A . n A 1 106 LEU 106 129 129 LEU LEU A . n A 1 107 LEU 107 130 130 LEU LEU A . n A 1 108 LYS 108 131 131 LYS LYS A . n A 1 109 HIS 109 132 132 HIS HIS A . n A 1 110 GLU 110 133 133 GLU GLU A . n A 1 111 ALA 111 134 134 ALA ALA A . n A 1 112 ASN 112 135 135 ASN ASN A . n A 1 113 ALA 113 136 136 ALA ALA A . n A 1 114 LEU 114 137 137 LEU LEU A . n A 1 115 GLY 115 138 138 GLY GLY A . n A 1 116 ALA 116 139 139 ALA ALA A . n A 1 117 TYR 117 140 140 TYR TYR A . n A 1 118 VAL 118 141 141 VAL VAL A . n A 1 119 ILE 119 142 142 ILE ILE A . n A 1 120 TYR 120 143 143 TYR TYR A . n A 1 121 VAL 121 144 144 VAL VAL A . n A 1 122 GLN 122 145 145 GLN GLN A . n A 1 123 ALA 123 146 146 ALA ALA A . n A 1 124 ASP 124 147 147 ASP ASP A . n A 1 125 TYR 125 148 148 TYR TYR A . n A 1 126 GLY 126 149 149 GLY GLY A . n A 1 127 ASP 127 150 150 ASP ASP A . n A 1 128 ASP 128 151 151 ASP ASP A . n A 1 129 PRO 129 152 152 PRO PRO A . n A 1 130 ALA 130 153 153 ALA ALA A . n A 1 131 VAL 131 154 154 VAL VAL A . n A 1 132 ALA 132 155 155 ALA ALA A . n A 1 133 LEU 133 156 156 LEU LEU A . n A 1 134 TYR 134 157 157 TYR TYR A . n A 1 135 THR 135 158 158 THR THR A . n A 1 136 LYS 136 159 159 LYS LYS A . n A 1 137 LEU 137 160 160 LEU LEU A . n A 1 138 GLY 138 161 161 GLY GLY A . n A 1 139 ILE 139 162 162 ILE ILE A . n A 1 140 ARG 140 163 163 ARG ARG A . n A 1 141 GLU 141 164 164 GLU GLU A . n A 1 142 GLU 142 165 165 GLU GLU A . n A 1 143 VAL 143 166 166 VAL VAL A . n A 1 144 MET 144 167 167 MET MET A . n A 1 145 HIS 145 168 168 HIS HIS A . n A 1 146 PHE 146 169 169 PHE PHE A . n A 1 147 ASP 147 170 170 ASP ASP A . n A 1 148 ILE 148 171 171 ILE ILE A . n A 1 149 ASP 149 172 172 ASP ASP A . n A 1 150 PRO 150 173 173 PRO PRO A . n A 1 151 SER 151 174 174 SER SER A . n A 1 152 THR 152 175 175 THR THR A . n A 1 153 ALA 153 176 176 ALA ALA A . n A 1 154 THR 154 177 177 THR THR A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id COA _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id COA _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 COA 1 201 201 COA COA A . C 3 HOH 1 301 14 HOH HOH A . C 3 HOH 2 302 2 HOH HOH A . C 3 HOH 3 303 6 HOH HOH A . C 3 HOH 4 304 8 HOH HOH A . C 3 HOH 5 305 7 HOH HOH A . C 3 HOH 6 306 24 HOH HOH A . C 3 HOH 7 307 4 HOH HOH A . C 3 HOH 8 308 21 HOH HOH A . C 3 HOH 9 309 11 HOH HOH A . C 3 HOH 10 310 26 HOH HOH A . C 3 HOH 11 311 23 HOH HOH A . C 3 HOH 12 312 13 HOH HOH A . C 3 HOH 13 313 27 HOH HOH A . C 3 HOH 14 314 16 HOH HOH A . C 3 HOH 15 315 9 HOH HOH A . C 3 HOH 16 316 3 HOH HOH A . C 3 HOH 17 317 5 HOH HOH A . C 3 HOH 18 318 12 HOH HOH A . C 3 HOH 19 319 18 HOH HOH A . C 3 HOH 20 320 10 HOH HOH A . C 3 HOH 21 321 1 HOH HOH A . C 3 HOH 22 322 17 HOH HOH A . C 3 HOH 23 323 25 HOH HOH A . C 3 HOH 24 324 15 HOH HOH A . C 3 HOH 25 325 20 HOH HOH A . C 3 HOH 26 326 22 HOH HOH A . C 3 HOH 27 327 28 HOH HOH A . C 3 HOH 28 328 29 HOH HOH A . C 3 HOH 29 329 19 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 28 ? CG ? A ARG 5 CG 2 1 Y 1 A ARG 28 ? CD ? A ARG 5 CD 3 1 Y 1 A ARG 28 ? NE ? A ARG 5 NE 4 1 Y 1 A ARG 28 ? CZ ? A ARG 5 CZ 5 1 Y 1 A ARG 28 ? NH1 ? A ARG 5 NH1 6 1 Y 1 A ARG 28 ? NH2 ? A ARG 5 NH2 7 1 Y 1 A ASP 35 ? CG ? A ASP 12 CG 8 1 Y 1 A ASP 35 ? OD1 ? A ASP 12 OD1 9 1 Y 1 A ASP 35 ? OD2 ? A ASP 12 OD2 10 1 Y 1 A LYS 38 ? CG ? A LYS 15 CG 11 1 Y 1 A LYS 38 ? CD ? A LYS 15 CD 12 1 Y 1 A LYS 38 ? CE ? A LYS 15 CE 13 1 Y 1 A LYS 38 ? NZ ? A LYS 15 NZ 14 1 Y 1 A GLU 50 ? CG ? A GLU 27 CG 15 1 Y 1 A GLU 50 ? CD ? A GLU 27 CD 16 1 Y 1 A GLU 50 ? OE1 ? A GLU 27 OE1 17 1 Y 1 A GLU 50 ? OE2 ? A GLU 27 OE2 18 1 Y 1 A THR 56 ? OG1 ? A THR 33 OG1 19 1 Y 1 A THR 56 ? CG2 ? A THR 33 CG2 20 1 Y 1 A GLN 59 ? CG ? A GLN 36 CG 21 1 Y 1 A GLN 59 ? CD ? A GLN 36 CD 22 1 Y 1 A GLN 59 ? OE1 ? A GLN 36 OE1 23 1 Y 1 A GLN 59 ? NE2 ? A GLN 36 NE2 24 1 Y 1 A LYS 74 ? CG ? A LYS 51 CG 25 1 Y 1 A LYS 74 ? CD ? A LYS 51 CD 26 1 Y 1 A LYS 74 ? CE ? A LYS 51 CE 27 1 Y 1 A LYS 74 ? NZ ? A LYS 51 NZ 28 1 Y 1 A GLN 84 ? CG ? A GLN 61 CG 29 1 Y 1 A GLN 84 ? CD ? A GLN 61 CD 30 1 Y 1 A GLN 84 ? OE1 ? A GLN 61 OE1 31 1 Y 1 A GLN 84 ? NE2 ? A GLN 61 NE2 32 1 Y 1 A GLU 85 ? CG ? A GLU 62 CG 33 1 Y 1 A GLU 85 ? CD ? A GLU 62 CD 34 1 Y 1 A GLU 85 ? OE1 ? A GLU 62 OE1 35 1 Y 1 A GLU 85 ? OE2 ? A GLU 62 OE2 36 1 Y 1 A GLU 116 ? CG ? A GLU 93 CG 37 1 Y 1 A GLU 116 ? CD ? A GLU 93 CD 38 1 Y 1 A GLU 116 ? OE1 ? A GLU 93 OE1 39 1 Y 1 A GLU 116 ? OE2 ? A GLU 93 OE2 40 1 Y 1 A ARG 119 ? CG ? A ARG 96 CG 41 1 Y 1 A ARG 119 ? CD ? A ARG 96 CD 42 1 Y 1 A ARG 119 ? NE ? A ARG 96 NE 43 1 Y 1 A ARG 119 ? CZ ? A ARG 96 CZ 44 1 Y 1 A ARG 119 ? NH1 ? A ARG 96 NH1 45 1 Y 1 A ARG 119 ? NH2 ? A ARG 96 NH2 46 1 Y 1 A LYS 159 ? CG ? A LYS 136 CG 47 1 Y 1 A LYS 159 ? CD ? A LYS 136 CD 48 1 Y 1 A LYS 159 ? CE ? A LYS 136 CE 49 1 Y 1 A LYS 159 ? NZ ? A LYS 136 NZ 50 1 Y 1 A GLU 164 ? CG ? A GLU 141 CG 51 1 Y 1 A GLU 164 ? CD ? A GLU 141 CD 52 1 Y 1 A GLU 164 ? OE1 ? A GLU 141 OE1 53 1 Y 1 A GLU 164 ? OE2 ? A GLU 141 OE2 54 1 Y 1 A SER 174 ? OG ? A SER 151 OG # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.20.1_4487 2 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 9MGU _cell.details ? _cell.formula_units_Z ? _cell.length_a 57.459 _cell.length_a_esd ? _cell.length_b 57.459 _cell.length_b_esd ? _cell.length_c 123.383 _cell.length_c_esd ? _cell.volume 407353.500 _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9MGU _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 _symmetry.space_group_name_Hall 'P 4nw 2abw' _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9MGU _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.01 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 59.10 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '10 mg/mL AAC(3)-Ia with a 10x molar excess of gentamicin and CoASH in 0.1 M Tris Ph 8.5, 0.05 M MgCl2, 20% EtOH, 35% PEG 400.' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 295.15 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2023-02-08 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9537 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'CLSI BEAMLINE 08ID-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9537 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 08ID-1 _diffrn_source.pdbx_synchrotron_site CLSI # _reflns.B_iso_Wilson_estimate 30.39 _reflns.entry_id 9MGU _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.34 _reflns.d_resolution_low 28.9 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 8695 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 92.84 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 8.4 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 7.22 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.99 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.34 _reflns_shell.d_res_low 2.67 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.98 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 5576 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.765 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 36.43 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9MGU _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.34 _refine.ls_d_res_low 28.90 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 8665 _refine.ls_number_reflns_R_free 446 _refine.ls_number_reflns_R_work 8219 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 92.84 _refine.ls_percent_reflns_R_free 5.15 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2142 _refine.ls_R_factor_R_free 0.2584 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2117 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'FOURIER SYNTHESIS' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 26.2129 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2513 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.34 _refine_hist.d_res_low 28.90 _refine_hist.number_atoms_solvent 29 _refine_hist.number_atoms_total 1203 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1126 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 48 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0124 ? 1198 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.4230 ? 1640 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0632 ? 187 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0109 ? 207 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 11.5234 ? 193 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.34 2.67 . . 111 2359 81.73 . . . . 0.2227 . . . . . . . . . . . 0.2738 'X-RAY DIFFRACTION' 2.67 3.37 . . 160 2896 99.54 . . . . 0.2318 . . . . . . . . . . . 0.2993 'X-RAY DIFFRACTION' 3.37 28.90 . . 175 2964 96.88 . . . . 0.1986 . . . . . . . . . . . 0.2361 # _struct.entry_id 9MGU _struct.title 'Structure of aminoglycoside acetyltransferase AAC(3)-Ia in complex with CoA' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9MGU _struct_keywords.text 'antibiotic resistance, aminoglycosides, transferase' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code D7R512_ACIBA _struct_ref.pdbx_db_accession D7R512 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MGIIRTCRLGPDQVKSMRAALDLFGREFGGVATYSQHQPDSDYLGNLLRSKTFIALAAFDQEAVVGALAAYVLPKFEQAR SEIYIYDLAVSGEHRRQGIATALINLLKHEANALGAYVIYVQADYGDDPAVALYTKLGIREEVMHFDIDPSTAT ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9MGU _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 154 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession D7R512 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 154 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 24 _struct_ref_seq.pdbx_auth_seq_align_end 177 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 7840 ? 1 MORE -41 ? 1 'SSA (A^2)' 13020 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 8_555 -y,-x,-z+1/2 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 61.6915000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 10 ? ASP A 12 ? GLY A 33 ASP A 35 5 ? 3 HELX_P HELX_P2 AA2 GLN A 13 ? PHE A 28 ? GLN A 36 PHE A 51 1 ? 16 HELX_P HELX_P3 AA3 GLY A 30 ? VAL A 31 ? GLY A 53 VAL A 54 5 ? 2 HELX_P HELX_P4 AA4 THR A 33 ? SER A 35 ? THR A 56 SER A 58 5 ? 3 HELX_P HELX_P5 AA5 ASP A 40 ? SER A 50 ? ASP A 63 SER A 73 1 ? 11 HELX_P HELX_P6 AA6 GLY A 92 ? ARG A 95 ? GLY A 115 ARG A 118 5 ? 4 HELX_P HELX_P7 AA7 GLY A 98 ? LEU A 114 ? GLY A 121 LEU A 137 1 ? 17 HELX_P HELX_P8 AA8 ASP A 127 ? GLY A 138 ? ASP A 150 GLY A 161 1 ? 12 HELX_P HELX_P9 AA9 ASP A 149 ? ALA A 153 ? ASP A 172 ALA A 176 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ARG A 5 ? ARG A 8 ? ARG A 28 ARG A 31 AA1 2 PHE A 53 ? PHE A 59 ? PHE A 76 PHE A 82 AA1 3 VAL A 64 ? PRO A 74 ? VAL A 87 PRO A 97 AA1 4 SER A 81 ? VAL A 90 ? SER A 104 VAL A 113 AA1 5 ALA A 116 ? VAL A 121 ? ALA A 139 VAL A 144 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ARG A 5 ? N ARG A 28 O PHE A 59 ? O PHE A 82 AA1 2 3 N LEU A 56 ? N LEU A 79 O LEU A 68 ? O LEU A 91 AA1 3 4 N LEU A 73 ? N LEU A 96 O GLU A 82 ? O GLU A 105 AA1 4 5 N ILE A 83 ? N ILE A 106 O TYR A 120 ? O TYR A 143 # _pdbx_entry_details.entry_id 9MGU _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 84 ? ? -114.44 -87.58 2 1 ALA A 102 ? ? -68.71 87.36 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y+1/2,x+1/2,z+3/4 3 y+1/2,-x+1/2,z+1/4 4 x+1/2,-y+1/2,-z+1/4 5 -x+1/2,y+1/2,-z+3/4 6 -x,-y,z+1/2 7 y,x,-z 8 -y,-x,-z+1/2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 24 ? A MET 1 2 1 Y 1 A ALA 55 ? A ALA 32 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 COA N1A N Y N 74 COA C2A C Y N 75 COA N3A N Y N 76 COA C4A C Y N 77 COA C5A C Y N 78 COA C6A C Y N 79 COA N6A N N N 80 COA N7A N Y N 81 COA C8A C Y N 82 COA N9A N Y N 83 COA C1B C N R 84 COA C2B C N R 85 COA O2B O N N 86 COA C3B C N S 87 COA O3B O N N 88 COA P3B P N N 89 COA O7A O N N 90 COA O8A O N N 91 COA O9A O N N 92 COA C4B C N R 93 COA O4B O N N 94 COA C5B C N N 95 COA O5B O N N 96 COA P1A P N S 97 COA O1A O N N 98 COA O2A O N N 99 COA O3A O N N 100 COA P2A P N S 101 COA O4A O N N 102 COA O5A O N N 103 COA O6A O N N 104 COA CBP C N N 105 COA CCP C N N 106 COA CDP C N N 107 COA CEP C N N 108 COA CAP C N R 109 COA OAP O N N 110 COA C9P C N N 111 COA O9P O N N 112 COA N8P N N N 113 COA C7P C N N 114 COA C6P C N N 115 COA C5P C N N 116 COA O5P O N N 117 COA N4P N N N 118 COA C3P C N N 119 COA C2P C N N 120 COA S1P S N N 121 COA H2A H N N 122 COA H61A H N N 123 COA H62A H N N 124 COA H8A H N N 125 COA H1B H N N 126 COA H2B H N N 127 COA HO2A H N N 128 COA H3B H N N 129 COA HOA8 H N N 130 COA HOA9 H N N 131 COA H4B H N N 132 COA H51A H N N 133 COA H52A H N N 134 COA HOA2 H N N 135 COA HOA5 H N N 136 COA H121 H N N 137 COA H122 H N N 138 COA H131 H N N 139 COA H132 H N N 140 COA H133 H N N 141 COA H141 H N N 142 COA H142 H N N 143 COA H143 H N N 144 COA H10 H N N 145 COA HO1 H N N 146 COA HN8 H N N 147 COA H71 H N N 148 COA H72 H N N 149 COA H61 H N N 150 COA H62 H N N 151 COA HN4 H N N 152 COA H31 H N N 153 COA H32 H N N 154 COA H21 H N N 155 COA H22 H N N 156 COA HS1 H N N 157 CYS N N N N 158 CYS CA C N R 159 CYS C C N N 160 CYS O O N N 161 CYS CB C N N 162 CYS SG S N N 163 CYS OXT O N N 164 CYS H H N N 165 CYS H2 H N N 166 CYS HA H N N 167 CYS HB2 H N N 168 CYS HB3 H N N 169 CYS HG H N N 170 CYS HXT H N N 171 GLN N N N N 172 GLN CA C N S 173 GLN C C N N 174 GLN O O N N 175 GLN CB C N N 176 GLN CG C N N 177 GLN CD C N N 178 GLN OE1 O N N 179 GLN NE2 N N N 180 GLN OXT O N N 181 GLN H H N N 182 GLN H2 H N N 183 GLN HA H N N 184 GLN HB2 H N N 185 GLN HB3 H N N 186 GLN HG2 H N N 187 GLN HG3 H N N 188 GLN HE21 H N N 189 GLN HE22 H N N 190 GLN HXT H N N 191 GLU N N N N 192 GLU CA C N S 193 GLU C C N N 194 GLU O O N N 195 GLU CB C N N 196 GLU CG C N N 197 GLU CD C N N 198 GLU OE1 O N N 199 GLU OE2 O N N 200 GLU OXT O N N 201 GLU H H N N 202 GLU H2 H N N 203 GLU HA H N N 204 GLU HB2 H N N 205 GLU HB3 H N N 206 GLU HG2 H N N 207 GLU HG3 H N N 208 GLU HE2 H N N 209 GLU HXT H N N 210 GLY N N N N 211 GLY CA C N N 212 GLY C C N N 213 GLY O O N N 214 GLY OXT O N N 215 GLY H H N N 216 GLY H2 H N N 217 GLY HA2 H N N 218 GLY HA3 H N N 219 GLY HXT H N N 220 HIS N N N N 221 HIS CA C N S 222 HIS C C N N 223 HIS O O N N 224 HIS CB C N N 225 HIS CG C Y N 226 HIS ND1 N Y N 227 HIS CD2 C Y N 228 HIS CE1 C Y N 229 HIS NE2 N Y N 230 HIS OXT O N N 231 HIS H H N N 232 HIS H2 H N N 233 HIS HA H N N 234 HIS HB2 H N N 235 HIS HB3 H N N 236 HIS HD1 H N N 237 HIS HD2 H N N 238 HIS HE1 H N N 239 HIS HE2 H N N 240 HIS HXT H N N 241 HOH O O N N 242 HOH H1 H N N 243 HOH H2 H N N 244 ILE N N N N 245 ILE CA C N S 246 ILE C C N N 247 ILE O O N N 248 ILE CB C N S 249 ILE CG1 C N N 250 ILE CG2 C N N 251 ILE CD1 C N N 252 ILE OXT O N N 253 ILE H H N N 254 ILE H2 H N N 255 ILE HA H N N 256 ILE HB H N N 257 ILE HG12 H N N 258 ILE HG13 H N N 259 ILE HG21 H N N 260 ILE HG22 H N N 261 ILE HG23 H N N 262 ILE HD11 H N N 263 ILE HD12 H N N 264 ILE HD13 H N N 265 ILE HXT H N N 266 LEU N N N N 267 LEU CA C N S 268 LEU C C N N 269 LEU O O N N 270 LEU CB C N N 271 LEU CG C N N 272 LEU CD1 C N N 273 LEU CD2 C N N 274 LEU OXT O N N 275 LEU H H N N 276 LEU H2 H N N 277 LEU HA H N N 278 LEU HB2 H N N 279 LEU HB3 H N N 280 LEU HG H N N 281 LEU HD11 H N N 282 LEU HD12 H N N 283 LEU HD13 H N N 284 LEU HD21 H N N 285 LEU HD22 H N N 286 LEU HD23 H N N 287 LEU HXT H N N 288 LYS N N N N 289 LYS CA C N S 290 LYS C C N N 291 LYS O O N N 292 LYS CB C N N 293 LYS CG C N N 294 LYS CD C N N 295 LYS CE C N N 296 LYS NZ N N N 297 LYS OXT O N N 298 LYS H H N N 299 LYS H2 H N N 300 LYS HA H N N 301 LYS HB2 H N N 302 LYS HB3 H N N 303 LYS HG2 H N N 304 LYS HG3 H N N 305 LYS HD2 H N N 306 LYS HD3 H N N 307 LYS HE2 H N N 308 LYS HE3 H N N 309 LYS HZ1 H N N 310 LYS HZ2 H N N 311 LYS HZ3 H N N 312 LYS HXT H N N 313 MET N N N N 314 MET CA C N S 315 MET C C N N 316 MET O O N N 317 MET CB C N N 318 MET CG C N N 319 MET SD S N N 320 MET CE C N N 321 MET OXT O N N 322 MET H H N N 323 MET H2 H N N 324 MET HA H N N 325 MET HB2 H N N 326 MET HB3 H N N 327 MET HG2 H N N 328 MET HG3 H N N 329 MET HE1 H N N 330 MET HE2 H N N 331 MET HE3 H N N 332 MET HXT H N N 333 PHE N N N N 334 PHE CA C N S 335 PHE C C N N 336 PHE O O N N 337 PHE CB C N N 338 PHE CG C Y N 339 PHE CD1 C Y N 340 PHE CD2 C Y N 341 PHE CE1 C Y N 342 PHE CE2 C Y N 343 PHE CZ C Y N 344 PHE OXT O N N 345 PHE H H N N 346 PHE H2 H N N 347 PHE HA H N N 348 PHE HB2 H N N 349 PHE HB3 H N N 350 PHE HD1 H N N 351 PHE HD2 H N N 352 PHE HE1 H N N 353 PHE HE2 H N N 354 PHE HZ H N N 355 PHE HXT H N N 356 PRO N N N N 357 PRO CA C N S 358 PRO C C N N 359 PRO O O N N 360 PRO CB C N N 361 PRO CG C N N 362 PRO CD C N N 363 PRO OXT O N N 364 PRO H H N N 365 PRO HA H N N 366 PRO HB2 H N N 367 PRO HB3 H N N 368 PRO HG2 H N N 369 PRO HG3 H N N 370 PRO HD2 H N N 371 PRO HD3 H N N 372 PRO HXT H N N 373 SER N N N N 374 SER CA C N S 375 SER C C N N 376 SER O O N N 377 SER CB C N N 378 SER OG O N N 379 SER OXT O N N 380 SER H H N N 381 SER H2 H N N 382 SER HA H N N 383 SER HB2 H N N 384 SER HB3 H N N 385 SER HG H N N 386 SER HXT H N N 387 THR N N N N 388 THR CA C N S 389 THR C C N N 390 THR O O N N 391 THR CB C N R 392 THR OG1 O N N 393 THR CG2 C N N 394 THR OXT O N N 395 THR H H N N 396 THR H2 H N N 397 THR HA H N N 398 THR HB H N N 399 THR HG1 H N N 400 THR HG21 H N N 401 THR HG22 H N N 402 THR HG23 H N N 403 THR HXT H N N 404 TYR N N N N 405 TYR CA C N S 406 TYR C C N N 407 TYR O O N N 408 TYR CB C N N 409 TYR CG C Y N 410 TYR CD1 C Y N 411 TYR CD2 C Y N 412 TYR CE1 C Y N 413 TYR CE2 C Y N 414 TYR CZ C Y N 415 TYR OH O N N 416 TYR OXT O N N 417 TYR H H N N 418 TYR H2 H N N 419 TYR HA H N N 420 TYR HB2 H N N 421 TYR HB3 H N N 422 TYR HD1 H N N 423 TYR HD2 H N N 424 TYR HE1 H N N 425 TYR HE2 H N N 426 TYR HH H N N 427 TYR HXT H N N 428 VAL N N N N 429 VAL CA C N S 430 VAL C C N N 431 VAL O O N N 432 VAL CB C N N 433 VAL CG1 C N N 434 VAL CG2 C N N 435 VAL OXT O N N 436 VAL H H N N 437 VAL H2 H N N 438 VAL HA H N N 439 VAL HB H N N 440 VAL HG11 H N N 441 VAL HG12 H N N 442 VAL HG13 H N N 443 VAL HG21 H N N 444 VAL HG22 H N N 445 VAL HG23 H N N 446 VAL HXT H N N 447 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 COA N1A C2A sing Y N 70 COA N1A C6A doub Y N 71 COA C2A N3A doub Y N 72 COA C2A H2A sing N N 73 COA N3A C4A sing Y N 74 COA C4A C5A doub Y N 75 COA C4A N9A sing Y N 76 COA C5A C6A sing Y N 77 COA C5A N7A sing Y N 78 COA C6A N6A sing N N 79 COA N6A H61A sing N N 80 COA N6A H62A sing N N 81 COA N7A C8A doub Y N 82 COA C8A N9A sing Y N 83 COA C8A H8A sing N N 84 COA N9A C1B sing N N 85 COA C1B C2B sing N N 86 COA C1B O4B sing N N 87 COA C1B H1B sing N N 88 COA C2B O2B sing N N 89 COA C2B C3B sing N N 90 COA C2B H2B sing N N 91 COA O2B HO2A sing N N 92 COA C3B O3B sing N N 93 COA C3B C4B sing N N 94 COA C3B H3B sing N N 95 COA O3B P3B sing N N 96 COA P3B O7A doub N N 97 COA P3B O8A sing N N 98 COA P3B O9A sing N N 99 COA O8A HOA8 sing N N 100 COA O9A HOA9 sing N N 101 COA C4B O4B sing N N 102 COA C4B C5B sing N N 103 COA C4B H4B sing N N 104 COA C5B O5B sing N N 105 COA C5B H51A sing N N 106 COA C5B H52A sing N N 107 COA O5B P1A sing N N 108 COA P1A O1A doub N N 109 COA P1A O2A sing N N 110 COA P1A O3A sing N N 111 COA O2A HOA2 sing N N 112 COA O3A P2A sing N N 113 COA P2A O4A doub N N 114 COA P2A O5A sing N N 115 COA P2A O6A sing N N 116 COA O5A HOA5 sing N N 117 COA O6A CCP sing N N 118 COA CBP CCP sing N N 119 COA CBP CDP sing N N 120 COA CBP CEP sing N N 121 COA CBP CAP sing N N 122 COA CCP H121 sing N N 123 COA CCP H122 sing N N 124 COA CDP H131 sing N N 125 COA CDP H132 sing N N 126 COA CDP H133 sing N N 127 COA CEP H141 sing N N 128 COA CEP H142 sing N N 129 COA CEP H143 sing N N 130 COA CAP OAP sing N N 131 COA CAP C9P sing N N 132 COA CAP H10 sing N N 133 COA OAP HO1 sing N N 134 COA C9P O9P doub N N 135 COA C9P N8P sing N N 136 COA N8P C7P sing N N 137 COA N8P HN8 sing N N 138 COA C7P C6P sing N N 139 COA C7P H71 sing N N 140 COA C7P H72 sing N N 141 COA C6P C5P sing N N 142 COA C6P H61 sing N N 143 COA C6P H62 sing N N 144 COA C5P O5P doub N N 145 COA C5P N4P sing N N 146 COA N4P C3P sing N N 147 COA N4P HN4 sing N N 148 COA C3P C2P sing N N 149 COA C3P H31 sing N N 150 COA C3P H32 sing N N 151 COA C2P S1P sing N N 152 COA C2P H21 sing N N 153 COA C2P H22 sing N N 154 COA S1P HS1 sing N N 155 CYS N CA sing N N 156 CYS N H sing N N 157 CYS N H2 sing N N 158 CYS CA C sing N N 159 CYS CA CB sing N N 160 CYS CA HA sing N N 161 CYS C O doub N N 162 CYS C OXT sing N N 163 CYS CB SG sing N N 164 CYS CB HB2 sing N N 165 CYS CB HB3 sing N N 166 CYS SG HG sing N N 167 CYS OXT HXT sing N N 168 GLN N CA sing N N 169 GLN N H sing N N 170 GLN N H2 sing N N 171 GLN CA C sing N N 172 GLN CA CB sing N N 173 GLN CA HA sing N N 174 GLN C O doub N N 175 GLN C OXT sing N N 176 GLN CB CG sing N N 177 GLN CB HB2 sing N N 178 GLN CB HB3 sing N N 179 GLN CG CD sing N N 180 GLN CG HG2 sing N N 181 GLN CG HG3 sing N N 182 GLN CD OE1 doub N N 183 GLN CD NE2 sing N N 184 GLN NE2 HE21 sing N N 185 GLN NE2 HE22 sing N N 186 GLN OXT HXT sing N N 187 GLU N CA sing N N 188 GLU N H sing N N 189 GLU N H2 sing N N 190 GLU CA C sing N N 191 GLU CA CB sing N N 192 GLU CA HA sing N N 193 GLU C O doub N N 194 GLU C OXT sing N N 195 GLU CB CG sing N N 196 GLU CB HB2 sing N N 197 GLU CB HB3 sing N N 198 GLU CG CD sing N N 199 GLU CG HG2 sing N N 200 GLU CG HG3 sing N N 201 GLU CD OE1 doub N N 202 GLU CD OE2 sing N N 203 GLU OE2 HE2 sing N N 204 GLU OXT HXT sing N N 205 GLY N CA sing N N 206 GLY N H sing N N 207 GLY N H2 sing N N 208 GLY CA C sing N N 209 GLY CA HA2 sing N N 210 GLY CA HA3 sing N N 211 GLY C O doub N N 212 GLY C OXT sing N N 213 GLY OXT HXT sing N N 214 HIS N CA sing N N 215 HIS N H sing N N 216 HIS N H2 sing N N 217 HIS CA C sing N N 218 HIS CA CB sing N N 219 HIS CA HA sing N N 220 HIS C O doub N N 221 HIS C OXT sing N N 222 HIS CB CG sing N N 223 HIS CB HB2 sing N N 224 HIS CB HB3 sing N N 225 HIS CG ND1 sing Y N 226 HIS CG CD2 doub Y N 227 HIS ND1 CE1 doub Y N 228 HIS ND1 HD1 sing N N 229 HIS CD2 NE2 sing Y N 230 HIS CD2 HD2 sing N N 231 HIS CE1 NE2 sing Y N 232 HIS CE1 HE1 sing N N 233 HIS NE2 HE2 sing N N 234 HIS OXT HXT sing N N 235 HOH O H1 sing N N 236 HOH O H2 sing N N 237 ILE N CA sing N N 238 ILE N H sing N N 239 ILE N H2 sing N N 240 ILE CA C sing N N 241 ILE CA CB sing N N 242 ILE CA HA sing N N 243 ILE C O doub N N 244 ILE C OXT sing N N 245 ILE CB CG1 sing N N 246 ILE CB CG2 sing N N 247 ILE CB HB sing N N 248 ILE CG1 CD1 sing N N 249 ILE CG1 HG12 sing N N 250 ILE CG1 HG13 sing N N 251 ILE CG2 HG21 sing N N 252 ILE CG2 HG22 sing N N 253 ILE CG2 HG23 sing N N 254 ILE CD1 HD11 sing N N 255 ILE CD1 HD12 sing N N 256 ILE CD1 HD13 sing N N 257 ILE OXT HXT sing N N 258 LEU N CA sing N N 259 LEU N H sing N N 260 LEU N H2 sing N N 261 LEU CA C sing N N 262 LEU CA CB sing N N 263 LEU CA HA sing N N 264 LEU C O doub N N 265 LEU C OXT sing N N 266 LEU CB CG sing N N 267 LEU CB HB2 sing N N 268 LEU CB HB3 sing N N 269 LEU CG CD1 sing N N 270 LEU CG CD2 sing N N 271 LEU CG HG sing N N 272 LEU CD1 HD11 sing N N 273 LEU CD1 HD12 sing N N 274 LEU CD1 HD13 sing N N 275 LEU CD2 HD21 sing N N 276 LEU CD2 HD22 sing N N 277 LEU CD2 HD23 sing N N 278 LEU OXT HXT sing N N 279 LYS N CA sing N N 280 LYS N H sing N N 281 LYS N H2 sing N N 282 LYS CA C sing N N 283 LYS CA CB sing N N 284 LYS CA HA sing N N 285 LYS C O doub N N 286 LYS C OXT sing N N 287 LYS CB CG sing N N 288 LYS CB HB2 sing N N 289 LYS CB HB3 sing N N 290 LYS CG CD sing N N 291 LYS CG HG2 sing N N 292 LYS CG HG3 sing N N 293 LYS CD CE sing N N 294 LYS CD HD2 sing N N 295 LYS CD HD3 sing N N 296 LYS CE NZ sing N N 297 LYS CE HE2 sing N N 298 LYS CE HE3 sing N N 299 LYS NZ HZ1 sing N N 300 LYS NZ HZ2 sing N N 301 LYS NZ HZ3 sing N N 302 LYS OXT HXT sing N N 303 MET N CA sing N N 304 MET N H sing N N 305 MET N H2 sing N N 306 MET CA C sing N N 307 MET CA CB sing N N 308 MET CA HA sing N N 309 MET C O doub N N 310 MET C OXT sing N N 311 MET CB CG sing N N 312 MET CB HB2 sing N N 313 MET CB HB3 sing N N 314 MET CG SD sing N N 315 MET CG HG2 sing N N 316 MET CG HG3 sing N N 317 MET SD CE sing N N 318 MET CE HE1 sing N N 319 MET CE HE2 sing N N 320 MET CE HE3 sing N N 321 MET OXT HXT sing N N 322 PHE N CA sing N N 323 PHE N H sing N N 324 PHE N H2 sing N N 325 PHE CA C sing N N 326 PHE CA CB sing N N 327 PHE CA HA sing N N 328 PHE C O doub N N 329 PHE C OXT sing N N 330 PHE CB CG sing N N 331 PHE CB HB2 sing N N 332 PHE CB HB3 sing N N 333 PHE CG CD1 doub Y N 334 PHE CG CD2 sing Y N 335 PHE CD1 CE1 sing Y N 336 PHE CD1 HD1 sing N N 337 PHE CD2 CE2 doub Y N 338 PHE CD2 HD2 sing N N 339 PHE CE1 CZ doub Y N 340 PHE CE1 HE1 sing N N 341 PHE CE2 CZ sing Y N 342 PHE CE2 HE2 sing N N 343 PHE CZ HZ sing N N 344 PHE OXT HXT sing N N 345 PRO N CA sing N N 346 PRO N CD sing N N 347 PRO N H sing N N 348 PRO CA C sing N N 349 PRO CA CB sing N N 350 PRO CA HA sing N N 351 PRO C O doub N N 352 PRO C OXT sing N N 353 PRO CB CG sing N N 354 PRO CB HB2 sing N N 355 PRO CB HB3 sing N N 356 PRO CG CD sing N N 357 PRO CG HG2 sing N N 358 PRO CG HG3 sing N N 359 PRO CD HD2 sing N N 360 PRO CD HD3 sing N N 361 PRO OXT HXT sing N N 362 SER N CA sing N N 363 SER N H sing N N 364 SER N H2 sing N N 365 SER CA C sing N N 366 SER CA CB sing N N 367 SER CA HA sing N N 368 SER C O doub N N 369 SER C OXT sing N N 370 SER CB OG sing N N 371 SER CB HB2 sing N N 372 SER CB HB3 sing N N 373 SER OG HG sing N N 374 SER OXT HXT sing N N 375 THR N CA sing N N 376 THR N H sing N N 377 THR N H2 sing N N 378 THR CA C sing N N 379 THR CA CB sing N N 380 THR CA HA sing N N 381 THR C O doub N N 382 THR C OXT sing N N 383 THR CB OG1 sing N N 384 THR CB CG2 sing N N 385 THR CB HB sing N N 386 THR OG1 HG1 sing N N 387 THR CG2 HG21 sing N N 388 THR CG2 HG22 sing N N 389 THR CG2 HG23 sing N N 390 THR OXT HXT sing N N 391 TYR N CA sing N N 392 TYR N H sing N N 393 TYR N H2 sing N N 394 TYR CA C sing N N 395 TYR CA CB sing N N 396 TYR CA HA sing N N 397 TYR C O doub N N 398 TYR C OXT sing N N 399 TYR CB CG sing N N 400 TYR CB HB2 sing N N 401 TYR CB HB3 sing N N 402 TYR CG CD1 doub Y N 403 TYR CG CD2 sing Y N 404 TYR CD1 CE1 sing Y N 405 TYR CD1 HD1 sing N N 406 TYR CD2 CE2 doub Y N 407 TYR CD2 HD2 sing N N 408 TYR CE1 CZ doub Y N 409 TYR CE1 HE1 sing N N 410 TYR CE2 CZ sing Y N 411 TYR CE2 HE2 sing N N 412 TYR CZ OH sing N N 413 TYR OH HH sing N N 414 TYR OXT HXT sing N N 415 VAL N CA sing N N 416 VAL N H sing N N 417 VAL N H2 sing N N 418 VAL CA C sing N N 419 VAL CA CB sing N N 420 VAL CA HA sing N N 421 VAL C O doub N N 422 VAL C OXT sing N N 423 VAL CB CG1 sing N N 424 VAL CB CG2 sing N N 425 VAL CB HB sing N N 426 VAL CG1 HG11 sing N N 427 VAL CG1 HG12 sing N N 428 VAL CG1 HG13 sing N N 429 VAL CG2 HG21 sing N N 430 VAL CG2 HG22 sing N N 431 VAL CG2 HG23 sing N N 432 VAL OXT HXT sing N N 433 # _pdbx_audit_support.funding_organization 'Canadian Institutes of Health Research (CIHR)' _pdbx_audit_support.country Canada _pdbx_audit_support.grant_number PJT-162365 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name Other _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.details 'Used model from deposition D_1000289484' # _space_group.name_H-M_alt 'P 43 21 2' _space_group.name_Hall 'P 4nw 2abw' _space_group.IT_number 96 _space_group.crystal_system tetragonal _space_group.id 1 # _atom_sites.entry_id 9MGU _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.017404 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017404 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008105 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? 0.51345 0.48472 ? ? 24.73122 6.32584 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O1- ? ? 5.12366 3.84317 ? ? 3.49406 27.47979 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? P ? ? 9.51135 5.44231 ? ? 1.42069 35.72801 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ #