data_9MPF # _entry.id 9MPF # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.412 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9MPF pdb_00009mpf 10.2210/pdb9mpf/pdb WWPDB D_1000291502 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-04-08 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9MPF _pdbx_database_status.recvd_initial_deposition_date 2024-12-30 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email joel.mackay@sydney.edu.au _pdbx_contact_author.name_first Joel _pdbx_contact_author.name_last Mackay _pdbx_contact_author.name_mi P _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-7508-8033 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Patel, K.' 1 0000-0003-3034-3840 'Mackay, J.P.' 2 0000-0001-7508-8033 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'BRD3-BD1 in complex with cyclic peptide 2.1B' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Patel, K.' 1 0000-0003-3034-3840 primary 'Mackay, J.P.' 2 0000-0001-7508-8033 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Bromodomain-containing protein 3' 15095.392 1 ? ? 'BD1 (UNP residues 25-147)' ? 2 polymer syn 2.1C 2224.589 1 ? ? ? 'WNGHYPLR(ALY)NYILHLQC' 3 water nat water 18.015 26 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'RING3-like protein' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;QPLGSEVSNPSKPGRKTNQLQYMQNVVVKTLWKHQFAWPFYQPVDAIKLNLPDYHKIIKNPMDMGTIKKRLENNYYWSAS ECMQDFNTMFTNCYIYNKPTDDIVLMAQALEKIFLQKVAQMPQEEVEL ; ;QPLGSEVSNPSKPGRKTNQLQYMQNVVVKTLWKHQFAWPFYQPVDAIKLNLPDYHKIIKNPMDMGTIKKRLENNYYWSAS ECMQDFNTMFTNCYIYNKPTDDIVLMAQALEKIFLQKVAQMPQEEVEL ; A ? 2 'polypeptide(L)' no yes '(ACE)WNGHYPLR(ALY)NYILHLQC(NH2)' XWNGHYPLRKNYILHLQCX B ? # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLN n 1 2 PRO n 1 3 LEU n 1 4 GLY n 1 5 SER n 1 6 GLU n 1 7 VAL n 1 8 SER n 1 9 ASN n 1 10 PRO n 1 11 SER n 1 12 LYS n 1 13 PRO n 1 14 GLY n 1 15 ARG n 1 16 LYS n 1 17 THR n 1 18 ASN n 1 19 GLN n 1 20 LEU n 1 21 GLN n 1 22 TYR n 1 23 MET n 1 24 GLN n 1 25 ASN n 1 26 VAL n 1 27 VAL n 1 28 VAL n 1 29 LYS n 1 30 THR n 1 31 LEU n 1 32 TRP n 1 33 LYS n 1 34 HIS n 1 35 GLN n 1 36 PHE n 1 37 ALA n 1 38 TRP n 1 39 PRO n 1 40 PHE n 1 41 TYR n 1 42 GLN n 1 43 PRO n 1 44 VAL n 1 45 ASP n 1 46 ALA n 1 47 ILE n 1 48 LYS n 1 49 LEU n 1 50 ASN n 1 51 LEU n 1 52 PRO n 1 53 ASP n 1 54 TYR n 1 55 HIS n 1 56 LYS n 1 57 ILE n 1 58 ILE n 1 59 LYS n 1 60 ASN n 1 61 PRO n 1 62 MET n 1 63 ASP n 1 64 MET n 1 65 GLY n 1 66 THR n 1 67 ILE n 1 68 LYS n 1 69 LYS n 1 70 ARG n 1 71 LEU n 1 72 GLU n 1 73 ASN n 1 74 ASN n 1 75 TYR n 1 76 TYR n 1 77 TRP n 1 78 SER n 1 79 ALA n 1 80 SER n 1 81 GLU n 1 82 CYS n 1 83 MET n 1 84 GLN n 1 85 ASP n 1 86 PHE n 1 87 ASN n 1 88 THR n 1 89 MET n 1 90 PHE n 1 91 THR n 1 92 ASN n 1 93 CYS n 1 94 TYR n 1 95 ILE n 1 96 TYR n 1 97 ASN n 1 98 LYS n 1 99 PRO n 1 100 THR n 1 101 ASP n 1 102 ASP n 1 103 ILE n 1 104 VAL n 1 105 LEU n 1 106 MET n 1 107 ALA n 1 108 GLN n 1 109 ALA n 1 110 LEU n 1 111 GLU n 1 112 LYS n 1 113 ILE n 1 114 PHE n 1 115 LEU n 1 116 GLN n 1 117 LYS n 1 118 VAL n 1 119 ALA n 1 120 GLN n 1 121 MET n 1 122 PRO n 1 123 GLN n 1 124 GLU n 1 125 GLU n 1 126 VAL n 1 127 GLU n 1 128 LEU n 2 1 ACE n 2 2 TRP n 2 3 ASN n 2 4 GLY n 2 5 HIS n 2 6 TYR n 2 7 PRO n 2 8 LEU n 2 9 ARG n 2 10 ALY n 2 11 ASN n 2 12 TYR n 2 13 ILE n 2 14 LEU n 2 15 HIS n 2 16 LEU n 2 17 GLN n 2 18 CYS n 2 19 NH2 n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 128 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'BRD3, KIAA0043, RING3L' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 19 _pdbx_entity_src_syn.organism_scientific 'synthetic construct' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 32630 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ACE non-polymer . 'ACETYL GROUP' ? 'C2 H4 O' 44.053 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ALY 'L-peptide linking' n 'N(6)-ACETYLLYSINE' ? 'C8 H16 N2 O3' 188.224 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NH2 non-polymer . 'AMINO GROUP' ? 'H2 N' 16.023 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLN 1 20 ? ? ? A . n A 1 2 PRO 2 21 ? ? ? A . n A 1 3 LEU 3 22 ? ? ? A . n A 1 4 GLY 4 23 ? ? ? A . n A 1 5 SER 5 24 24 SER SER A . n A 1 6 GLU 6 25 25 GLU GLU A . n A 1 7 VAL 7 26 26 VAL VAL A . n A 1 8 SER 8 27 27 SER SER A . n A 1 9 ASN 9 28 28 ASN ASN A . n A 1 10 PRO 10 29 29 PRO PRO A . n A 1 11 SER 11 30 30 SER SER A . n A 1 12 LYS 12 31 31 LYS LYS A . n A 1 13 PRO 13 32 32 PRO PRO A . n A 1 14 GLY 14 33 33 GLY GLY A . n A 1 15 ARG 15 34 34 ARG ARG A . n A 1 16 LYS 16 35 35 LYS LYS A . n A 1 17 THR 17 36 36 THR THR A . n A 1 18 ASN 18 37 37 ASN ASN A . n A 1 19 GLN 19 38 38 GLN GLN A . n A 1 20 LEU 20 39 39 LEU LEU A . n A 1 21 GLN 21 40 40 GLN GLN A . n A 1 22 TYR 22 41 41 TYR TYR A . n A 1 23 MET 23 42 42 MET MET A . n A 1 24 GLN 24 43 43 GLN GLN A . n A 1 25 ASN 25 44 44 ASN ASN A . n A 1 26 VAL 26 45 45 VAL VAL A . n A 1 27 VAL 27 46 46 VAL VAL A . n A 1 28 VAL 28 47 47 VAL VAL A . n A 1 29 LYS 29 48 48 LYS LYS A . n A 1 30 THR 30 49 49 THR THR A . n A 1 31 LEU 31 50 50 LEU LEU A . n A 1 32 TRP 32 51 51 TRP TRP A . n A 1 33 LYS 33 52 52 LYS LYS A . n A 1 34 HIS 34 53 53 HIS HIS A . n A 1 35 GLN 35 54 54 GLN GLN A . n A 1 36 PHE 36 55 55 PHE PHE A . n A 1 37 ALA 37 56 56 ALA ALA A . n A 1 38 TRP 38 57 57 TRP TRP A . n A 1 39 PRO 39 58 58 PRO PRO A . n A 1 40 PHE 40 59 59 PHE PHE A . n A 1 41 TYR 41 60 60 TYR TYR A . n A 1 42 GLN 42 61 61 GLN GLN A . n A 1 43 PRO 43 62 62 PRO PRO A . n A 1 44 VAL 44 63 63 VAL VAL A . n A 1 45 ASP 45 64 64 ASP ASP A . n A 1 46 ALA 46 65 65 ALA ALA A . n A 1 47 ILE 47 66 66 ILE ILE A . n A 1 48 LYS 48 67 67 LYS LYS A . n A 1 49 LEU 49 68 68 LEU LEU A . n A 1 50 ASN 50 69 69 ASN ASN A . n A 1 51 LEU 51 70 70 LEU LEU A . n A 1 52 PRO 52 71 71 PRO PRO A . n A 1 53 ASP 53 72 72 ASP ASP A . n A 1 54 TYR 54 73 73 TYR TYR A . n A 1 55 HIS 55 74 74 HIS HIS A . n A 1 56 LYS 56 75 75 LYS LYS A . n A 1 57 ILE 57 76 76 ILE ILE A . n A 1 58 ILE 58 77 77 ILE ILE A . n A 1 59 LYS 59 78 78 LYS LYS A . n A 1 60 ASN 60 79 79 ASN ASN A . n A 1 61 PRO 61 80 80 PRO PRO A . n A 1 62 MET 62 81 81 MET MET A . n A 1 63 ASP 63 82 82 ASP ASP A . n A 1 64 MET 64 83 83 MET MET A . n A 1 65 GLY 65 84 84 GLY GLY A . n A 1 66 THR 66 85 85 THR THR A . n A 1 67 ILE 67 86 86 ILE ILE A . n A 1 68 LYS 68 87 87 LYS LYS A . n A 1 69 LYS 69 88 88 LYS LYS A . n A 1 70 ARG 70 89 89 ARG ARG A . n A 1 71 LEU 71 90 90 LEU LEU A . n A 1 72 GLU 72 91 91 GLU GLU A . n A 1 73 ASN 73 92 92 ASN ASN A . n A 1 74 ASN 74 93 93 ASN ASN A . n A 1 75 TYR 75 94 94 TYR TYR A . n A 1 76 TYR 76 95 95 TYR TYR A . n A 1 77 TRP 77 96 96 TRP TRP A . n A 1 78 SER 78 97 97 SER SER A . n A 1 79 ALA 79 98 98 ALA ALA A . n A 1 80 SER 80 99 99 SER SER A . n A 1 81 GLU 81 100 100 GLU GLU A . n A 1 82 CYS 82 101 101 CYS CYS A . n A 1 83 MET 83 102 102 MET MET A . n A 1 84 GLN 84 103 103 GLN GLN A . n A 1 85 ASP 85 104 104 ASP ASP A . n A 1 86 PHE 86 105 105 PHE PHE A . n A 1 87 ASN 87 106 106 ASN ASN A . n A 1 88 THR 88 107 107 THR THR A . n A 1 89 MET 89 108 108 MET MET A . n A 1 90 PHE 90 109 109 PHE PHE A . n A 1 91 THR 91 110 110 THR THR A . n A 1 92 ASN 92 111 111 ASN ASN A . n A 1 93 CYS 93 112 112 CYS CYS A . n A 1 94 TYR 94 113 113 TYR TYR A . n A 1 95 ILE 95 114 114 ILE ILE A . n A 1 96 TYR 96 115 115 TYR TYR A . n A 1 97 ASN 97 116 116 ASN ASN A . n A 1 98 LYS 98 117 117 LYS LYS A . n A 1 99 PRO 99 118 118 PRO PRO A . n A 1 100 THR 100 119 119 THR THR A . n A 1 101 ASP 101 120 120 ASP ASP A . n A 1 102 ASP 102 121 121 ASP ASP A . n A 1 103 ILE 103 122 122 ILE ILE A . n A 1 104 VAL 104 123 123 VAL VAL A . n A 1 105 LEU 105 124 124 LEU LEU A . n A 1 106 MET 106 125 125 MET MET A . n A 1 107 ALA 107 126 126 ALA ALA A . n A 1 108 GLN 108 127 127 GLN GLN A . n A 1 109 ALA 109 128 128 ALA ALA A . n A 1 110 LEU 110 129 129 LEU LEU A . n A 1 111 GLU 111 130 130 GLU GLU A . n A 1 112 LYS 112 131 131 LYS LYS A . n A 1 113 ILE 113 132 132 ILE ILE A . n A 1 114 PHE 114 133 133 PHE PHE A . n A 1 115 LEU 115 134 134 LEU LEU A . n A 1 116 GLN 116 135 135 GLN GLN A . n A 1 117 LYS 117 136 136 LYS LYS A . n A 1 118 VAL 118 137 137 VAL VAL A . n A 1 119 ALA 119 138 138 ALA ALA A . n A 1 120 GLN 120 139 139 GLN GLN A . n A 1 121 MET 121 140 140 MET MET A . n A 1 122 PRO 122 141 141 PRO PRO A . n A 1 123 GLN 123 142 142 GLN GLN A . n A 1 124 GLU 124 143 143 GLU GLU A . n A 1 125 GLU 125 144 144 GLU GLU A . n A 1 126 VAL 126 145 145 VAL VAL A . n A 1 127 GLU 127 146 146 GLU GLU A . n A 1 128 LEU 128 147 147 LEU LEU A . n B 2 1 ACE 1 0 0 ACE ACE B . n B 2 2 TRP 2 1 1 TRP TRP B . n B 2 3 ASN 3 2 2 ASN ASN B . n B 2 4 GLY 4 3 3 GLY GLY B . n B 2 5 HIS 5 4 4 HIS HIS B . n B 2 6 TYR 6 5 5 TYR TYR B . n B 2 7 PRO 7 6 6 PRO PRO B . n B 2 8 LEU 8 7 7 LEU LEU B . n B 2 9 ARG 9 8 8 ARG ARG B . n B 2 10 ALY 10 9 9 ALY ALY B . n B 2 11 ASN 11 10 10 ASN ASN B . n B 2 12 TYR 12 11 11 TYR TYR B . n B 2 13 ILE 13 12 12 ILE ILE B . n B 2 14 LEU 14 13 13 LEU LEU B . n B 2 15 HIS 15 14 14 HIS HIS B . n B 2 16 LEU 16 15 15 LEU LEU B . n B 2 17 GLN 17 16 16 GLN GLN B . n B 2 18 CYS 18 17 17 CYS CYS B . n B 2 19 NH2 19 18 18 NH2 NH2 B . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id ACE _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id ACE _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 HOH 1 201 10 HOH HOH A . C 3 HOH 2 202 13 HOH HOH A . C 3 HOH 3 203 14 HOH HOH A . C 3 HOH 4 204 29 HOH HOH A . C 3 HOH 5 205 17 HOH HOH A . C 3 HOH 6 206 16 HOH HOH A . C 3 HOH 7 207 12 HOH HOH A . C 3 HOH 8 208 22 HOH HOH A . C 3 HOH 9 209 3 HOH HOH A . C 3 HOH 10 210 18 HOH HOH A . C 3 HOH 11 211 19 HOH HOH A . C 3 HOH 12 212 2 HOH HOH A . C 3 HOH 13 213 4 HOH HOH A . C 3 HOH 14 214 25 HOH HOH A . C 3 HOH 15 215 24 HOH HOH A . C 3 HOH 16 216 5 HOH HOH A . C 3 HOH 17 217 9 HOH HOH A . C 3 HOH 18 218 8 HOH HOH A . C 3 HOH 19 219 11 HOH HOH A . C 3 HOH 20 220 23 HOH HOH A . C 3 HOH 21 221 15 HOH HOH A . C 3 HOH 22 222 28 HOH HOH A . C 3 HOH 23 223 7 HOH HOH A . C 3 HOH 24 224 27 HOH HOH A . D 3 HOH 1 101 26 HOH HOH B . D 3 HOH 2 102 20 HOH HOH B . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 48 ? NZ ? A LYS 29 NZ 2 1 Y 0 A LYS 52 ? NZ ? A LYS 33 NZ 3 1 Y 0 A LYS 75 ? CD ? A LYS 56 CD 4 1 Y 0 A LYS 75 ? CE ? A LYS 56 CE 5 1 Y 0 A LYS 75 ? NZ ? A LYS 56 NZ 6 1 Y 0 B TRP 1 ? CB ? B TRP 2 CB 7 1 Y 0 B TRP 1 ? CG ? B TRP 2 CG 8 1 Y 0 B TRP 1 ? CD1 ? B TRP 2 CD1 9 1 Y 0 B TRP 1 ? CD2 ? B TRP 2 CD2 10 1 Y 0 B TRP 1 ? NE1 ? B TRP 2 NE1 11 1 Y 0 B TRP 1 ? CE2 ? B TRP 2 CE2 12 1 Y 0 B TRP 1 ? CE3 ? B TRP 2 CE3 13 1 Y 0 B TRP 1 ? CZ2 ? B TRP 2 CZ2 14 1 Y 0 B TRP 1 ? CZ3 ? B TRP 2 CZ3 15 1 Y 0 B TRP 1 ? CH2 ? B TRP 2 CH2 16 1 Y 0 B HIS 4 ? CG ? B HIS 5 CG 17 1 Y 0 B HIS 4 ? ND1 ? B HIS 5 ND1 18 1 Y 0 B HIS 4 ? CD2 ? B HIS 5 CD2 19 1 Y 0 B HIS 4 ? CE1 ? B HIS 5 CE1 20 1 Y 0 B HIS 4 ? NE2 ? B HIS 5 NE2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.20.1_4487 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 9MPF _cell.details ? _cell.formula_units_Z ? _cell.length_a 63.425 _cell.length_a_esd ? _cell.length_b 63.425 _cell.length_b_esd ? _cell.length_c 85.132 _cell.length_c_esd ? _cell.volume 296581.748 _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9MPF _symmetry.cell_setting ? _symmetry.Int_Tables_number 170 _symmetry.space_group_name_Hall 'P 65' _symmetry.space_group_name_H-M 'P 65' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9MPF _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.86 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 56.96 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M Lithium sulfate, 0.1 M Phosphate/citrate pH 4.2, 20 % w/v PEG 1000' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 291 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 210r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-07-26 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9537 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'AUSTRALIAN SYNCHROTRON BEAMLINE MX1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9537 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline MX1 _diffrn_source.pdbx_synchrotron_site 'Australian Synchrotron' # _reflns.B_iso_Wilson_estimate 27.17 _reflns.entry_id 9MPF _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.7 _reflns.d_resolution_low 46.15 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 5385 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.8 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 11.4 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 12.7 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.993 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.199 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.7 _reflns_shell.d_res_low 2.84 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 709 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.858 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.766 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 31.83 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9MPF _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.70 _refine.ls_d_res_low 46.15 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 5358 _refine.ls_number_reflns_R_free 231 _refine.ls_number_reflns_R_work 5127 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.85 _refine.ls_percent_reflns_R_free 4.31 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1933 _refine.ls_R_factor_R_free 0.2187 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1922 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 17.6495 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2265 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.70 _refine_hist.d_res_low 46.15 _refine_hist.number_atoms_solvent 26 _refine_hist.number_atoms_total 1214 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1184 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 4 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0020 ? 1233 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.5429 ? 1673 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0355 ? 173 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0043 ? 215 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 11.9074 ? 465 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.70 3.40 . . 113 2542 99.70 . . . . 0.2132 . . . . . . . . . . . 0.2472 'X-RAY DIFFRACTION' 3.41 46.15 . . 118 2585 100.00 . . . . 0.1804 . . . . . . . . . . . 0.2026 # _struct.entry_id 9MPF _struct.title 'BRD3-BD1 in complex with cyclic peptide 2.1B' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9MPF _struct_keywords.text 'BRD3, cyclic peptide, GENE REGULATION' _struct_keywords.pdbx_keywords 'GENE REGULATION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP BRD3_HUMAN Q15059 ? 1 ;EVSNPSKPGRKTNQLQYMQNVVVKTLWKHQFAWPFYQPVDAIKLNLPDYHKIIKNPMDMGTIKKRLENNYYWSASECMQD FNTMFTNCYIYNKPTDDIVLMAQALEKIFLQKVAQMPQEEVEL ; 25 2 PDB 9MPF 9MPF ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 9MPF A 6 ? 128 ? Q15059 25 ? 147 ? 25 147 2 2 9MPF B 1 ? 19 ? 9MPF 0 ? 18 ? 0 18 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9MPF GLN A 1 ? UNP Q15059 ? ? 'expression tag' 20 1 1 9MPF PRO A 2 ? UNP Q15059 ? ? 'expression tag' 21 2 1 9MPF LEU A 3 ? UNP Q15059 ? ? 'expression tag' 22 3 1 9MPF GLY A 4 ? UNP Q15059 ? ? 'expression tag' 23 4 1 9MPF SER A 5 ? UNP Q15059 ? ? 'expression tag' 24 5 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1700 ? 1 MORE -12 ? 1 'SSA (A^2)' 8370 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'surface plasmon resonance' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 17 ? VAL A 26 ? THR A 36 VAL A 45 1 ? 10 HELX_P HELX_P2 AA2 VAL A 26 ? LYS A 33 ? VAL A 45 LYS A 52 1 ? 8 HELX_P HELX_P3 AA3 ALA A 37 ? TYR A 41 ? ALA A 56 TYR A 60 5 ? 5 HELX_P HELX_P4 AA4 ASP A 45 ? ASN A 50 ? ASP A 64 ASN A 69 1 ? 6 HELX_P HELX_P5 AA5 ASP A 53 ? ILE A 58 ? ASP A 72 ILE A 77 1 ? 6 HELX_P HELX_P6 AA6 ASP A 63 ? ASN A 73 ? ASP A 82 ASN A 92 1 ? 11 HELX_P HELX_P7 AA7 SER A 78 ? ASN A 97 ? SER A 97 ASN A 116 1 ? 20 HELX_P HELX_P8 AA8 ASP A 101 ? GLN A 120 ? ASP A 120 GLN A 139 1 ? 20 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? B ACE 1 C ? ? ? 1_555 B TRP 2 N ? ? B ACE 0 B TRP 1 1_555 ? ? ? ? ? ? ? 1.332 ? ? covale2 covale none ? B ACE 1 CH3 ? ? ? 1_555 B CYS 18 SG ? ? B ACE 0 B CYS 17 1_555 ? ? ? ? ? ? ? 1.767 ? ? covale3 covale both ? B ARG 9 C ? ? ? 1_555 B ALY 10 N ? ? B ARG 8 B ALY 9 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale4 covale both ? B ALY 10 C ? ? ? 1_555 B ASN 11 N ? ? B ALY 9 B ASN 10 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale5 covale both ? B CYS 18 C ? ? ? 1_555 B NH2 19 N ? ? B CYS 17 B NH2 18 1_555 ? ? ? ? ? ? ? 1.329 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 ALY B 10 ? . . . . ALY B 9 ? 1_555 . . . . . . . LYS 1 ALY Acetylation 'Named protein modification' 2 ACE B 1 ? TRP B 2 ? ACE B 0 ? 1_555 TRP B 1 ? 1_555 . . TRP 16 ACE None 'Terminal acetylation' 3 NH2 B 19 ? CYS B 18 ? NH2 B 18 ? 1_555 CYS B 17 ? 1_555 . . CYS 11 NH2 None 'Terminal amidation' 4 ACE B 1 ? CYS B 18 ? ACE B 0 ? 1_555 CYS B 17 ? 1_555 CH3 SG . . . None 'Non-standard linkage' # _pdbx_entry_details.entry_id 9MPF _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 C _pdbx_validate_close_contact.auth_asym_id_1 B _pdbx_validate_close_contact.auth_comp_id_1 ACE _pdbx_validate_close_contact.auth_seq_id_1 0 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 SG _pdbx_validate_close_contact.auth_asym_id_2 B _pdbx_validate_close_contact.auth_comp_id_2 CYS _pdbx_validate_close_contact.auth_seq_id_2 17 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.17 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 45 ? ? -122.89 -57.21 2 1 ASN B 2 ? ? -156.64 -57.59 3 1 PRO B 6 ? ? -62.78 71.77 4 1 LEU B 7 ? ? -82.25 43.61 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x-y,x,z+5/6 3 y,-x+y,z+1/6 4 -y,x-y,z+2/3 5 -x+y,-x,z+1/3 6 -x,-y,z+1/2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLN 20 ? A GLN 1 2 1 Y 1 A PRO 21 ? A PRO 2 3 1 Y 1 A LEU 22 ? A LEU 3 4 1 Y 1 A GLY 23 ? A GLY 4 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ACE C C N N 1 ACE O O N N 2 ACE CH3 C N N 3 ACE H H N N 4 ACE H1 H N N 5 ACE H2 H N N 6 ACE H3 H N N 7 ALA N N N N 8 ALA CA C N S 9 ALA C C N N 10 ALA O O N N 11 ALA CB C N N 12 ALA OXT O N N 13 ALA H H N N 14 ALA H2 H N N 15 ALA HA H N N 16 ALA HB1 H N N 17 ALA HB2 H N N 18 ALA HB3 H N N 19 ALA HXT H N N 20 ALY OH O N N 21 ALY CH C N N 22 ALY CH3 C N N 23 ALY NZ N N N 24 ALY CE C N N 25 ALY CD C N N 26 ALY CG C N N 27 ALY CB C N N 28 ALY CA C N S 29 ALY N N N N 30 ALY C C N N 31 ALY O O N N 32 ALY OXT O N N 33 ALY HH31 H N N 34 ALY HH32 H N N 35 ALY HH33 H N N 36 ALY HZ H N N 37 ALY HE3 H N N 38 ALY HE2 H N N 39 ALY HD3 H N N 40 ALY HD2 H N N 41 ALY HG3 H N N 42 ALY HG2 H N N 43 ALY HB3 H N N 44 ALY HB2 H N N 45 ALY HA H N N 46 ALY H H N N 47 ALY H2 H N N 48 ALY HXT H N N 49 ARG N N N N 50 ARG CA C N S 51 ARG C C N N 52 ARG O O N N 53 ARG CB C N N 54 ARG CG C N N 55 ARG CD C N N 56 ARG NE N N N 57 ARG CZ C N N 58 ARG NH1 N N N 59 ARG NH2 N N N 60 ARG OXT O N N 61 ARG H H N N 62 ARG H2 H N N 63 ARG HA H N N 64 ARG HB2 H N N 65 ARG HB3 H N N 66 ARG HG2 H N N 67 ARG HG3 H N N 68 ARG HD2 H N N 69 ARG HD3 H N N 70 ARG HE H N N 71 ARG HH11 H N N 72 ARG HH12 H N N 73 ARG HH21 H N N 74 ARG HH22 H N N 75 ARG HXT H N N 76 ASN N N N N 77 ASN CA C N S 78 ASN C C N N 79 ASN O O N N 80 ASN CB C N N 81 ASN CG C N N 82 ASN OD1 O N N 83 ASN ND2 N N N 84 ASN OXT O N N 85 ASN H H N N 86 ASN H2 H N N 87 ASN HA H N N 88 ASN HB2 H N N 89 ASN HB3 H N N 90 ASN HD21 H N N 91 ASN HD22 H N N 92 ASN HXT H N N 93 ASP N N N N 94 ASP CA C N S 95 ASP C C N N 96 ASP O O N N 97 ASP CB C N N 98 ASP CG C N N 99 ASP OD1 O N N 100 ASP OD2 O N N 101 ASP OXT O N N 102 ASP H H N N 103 ASP H2 H N N 104 ASP HA H N N 105 ASP HB2 H N N 106 ASP HB3 H N N 107 ASP HD2 H N N 108 ASP HXT H N N 109 CYS N N N N 110 CYS CA C N R 111 CYS C C N N 112 CYS O O N N 113 CYS CB C N N 114 CYS SG S N N 115 CYS OXT O N N 116 CYS H H N N 117 CYS H2 H N N 118 CYS HA H N N 119 CYS HB2 H N N 120 CYS HB3 H N N 121 CYS HG H N N 122 CYS HXT H N N 123 GLN N N N N 124 GLN CA C N S 125 GLN C C N N 126 GLN O O N N 127 GLN CB C N N 128 GLN CG C N N 129 GLN CD C N N 130 GLN OE1 O N N 131 GLN NE2 N N N 132 GLN OXT O N N 133 GLN H H N N 134 GLN H2 H N N 135 GLN HA H N N 136 GLN HB2 H N N 137 GLN HB3 H N N 138 GLN HG2 H N N 139 GLN HG3 H N N 140 GLN HE21 H N N 141 GLN HE22 H N N 142 GLN HXT H N N 143 GLU N N N N 144 GLU CA C N S 145 GLU C C N N 146 GLU O O N N 147 GLU CB C N N 148 GLU CG C N N 149 GLU CD C N N 150 GLU OE1 O N N 151 GLU OE2 O N N 152 GLU OXT O N N 153 GLU H H N N 154 GLU H2 H N N 155 GLU HA H N N 156 GLU HB2 H N N 157 GLU HB3 H N N 158 GLU HG2 H N N 159 GLU HG3 H N N 160 GLU HE2 H N N 161 GLU HXT H N N 162 GLY N N N N 163 GLY CA C N N 164 GLY C C N N 165 GLY O O N N 166 GLY OXT O N N 167 GLY H H N N 168 GLY H2 H N N 169 GLY HA2 H N N 170 GLY HA3 H N N 171 GLY HXT H N N 172 HIS N N N N 173 HIS CA C N S 174 HIS C C N N 175 HIS O O N N 176 HIS CB C N N 177 HIS CG C Y N 178 HIS ND1 N Y N 179 HIS CD2 C Y N 180 HIS CE1 C Y N 181 HIS NE2 N Y N 182 HIS OXT O N N 183 HIS H H N N 184 HIS H2 H N N 185 HIS HA H N N 186 HIS HB2 H N N 187 HIS HB3 H N N 188 HIS HD1 H N N 189 HIS HD2 H N N 190 HIS HE1 H N N 191 HIS HE2 H N N 192 HIS HXT H N N 193 HOH O O N N 194 HOH H1 H N N 195 HOH H2 H N N 196 ILE N N N N 197 ILE CA C N S 198 ILE C C N N 199 ILE O O N N 200 ILE CB C N S 201 ILE CG1 C N N 202 ILE CG2 C N N 203 ILE CD1 C N N 204 ILE OXT O N N 205 ILE H H N N 206 ILE H2 H N N 207 ILE HA H N N 208 ILE HB H N N 209 ILE HG12 H N N 210 ILE HG13 H N N 211 ILE HG21 H N N 212 ILE HG22 H N N 213 ILE HG23 H N N 214 ILE HD11 H N N 215 ILE HD12 H N N 216 ILE HD13 H N N 217 ILE HXT H N N 218 LEU N N N N 219 LEU CA C N S 220 LEU C C N N 221 LEU O O N N 222 LEU CB C N N 223 LEU CG C N N 224 LEU CD1 C N N 225 LEU CD2 C N N 226 LEU OXT O N N 227 LEU H H N N 228 LEU H2 H N N 229 LEU HA H N N 230 LEU HB2 H N N 231 LEU HB3 H N N 232 LEU HG H N N 233 LEU HD11 H N N 234 LEU HD12 H N N 235 LEU HD13 H N N 236 LEU HD21 H N N 237 LEU HD22 H N N 238 LEU HD23 H N N 239 LEU HXT H N N 240 LYS N N N N 241 LYS CA C N S 242 LYS C C N N 243 LYS O O N N 244 LYS CB C N N 245 LYS CG C N N 246 LYS CD C N N 247 LYS CE C N N 248 LYS NZ N N N 249 LYS OXT O N N 250 LYS H H N N 251 LYS H2 H N N 252 LYS HA H N N 253 LYS HB2 H N N 254 LYS HB3 H N N 255 LYS HG2 H N N 256 LYS HG3 H N N 257 LYS HD2 H N N 258 LYS HD3 H N N 259 LYS HE2 H N N 260 LYS HE3 H N N 261 LYS HZ1 H N N 262 LYS HZ2 H N N 263 LYS HZ3 H N N 264 LYS HXT H N N 265 MET N N N N 266 MET CA C N S 267 MET C C N N 268 MET O O N N 269 MET CB C N N 270 MET CG C N N 271 MET SD S N N 272 MET CE C N N 273 MET OXT O N N 274 MET H H N N 275 MET H2 H N N 276 MET HA H N N 277 MET HB2 H N N 278 MET HB3 H N N 279 MET HG2 H N N 280 MET HG3 H N N 281 MET HE1 H N N 282 MET HE2 H N N 283 MET HE3 H N N 284 MET HXT H N N 285 NH2 N N N N 286 NH2 HN1 H N N 287 NH2 HN2 H N N 288 PHE N N N N 289 PHE CA C N S 290 PHE C C N N 291 PHE O O N N 292 PHE CB C N N 293 PHE CG C Y N 294 PHE CD1 C Y N 295 PHE CD2 C Y N 296 PHE CE1 C Y N 297 PHE CE2 C Y N 298 PHE CZ C Y N 299 PHE OXT O N N 300 PHE H H N N 301 PHE H2 H N N 302 PHE HA H N N 303 PHE HB2 H N N 304 PHE HB3 H N N 305 PHE HD1 H N N 306 PHE HD2 H N N 307 PHE HE1 H N N 308 PHE HE2 H N N 309 PHE HZ H N N 310 PHE HXT H N N 311 PRO N N N N 312 PRO CA C N S 313 PRO C C N N 314 PRO O O N N 315 PRO CB C N N 316 PRO CG C N N 317 PRO CD C N N 318 PRO OXT O N N 319 PRO H H N N 320 PRO HA H N N 321 PRO HB2 H N N 322 PRO HB3 H N N 323 PRO HG2 H N N 324 PRO HG3 H N N 325 PRO HD2 H N N 326 PRO HD3 H N N 327 PRO HXT H N N 328 SER N N N N 329 SER CA C N S 330 SER C C N N 331 SER O O N N 332 SER CB C N N 333 SER OG O N N 334 SER OXT O N N 335 SER H H N N 336 SER H2 H N N 337 SER HA H N N 338 SER HB2 H N N 339 SER HB3 H N N 340 SER HG H N N 341 SER HXT H N N 342 THR N N N N 343 THR CA C N S 344 THR C C N N 345 THR O O N N 346 THR CB C N R 347 THR OG1 O N N 348 THR CG2 C N N 349 THR OXT O N N 350 THR H H N N 351 THR H2 H N N 352 THR HA H N N 353 THR HB H N N 354 THR HG1 H N N 355 THR HG21 H N N 356 THR HG22 H N N 357 THR HG23 H N N 358 THR HXT H N N 359 TRP N N N N 360 TRP CA C N S 361 TRP C C N N 362 TRP O O N N 363 TRP CB C N N 364 TRP CG C Y N 365 TRP CD1 C Y N 366 TRP CD2 C Y N 367 TRP NE1 N Y N 368 TRP CE2 C Y N 369 TRP CE3 C Y N 370 TRP CZ2 C Y N 371 TRP CZ3 C Y N 372 TRP CH2 C Y N 373 TRP OXT O N N 374 TRP H H N N 375 TRP H2 H N N 376 TRP HA H N N 377 TRP HB2 H N N 378 TRP HB3 H N N 379 TRP HD1 H N N 380 TRP HE1 H N N 381 TRP HE3 H N N 382 TRP HZ2 H N N 383 TRP HZ3 H N N 384 TRP HH2 H N N 385 TRP HXT H N N 386 TYR N N N N 387 TYR CA C N S 388 TYR C C N N 389 TYR O O N N 390 TYR CB C N N 391 TYR CG C Y N 392 TYR CD1 C Y N 393 TYR CD2 C Y N 394 TYR CE1 C Y N 395 TYR CE2 C Y N 396 TYR CZ C Y N 397 TYR OH O N N 398 TYR OXT O N N 399 TYR H H N N 400 TYR H2 H N N 401 TYR HA H N N 402 TYR HB2 H N N 403 TYR HB3 H N N 404 TYR HD1 H N N 405 TYR HD2 H N N 406 TYR HE1 H N N 407 TYR HE2 H N N 408 TYR HH H N N 409 TYR HXT H N N 410 VAL N N N N 411 VAL CA C N S 412 VAL C C N N 413 VAL O O N N 414 VAL CB C N N 415 VAL CG1 C N N 416 VAL CG2 C N N 417 VAL OXT O N N 418 VAL H H N N 419 VAL H2 H N N 420 VAL HA H N N 421 VAL HB H N N 422 VAL HG11 H N N 423 VAL HG12 H N N 424 VAL HG13 H N N 425 VAL HG21 H N N 426 VAL HG22 H N N 427 VAL HG23 H N N 428 VAL HXT H N N 429 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ACE C O doub N N 1 ACE C CH3 sing N N 2 ACE C H sing N N 3 ACE CH3 H1 sing N N 4 ACE CH3 H2 sing N N 5 ACE CH3 H3 sing N N 6 ALA N CA sing N N 7 ALA N H sing N N 8 ALA N H2 sing N N 9 ALA CA C sing N N 10 ALA CA CB sing N N 11 ALA CA HA sing N N 12 ALA C O doub N N 13 ALA C OXT sing N N 14 ALA CB HB1 sing N N 15 ALA CB HB2 sing N N 16 ALA CB HB3 sing N N 17 ALA OXT HXT sing N N 18 ALY OH CH doub N N 19 ALY CH CH3 sing N N 20 ALY CH NZ sing N N 21 ALY CH3 HH31 sing N N 22 ALY CH3 HH32 sing N N 23 ALY CH3 HH33 sing N N 24 ALY NZ CE sing N N 25 ALY NZ HZ sing N N 26 ALY CE CD sing N N 27 ALY CE HE3 sing N N 28 ALY CE HE2 sing N N 29 ALY CD CG sing N N 30 ALY CD HD3 sing N N 31 ALY CD HD2 sing N N 32 ALY CG CB sing N N 33 ALY CG HG3 sing N N 34 ALY CG HG2 sing N N 35 ALY CB CA sing N N 36 ALY CB HB3 sing N N 37 ALY CB HB2 sing N N 38 ALY CA N sing N N 39 ALY CA C sing N N 40 ALY CA HA sing N N 41 ALY N H sing N N 42 ALY N H2 sing N N 43 ALY C O doub N N 44 ALY C OXT sing N N 45 ALY OXT HXT sing N N 46 ARG N CA sing N N 47 ARG N H sing N N 48 ARG N H2 sing N N 49 ARG CA C sing N N 50 ARG CA CB sing N N 51 ARG CA HA sing N N 52 ARG C O doub N N 53 ARG C OXT sing N N 54 ARG CB CG sing N N 55 ARG CB HB2 sing N N 56 ARG CB HB3 sing N N 57 ARG CG CD sing N N 58 ARG CG HG2 sing N N 59 ARG CG HG3 sing N N 60 ARG CD NE sing N N 61 ARG CD HD2 sing N N 62 ARG CD HD3 sing N N 63 ARG NE CZ sing N N 64 ARG NE HE sing N N 65 ARG CZ NH1 sing N N 66 ARG CZ NH2 doub N N 67 ARG NH1 HH11 sing N N 68 ARG NH1 HH12 sing N N 69 ARG NH2 HH21 sing N N 70 ARG NH2 HH22 sing N N 71 ARG OXT HXT sing N N 72 ASN N CA sing N N 73 ASN N H sing N N 74 ASN N H2 sing N N 75 ASN CA C sing N N 76 ASN CA CB sing N N 77 ASN CA HA sing N N 78 ASN C O doub N N 79 ASN C OXT sing N N 80 ASN CB CG sing N N 81 ASN CB HB2 sing N N 82 ASN CB HB3 sing N N 83 ASN CG OD1 doub N N 84 ASN CG ND2 sing N N 85 ASN ND2 HD21 sing N N 86 ASN ND2 HD22 sing N N 87 ASN OXT HXT sing N N 88 ASP N CA sing N N 89 ASP N H sing N N 90 ASP N H2 sing N N 91 ASP CA C sing N N 92 ASP CA CB sing N N 93 ASP CA HA sing N N 94 ASP C O doub N N 95 ASP C OXT sing N N 96 ASP CB CG sing N N 97 ASP CB HB2 sing N N 98 ASP CB HB3 sing N N 99 ASP CG OD1 doub N N 100 ASP CG OD2 sing N N 101 ASP OD2 HD2 sing N N 102 ASP OXT HXT sing N N 103 CYS N CA sing N N 104 CYS N H sing N N 105 CYS N H2 sing N N 106 CYS CA C sing N N 107 CYS CA CB sing N N 108 CYS CA HA sing N N 109 CYS C O doub N N 110 CYS C OXT sing N N 111 CYS CB SG sing N N 112 CYS CB HB2 sing N N 113 CYS CB HB3 sing N N 114 CYS SG HG sing N N 115 CYS OXT HXT sing N N 116 GLN N CA sing N N 117 GLN N H sing N N 118 GLN N H2 sing N N 119 GLN CA C sing N N 120 GLN CA CB sing N N 121 GLN CA HA sing N N 122 GLN C O doub N N 123 GLN C OXT sing N N 124 GLN CB CG sing N N 125 GLN CB HB2 sing N N 126 GLN CB HB3 sing N N 127 GLN CG CD sing N N 128 GLN CG HG2 sing N N 129 GLN CG HG3 sing N N 130 GLN CD OE1 doub N N 131 GLN CD NE2 sing N N 132 GLN NE2 HE21 sing N N 133 GLN NE2 HE22 sing N N 134 GLN OXT HXT sing N N 135 GLU N CA sing N N 136 GLU N H sing N N 137 GLU N H2 sing N N 138 GLU CA C sing N N 139 GLU CA CB sing N N 140 GLU CA HA sing N N 141 GLU C O doub N N 142 GLU C OXT sing N N 143 GLU CB CG sing N N 144 GLU CB HB2 sing N N 145 GLU CB HB3 sing N N 146 GLU CG CD sing N N 147 GLU CG HG2 sing N N 148 GLU CG HG3 sing N N 149 GLU CD OE1 doub N N 150 GLU CD OE2 sing N N 151 GLU OE2 HE2 sing N N 152 GLU OXT HXT sing N N 153 GLY N CA sing N N 154 GLY N H sing N N 155 GLY N H2 sing N N 156 GLY CA C sing N N 157 GLY CA HA2 sing N N 158 GLY CA HA3 sing N N 159 GLY C O doub N N 160 GLY C OXT sing N N 161 GLY OXT HXT sing N N 162 HIS N CA sing N N 163 HIS N H sing N N 164 HIS N H2 sing N N 165 HIS CA C sing N N 166 HIS CA CB sing N N 167 HIS CA HA sing N N 168 HIS C O doub N N 169 HIS C OXT sing N N 170 HIS CB CG sing N N 171 HIS CB HB2 sing N N 172 HIS CB HB3 sing N N 173 HIS CG ND1 sing Y N 174 HIS CG CD2 doub Y N 175 HIS ND1 CE1 doub Y N 176 HIS ND1 HD1 sing N N 177 HIS CD2 NE2 sing Y N 178 HIS CD2 HD2 sing N N 179 HIS CE1 NE2 sing Y N 180 HIS CE1 HE1 sing N N 181 HIS NE2 HE2 sing N N 182 HIS OXT HXT sing N N 183 HOH O H1 sing N N 184 HOH O H2 sing N N 185 ILE N CA sing N N 186 ILE N H sing N N 187 ILE N H2 sing N N 188 ILE CA C sing N N 189 ILE CA CB sing N N 190 ILE CA HA sing N N 191 ILE C O doub N N 192 ILE C OXT sing N N 193 ILE CB CG1 sing N N 194 ILE CB CG2 sing N N 195 ILE CB HB sing N N 196 ILE CG1 CD1 sing N N 197 ILE CG1 HG12 sing N N 198 ILE CG1 HG13 sing N N 199 ILE CG2 HG21 sing N N 200 ILE CG2 HG22 sing N N 201 ILE CG2 HG23 sing N N 202 ILE CD1 HD11 sing N N 203 ILE CD1 HD12 sing N N 204 ILE CD1 HD13 sing N N 205 ILE OXT HXT sing N N 206 LEU N CA sing N N 207 LEU N H sing N N 208 LEU N H2 sing N N 209 LEU CA C sing N N 210 LEU CA CB sing N N 211 LEU CA HA sing N N 212 LEU C O doub N N 213 LEU C OXT sing N N 214 LEU CB CG sing N N 215 LEU CB HB2 sing N N 216 LEU CB HB3 sing N N 217 LEU CG CD1 sing N N 218 LEU CG CD2 sing N N 219 LEU CG HG sing N N 220 LEU CD1 HD11 sing N N 221 LEU CD1 HD12 sing N N 222 LEU CD1 HD13 sing N N 223 LEU CD2 HD21 sing N N 224 LEU CD2 HD22 sing N N 225 LEU CD2 HD23 sing N N 226 LEU OXT HXT sing N N 227 LYS N CA sing N N 228 LYS N H sing N N 229 LYS N H2 sing N N 230 LYS CA C sing N N 231 LYS CA CB sing N N 232 LYS CA HA sing N N 233 LYS C O doub N N 234 LYS C OXT sing N N 235 LYS CB CG sing N N 236 LYS CB HB2 sing N N 237 LYS CB HB3 sing N N 238 LYS CG CD sing N N 239 LYS CG HG2 sing N N 240 LYS CG HG3 sing N N 241 LYS CD CE sing N N 242 LYS CD HD2 sing N N 243 LYS CD HD3 sing N N 244 LYS CE NZ sing N N 245 LYS CE HE2 sing N N 246 LYS CE HE3 sing N N 247 LYS NZ HZ1 sing N N 248 LYS NZ HZ2 sing N N 249 LYS NZ HZ3 sing N N 250 LYS OXT HXT sing N N 251 MET N CA sing N N 252 MET N H sing N N 253 MET N H2 sing N N 254 MET CA C sing N N 255 MET CA CB sing N N 256 MET CA HA sing N N 257 MET C O doub N N 258 MET C OXT sing N N 259 MET CB CG sing N N 260 MET CB HB2 sing N N 261 MET CB HB3 sing N N 262 MET CG SD sing N N 263 MET CG HG2 sing N N 264 MET CG HG3 sing N N 265 MET SD CE sing N N 266 MET CE HE1 sing N N 267 MET CE HE2 sing N N 268 MET CE HE3 sing N N 269 MET OXT HXT sing N N 270 NH2 N HN1 sing N N 271 NH2 N HN2 sing N N 272 PHE N CA sing N N 273 PHE N H sing N N 274 PHE N H2 sing N N 275 PHE CA C sing N N 276 PHE CA CB sing N N 277 PHE CA HA sing N N 278 PHE C O doub N N 279 PHE C OXT sing N N 280 PHE CB CG sing N N 281 PHE CB HB2 sing N N 282 PHE CB HB3 sing N N 283 PHE CG CD1 doub Y N 284 PHE CG CD2 sing Y N 285 PHE CD1 CE1 sing Y N 286 PHE CD1 HD1 sing N N 287 PHE CD2 CE2 doub Y N 288 PHE CD2 HD2 sing N N 289 PHE CE1 CZ doub Y N 290 PHE CE1 HE1 sing N N 291 PHE CE2 CZ sing Y N 292 PHE CE2 HE2 sing N N 293 PHE CZ HZ sing N N 294 PHE OXT HXT sing N N 295 PRO N CA sing N N 296 PRO N CD sing N N 297 PRO N H sing N N 298 PRO CA C sing N N 299 PRO CA CB sing N N 300 PRO CA HA sing N N 301 PRO C O doub N N 302 PRO C OXT sing N N 303 PRO CB CG sing N N 304 PRO CB HB2 sing N N 305 PRO CB HB3 sing N N 306 PRO CG CD sing N N 307 PRO CG HG2 sing N N 308 PRO CG HG3 sing N N 309 PRO CD HD2 sing N N 310 PRO CD HD3 sing N N 311 PRO OXT HXT sing N N 312 SER N CA sing N N 313 SER N H sing N N 314 SER N H2 sing N N 315 SER CA C sing N N 316 SER CA CB sing N N 317 SER CA HA sing N N 318 SER C O doub N N 319 SER C OXT sing N N 320 SER CB OG sing N N 321 SER CB HB2 sing N N 322 SER CB HB3 sing N N 323 SER OG HG sing N N 324 SER OXT HXT sing N N 325 THR N CA sing N N 326 THR N H sing N N 327 THR N H2 sing N N 328 THR CA C sing N N 329 THR CA CB sing N N 330 THR CA HA sing N N 331 THR C O doub N N 332 THR C OXT sing N N 333 THR CB OG1 sing N N 334 THR CB CG2 sing N N 335 THR CB HB sing N N 336 THR OG1 HG1 sing N N 337 THR CG2 HG21 sing N N 338 THR CG2 HG22 sing N N 339 THR CG2 HG23 sing N N 340 THR OXT HXT sing N N 341 TRP N CA sing N N 342 TRP N H sing N N 343 TRP N H2 sing N N 344 TRP CA C sing N N 345 TRP CA CB sing N N 346 TRP CA HA sing N N 347 TRP C O doub N N 348 TRP C OXT sing N N 349 TRP CB CG sing N N 350 TRP CB HB2 sing N N 351 TRP CB HB3 sing N N 352 TRP CG CD1 doub Y N 353 TRP CG CD2 sing Y N 354 TRP CD1 NE1 sing Y N 355 TRP CD1 HD1 sing N N 356 TRP CD2 CE2 doub Y N 357 TRP CD2 CE3 sing Y N 358 TRP NE1 CE2 sing Y N 359 TRP NE1 HE1 sing N N 360 TRP CE2 CZ2 sing Y N 361 TRP CE3 CZ3 doub Y N 362 TRP CE3 HE3 sing N N 363 TRP CZ2 CH2 doub Y N 364 TRP CZ2 HZ2 sing N N 365 TRP CZ3 CH2 sing Y N 366 TRP CZ3 HZ3 sing N N 367 TRP CH2 HH2 sing N N 368 TRP OXT HXT sing N N 369 TYR N CA sing N N 370 TYR N H sing N N 371 TYR N H2 sing N N 372 TYR CA C sing N N 373 TYR CA CB sing N N 374 TYR CA HA sing N N 375 TYR C O doub N N 376 TYR C OXT sing N N 377 TYR CB CG sing N N 378 TYR CB HB2 sing N N 379 TYR CB HB3 sing N N 380 TYR CG CD1 doub Y N 381 TYR CG CD2 sing Y N 382 TYR CD1 CE1 sing Y N 383 TYR CD1 HD1 sing N N 384 TYR CD2 CE2 doub Y N 385 TYR CD2 HD2 sing N N 386 TYR CE1 CZ doub Y N 387 TYR CE1 HE1 sing N N 388 TYR CE2 CZ sing Y N 389 TYR CE2 HE2 sing N N 390 TYR CZ OH sing N N 391 TYR OH HH sing N N 392 TYR OXT HXT sing N N 393 VAL N CA sing N N 394 VAL N H sing N N 395 VAL N H2 sing N N 396 VAL CA C sing N N 397 VAL CA CB sing N N 398 VAL CA HA sing N N 399 VAL C O doub N N 400 VAL C OXT sing N N 401 VAL CB CG1 sing N N 402 VAL CB CG2 sing N N 403 VAL CB HB sing N N 404 VAL CG1 HG11 sing N N 405 VAL CG1 HG12 sing N N 406 VAL CG1 HG13 sing N N 407 VAL CG2 HG21 sing N N 408 VAL CG2 HG22 sing N N 409 VAL CG2 HG23 sing N N 410 VAL OXT HXT sing N N 411 # _pdbx_audit_support.funding_organization 'National Health and Medical Research Council (NHMRC, Australia)' _pdbx_audit_support.country Australia _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3S91 _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'P 65' _space_group.name_Hall 'P 65' _space_group.IT_number 170 _space_group.crystal_system hexagonal _space_group.id 1 # _atom_sites.entry_id 9MPF _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.015767 _atom_sites.fract_transf_matrix[1][2] 0.009103 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.018206 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011746 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 7.96527 ? ? ? 9.05267 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ #