data_9MSQ # _entry.id 9MSQ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.404 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9MSQ pdb_00009msq 10.2210/pdb9msq/pdb WWPDB D_1000291728 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2025-06-04 ? 2 'Structure model' 1 1 2025-06-18 ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation_author.identifier_ORCID' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9MSQ _pdbx_database_status.recvd_initial_deposition_date 2025-01-10 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email redinbo@unc.edu _pdbx_contact_author.name_first Matthew _pdbx_contact_author.name_last Redinbo _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-0814-5346 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Kowalewski, M.E.' 1 0000-0001-9455-7333 'Redinbo, M.R.' 2 0000-0003-0814-5346 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Biochemistry _citation.journal_id_ASTM BICHAW _citation.journal_id_CSD 0033 _citation.journal_id_ISSN 0006-2960 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 64 _citation.language ? _citation.page_first 2401 _citation.page_last 2411 _citation.title 'Structural Insights into Selectively Targeting Candida albicans Hsp90.' _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.biochem.5c00015 _citation.pdbx_database_id_PubMed 40397669 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kowalewski, M.E.' 1 ? primary 'Zagler, S.' 2 ? primary 'Redinbo, M.R.' 3 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Heat shock protein 90 homolog' 26350.838 1 ? ? ? ? 2 non-polymer syn '(7R)-2-amino-7-[4-fluoro-2-(6-methoxypyridin-2-yl)phenyl]-4-methyl-7,8-dihydropyrido[4,3-d]pyrimidin-5(6H)-one' 379.388 1 ? ? ? ? 3 water nat water 18.015 15 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MADAKVETHEFTAEISQLMSLIINTVYSNKEIFLRELISNASDALDKIRYQALSDPSQLESEPELFIRIIPQKDQKVLEI RDSGIGMTKADLVNNLGTIAKSGTKSFMEALSAGADVSMIGQFGVGFYSLFLVADHVQVISKHNDDEQYVWESNAGGKFT VTLDETNERLGRGTMLRLFLKEDQLEYLEEKRIKEVVKKHSEFVAYPIQLVVTKEVEKNLYFQSGSHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MADAKVETHEFTAEISQLMSLIINTVYSNKEIFLRELISNASDALDKIRYQALSDPSQLESEPELFIRIIPQKDQKVLEI RDSGIGMTKADLVNNLGTIAKSGTKSFMEALSAGADVSMIGQFGVGFYSLFLVADHVQVISKHNDDEQYVWESNAGGKFT VTLDETNERLGRGTMLRLFLKEDQLEYLEEKRIKEVVKKHSEFVAYPIQLVVTKEVEKNLYFQSGSHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '(7R)-2-amino-7-[4-fluoro-2-(6-methoxypyridin-2-yl)phenyl]-4-methyl-7,8-dihydropyrido[4,3-d]pyrimidin-5(6H)-one' 990 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 ASP n 1 4 ALA n 1 5 LYS n 1 6 VAL n 1 7 GLU n 1 8 THR n 1 9 HIS n 1 10 GLU n 1 11 PHE n 1 12 THR n 1 13 ALA n 1 14 GLU n 1 15 ILE n 1 16 SER n 1 17 GLN n 1 18 LEU n 1 19 MET n 1 20 SER n 1 21 LEU n 1 22 ILE n 1 23 ILE n 1 24 ASN n 1 25 THR n 1 26 VAL n 1 27 TYR n 1 28 SER n 1 29 ASN n 1 30 LYS n 1 31 GLU n 1 32 ILE n 1 33 PHE n 1 34 LEU n 1 35 ARG n 1 36 GLU n 1 37 LEU n 1 38 ILE n 1 39 SER n 1 40 ASN n 1 41 ALA n 1 42 SER n 1 43 ASP n 1 44 ALA n 1 45 LEU n 1 46 ASP n 1 47 LYS n 1 48 ILE n 1 49 ARG n 1 50 TYR n 1 51 GLN n 1 52 ALA n 1 53 LEU n 1 54 SER n 1 55 ASP n 1 56 PRO n 1 57 SER n 1 58 GLN n 1 59 LEU n 1 60 GLU n 1 61 SER n 1 62 GLU n 1 63 PRO n 1 64 GLU n 1 65 LEU n 1 66 PHE n 1 67 ILE n 1 68 ARG n 1 69 ILE n 1 70 ILE n 1 71 PRO n 1 72 GLN n 1 73 LYS n 1 74 ASP n 1 75 GLN n 1 76 LYS n 1 77 VAL n 1 78 LEU n 1 79 GLU n 1 80 ILE n 1 81 ARG n 1 82 ASP n 1 83 SER n 1 84 GLY n 1 85 ILE n 1 86 GLY n 1 87 MET n 1 88 THR n 1 89 LYS n 1 90 ALA n 1 91 ASP n 1 92 LEU n 1 93 VAL n 1 94 ASN n 1 95 ASN n 1 96 LEU n 1 97 GLY n 1 98 THR n 1 99 ILE n 1 100 ALA n 1 101 LYS n 1 102 SER n 1 103 GLY n 1 104 THR n 1 105 LYS n 1 106 SER n 1 107 PHE n 1 108 MET n 1 109 GLU n 1 110 ALA n 1 111 LEU n 1 112 SER n 1 113 ALA n 1 114 GLY n 1 115 ALA n 1 116 ASP n 1 117 VAL n 1 118 SER n 1 119 MET n 1 120 ILE n 1 121 GLY n 1 122 GLN n 1 123 PHE n 1 124 GLY n 1 125 VAL n 1 126 GLY n 1 127 PHE n 1 128 TYR n 1 129 SER n 1 130 LEU n 1 131 PHE n 1 132 LEU n 1 133 VAL n 1 134 ALA n 1 135 ASP n 1 136 HIS n 1 137 VAL n 1 138 GLN n 1 139 VAL n 1 140 ILE n 1 141 SER n 1 142 LYS n 1 143 HIS n 1 144 ASN n 1 145 ASP n 1 146 ASP n 1 147 GLU n 1 148 GLN n 1 149 TYR n 1 150 VAL n 1 151 TRP n 1 152 GLU n 1 153 SER n 1 154 ASN n 1 155 ALA n 1 156 GLY n 1 157 GLY n 1 158 LYS n 1 159 PHE n 1 160 THR n 1 161 VAL n 1 162 THR n 1 163 LEU n 1 164 ASP n 1 165 GLU n 1 166 THR n 1 167 ASN n 1 168 GLU n 1 169 ARG n 1 170 LEU n 1 171 GLY n 1 172 ARG n 1 173 GLY n 1 174 THR n 1 175 MET n 1 176 LEU n 1 177 ARG n 1 178 LEU n 1 179 PHE n 1 180 LEU n 1 181 LYS n 1 182 GLU n 1 183 ASP n 1 184 GLN n 1 185 LEU n 1 186 GLU n 1 187 TYR n 1 188 LEU n 1 189 GLU n 1 190 GLU n 1 191 LYS n 1 192 ARG n 1 193 ILE n 1 194 LYS n 1 195 GLU n 1 196 VAL n 1 197 VAL n 1 198 LYS n 1 199 LYS n 1 200 HIS n 1 201 SER n 1 202 GLU n 1 203 PHE n 1 204 VAL n 1 205 ALA n 1 206 TYR n 1 207 PRO n 1 208 ILE n 1 209 GLN n 1 210 LEU n 1 211 VAL n 1 212 VAL n 1 213 THR n 1 214 LYS n 1 215 GLU n 1 216 VAL n 1 217 GLU n 1 218 LYS n 1 219 ASN n 1 220 LEU n 1 221 TYR n 1 222 PHE n 1 223 GLN n 1 224 SER n 1 225 GLY n 1 226 SER n 1 227 HIS n 1 228 HIS n 1 229 HIS n 1 230 HIS n 1 231 HIS n 1 232 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 232 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'HSP90, CAALFM_C702030WA, CaJ7.0234, CaO19.13868, CaO19.6515' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Candida albicans' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 5476 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ;Escherichia coli 'BL21-Gold(DE3)pLysS AG' ; _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 866768 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 990 non-polymer . '(7R)-2-amino-7-[4-fluoro-2-(6-methoxypyridin-2-yl)phenyl]-4-methyl-7,8-dihydropyrido[4,3-d]pyrimidin-5(6H)-one' ? 'C20 H18 F N5 O2' 379.388 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ALA 2 2 ? ? ? A . n A 1 3 ASP 3 3 ? ? ? A . n A 1 4 ALA 4 4 4 ALA ALA A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 HIS 9 9 9 HIS HIS A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 PHE 11 11 11 PHE PHE A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 MET 19 19 19 MET MET A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 ASN 24 24 24 ASN ASN A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 TYR 27 27 27 TYR TYR A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 ASN 29 29 29 ASN ASN A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 PHE 33 33 33 PHE PHE A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 ARG 35 35 35 ARG ARG A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 SER 39 39 39 SER SER A . n A 1 40 ASN 40 40 40 ASN ASN A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 SER 42 42 42 SER SER A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 ARG 49 49 49 ARG ARG A . n A 1 50 TYR 50 50 50 TYR TYR A . n A 1 51 GLN 51 51 51 GLN GLN A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 PRO 56 56 56 PRO PRO A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 GLN 58 58 58 GLN GLN A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 PRO 63 63 63 PRO PRO A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 PHE 66 66 66 PHE PHE A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 ILE 69 69 69 ILE ILE A . n A 1 70 ILE 70 70 70 ILE ILE A . n A 1 71 PRO 71 71 71 PRO PRO A . n A 1 72 GLN 72 72 72 GLN GLN A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 ASP 74 74 74 ASP ASP A . n A 1 75 GLN 75 75 75 GLN GLN A . n A 1 76 LYS 76 76 76 LYS LYS A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 GLU 79 79 79 GLU GLU A . n A 1 80 ILE 80 80 80 ILE ILE A . n A 1 81 ARG 81 81 81 ARG ARG A . n A 1 82 ASP 82 82 82 ASP ASP A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 ILE 85 85 85 ILE ILE A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 MET 87 87 87 MET MET A . n A 1 88 THR 88 88 88 THR THR A . n A 1 89 LYS 89 89 89 LYS LYS A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 ASP 91 91 91 ASP ASP A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 VAL 93 93 93 VAL VAL A . n A 1 94 ASN 94 94 94 ASN ASN A . n A 1 95 ASN 95 95 95 ASN ASN A . n A 1 96 LEU 96 96 ? ? ? A . n A 1 97 GLY 97 97 ? ? ? A . n A 1 98 THR 98 98 98 THR THR A . n A 1 99 ILE 99 99 99 ILE ILE A . n A 1 100 ALA 100 100 100 ALA ALA A . n A 1 101 LYS 101 101 101 LYS LYS A . n A 1 102 SER 102 102 102 SER SER A . n A 1 103 GLY 103 103 103 GLY GLY A . n A 1 104 THR 104 104 104 THR THR A . n A 1 105 LYS 105 105 105 LYS LYS A . n A 1 106 SER 106 106 106 SER SER A . n A 1 107 PHE 107 107 107 PHE PHE A . n A 1 108 MET 108 108 108 MET MET A . n A 1 109 GLU 109 109 109 GLU GLU A . n A 1 110 ALA 110 110 110 ALA ALA A . n A 1 111 LEU 111 111 111 LEU LEU A . n A 1 112 SER 112 112 112 SER SER A . n A 1 113 ALA 113 113 113 ALA ALA A . n A 1 114 GLY 114 114 114 GLY GLY A . n A 1 115 ALA 115 115 115 ALA ALA A . n A 1 116 ASP 116 116 116 ASP ASP A . n A 1 117 VAL 117 117 117 VAL VAL A . n A 1 118 SER 118 118 118 SER SER A . n A 1 119 MET 119 119 119 MET MET A . n A 1 120 ILE 120 120 120 ILE ILE A . n A 1 121 GLY 121 121 121 GLY GLY A . n A 1 122 GLN 122 122 122 GLN GLN A . n A 1 123 PHE 123 123 123 PHE PHE A . n A 1 124 GLY 124 124 124 GLY GLY A . n A 1 125 VAL 125 125 125 VAL VAL A . n A 1 126 GLY 126 126 126 GLY GLY A . n A 1 127 PHE 127 127 127 PHE PHE A . n A 1 128 TYR 128 128 128 TYR TYR A . n A 1 129 SER 129 129 129 SER SER A . n A 1 130 LEU 130 130 130 LEU LEU A . n A 1 131 PHE 131 131 131 PHE PHE A . n A 1 132 LEU 132 132 132 LEU LEU A . n A 1 133 VAL 133 133 133 VAL VAL A . n A 1 134 ALA 134 134 134 ALA ALA A . n A 1 135 ASP 135 135 135 ASP ASP A . n A 1 136 HIS 136 136 136 HIS HIS A . n A 1 137 VAL 137 137 137 VAL VAL A . n A 1 138 GLN 138 138 138 GLN GLN A . n A 1 139 VAL 139 139 139 VAL VAL A . n A 1 140 ILE 140 140 140 ILE ILE A . n A 1 141 SER 141 141 141 SER SER A . n A 1 142 LYS 142 142 142 LYS LYS A . n A 1 143 HIS 143 143 143 HIS HIS A . n A 1 144 ASN 144 144 144 ASN ASN A . n A 1 145 ASP 145 145 145 ASP ASP A . n A 1 146 ASP 146 146 146 ASP ASP A . n A 1 147 GLU 147 147 147 GLU GLU A . n A 1 148 GLN 148 148 148 GLN GLN A . n A 1 149 TYR 149 149 149 TYR TYR A . n A 1 150 VAL 150 150 150 VAL VAL A . n A 1 151 TRP 151 151 151 TRP TRP A . n A 1 152 GLU 152 152 152 GLU GLU A . n A 1 153 SER 153 153 153 SER SER A . n A 1 154 ASN 154 154 154 ASN ASN A . n A 1 155 ALA 155 155 155 ALA ALA A . n A 1 156 GLY 156 156 156 GLY GLY A . n A 1 157 GLY 157 157 157 GLY GLY A . n A 1 158 LYS 158 158 158 LYS LYS A . n A 1 159 PHE 159 159 159 PHE PHE A . n A 1 160 THR 160 160 160 THR THR A . n A 1 161 VAL 161 161 161 VAL VAL A . n A 1 162 THR 162 162 162 THR THR A . n A 1 163 LEU 163 163 163 LEU LEU A . n A 1 164 ASP 164 164 164 ASP ASP A . n A 1 165 GLU 165 165 165 GLU GLU A . n A 1 166 THR 166 166 166 THR THR A . n A 1 167 ASN 167 167 167 ASN ASN A . n A 1 168 GLU 168 168 168 GLU GLU A . n A 1 169 ARG 169 169 169 ARG ARG A . n A 1 170 LEU 170 170 170 LEU LEU A . n A 1 171 GLY 171 171 171 GLY GLY A . n A 1 172 ARG 172 172 172 ARG ARG A . n A 1 173 GLY 173 173 173 GLY GLY A . n A 1 174 THR 174 174 174 THR THR A . n A 1 175 MET 175 175 175 MET MET A . n A 1 176 LEU 176 176 176 LEU LEU A . n A 1 177 ARG 177 177 177 ARG ARG A . n A 1 178 LEU 178 178 178 LEU LEU A . n A 1 179 PHE 179 179 179 PHE PHE A . n A 1 180 LEU 180 180 180 LEU LEU A . n A 1 181 LYS 181 181 181 LYS LYS A . n A 1 182 GLU 182 182 182 GLU GLU A . n A 1 183 ASP 183 183 183 ASP ASP A . n A 1 184 GLN 184 184 184 GLN GLN A . n A 1 185 LEU 185 185 185 LEU LEU A . n A 1 186 GLU 186 186 186 GLU GLU A . n A 1 187 TYR 187 187 187 TYR TYR A . n A 1 188 LEU 188 188 188 LEU LEU A . n A 1 189 GLU 189 189 189 GLU GLU A . n A 1 190 GLU 190 190 190 GLU GLU A . n A 1 191 LYS 191 191 191 LYS LYS A . n A 1 192 ARG 192 192 192 ARG ARG A . n A 1 193 ILE 193 193 193 ILE ILE A . n A 1 194 LYS 194 194 194 LYS LYS A . n A 1 195 GLU 195 195 195 GLU GLU A . n A 1 196 VAL 196 196 196 VAL VAL A . n A 1 197 VAL 197 197 197 VAL VAL A . n A 1 198 LYS 198 198 198 LYS LYS A . n A 1 199 LYS 199 199 199 LYS LYS A . n A 1 200 HIS 200 200 200 HIS HIS A . n A 1 201 SER 201 201 201 SER SER A . n A 1 202 GLU 202 202 202 GLU GLU A . n A 1 203 PHE 203 203 203 PHE PHE A . n A 1 204 VAL 204 204 204 VAL VAL A . n A 1 205 ALA 205 205 205 ALA ALA A . n A 1 206 TYR 206 206 206 TYR TYR A . n A 1 207 PRO 207 207 207 PRO PRO A . n A 1 208 ILE 208 208 208 ILE ILE A . n A 1 209 GLN 209 209 209 GLN GLN A . n A 1 210 LEU 210 210 210 LEU LEU A . n A 1 211 VAL 211 211 211 VAL VAL A . n A 1 212 VAL 212 212 212 VAL VAL A . n A 1 213 THR 213 213 213 THR THR A . n A 1 214 LYS 214 214 214 LYS LYS A . n A 1 215 GLU 215 215 215 GLU GLU A . n A 1 216 VAL 216 216 216 VAL VAL A . n A 1 217 GLU 217 217 217 GLU GLU A . n A 1 218 LYS 218 218 ? ? ? A . n A 1 219 ASN 219 219 ? ? ? A . n A 1 220 LEU 220 220 ? ? ? A . n A 1 221 TYR 221 221 ? ? ? A . n A 1 222 PHE 222 222 ? ? ? A . n A 1 223 GLN 223 223 ? ? ? A . n A 1 224 SER 224 224 ? ? ? A . n A 1 225 GLY 225 225 ? ? ? A . n A 1 226 SER 226 226 ? ? ? A . n A 1 227 HIS 227 227 ? ? ? A . n A 1 228 HIS 228 228 ? ? ? A . n A 1 229 HIS 229 229 ? ? ? A . n A 1 230 HIS 230 230 ? ? ? A . n A 1 231 HIS 231 231 ? ? ? A . n A 1 232 HIS 232 232 ? ? ? A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id 990 _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id 990 _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 990 1 301 301 990 990 A . C 3 HOH 1 401 3 HOH HOH A . C 3 HOH 2 402 1 HOH HOH A . C 3 HOH 3 403 8 HOH HOH A . C 3 HOH 4 404 4 HOH HOH A . C 3 HOH 5 405 6 HOH HOH A . C 3 HOH 6 406 12 HOH HOH A . C 3 HOH 7 407 14 HOH HOH A . C 3 HOH 8 408 5 HOH HOH A . C 3 HOH 9 409 11 HOH HOH A . C 3 HOH 10 410 9 HOH HOH A . C 3 HOH 11 411 17 HOH HOH A . C 3 HOH 12 412 10 HOH HOH A . C 3 HOH 13 413 2 HOH HOH A . C 3 HOH 14 414 16 HOH HOH A . C 3 HOH 15 415 15 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 5 ? CG ? A LYS 5 CG 2 1 Y 1 A LYS 5 ? CD ? A LYS 5 CD 3 1 Y 1 A LYS 5 ? CE ? A LYS 5 CE 4 1 Y 1 A LYS 5 ? NZ ? A LYS 5 NZ 5 1 Y 1 A GLN 17 ? CG ? A GLN 17 CG 6 1 Y 1 A GLN 17 ? CD ? A GLN 17 CD 7 1 Y 1 A GLN 17 ? OE1 ? A GLN 17 OE1 8 1 Y 1 A GLN 17 ? NE2 ? A GLN 17 NE2 9 1 Y 1 A LYS 101 ? CG ? A LYS 101 CG 10 1 Y 1 A LYS 101 ? CD ? A LYS 101 CD 11 1 Y 1 A LYS 101 ? CE ? A LYS 101 CE 12 1 Y 1 A LYS 101 ? NZ ? A LYS 101 NZ 13 1 Y 1 A LYS 214 ? CG ? A LYS 214 CG 14 1 Y 1 A LYS 214 ? CD ? A LYS 214 CD 15 1 Y 1 A LYS 214 ? CE ? A LYS 214 CE 16 1 Y 1 A LYS 214 ? NZ ? A LYS 214 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.21.1_5286 1 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 2 ? 'data processing' ? ? ? ? ? ? ? ? ? ? ? autoPROC ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 4 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 9MSQ _cell.details ? _cell.formula_units_Z ? _cell.length_a 73.758 _cell.length_a_esd ? _cell.length_b 73.758 _cell.length_b_esd ? _cell.length_c 107.014 _cell.length_c_esd ? _cell.volume 582182.118 _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9MSQ _symmetry.cell_setting ? _symmetry.Int_Tables_number 95 _symmetry.space_group_name_Hall 'P 4cw 2c' _symmetry.space_group_name_H-M 'P 43 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9MSQ _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.76 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 55.46 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.17 M ammonium acetate, 0.085 M sodium citrate:HCl pH 5.6, 25.5% w/v PEG4000, and 15% glycerol' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2023-05-25 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'NSLS-II BEAMLINE 17-ID-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 17-ID-1 _diffrn_source.pdbx_synchrotron_site NSLS-II # _reflns.B_iso_Wilson_estimate 54.61 _reflns.entry_id 9MSQ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.53 _reflns.d_resolution_low 37.35 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 10390 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.95 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 19.4 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 21.66 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs .08814 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.53 _reflns_shell.d_res_low 2.66 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 4.83 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1437 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 19.1 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.955 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 99.93 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.6209 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 60.76 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9MSQ _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.53 _refine.ls_d_res_low 37.35 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 10386 _refine.ls_number_reflns_R_free 1039 _refine.ls_number_reflns_R_work 9347 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.96 _refine.ls_percent_reflns_R_free 10.00 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2166 _refine.ls_R_factor_R_free 0.2663 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2111 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 27.0369 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3584 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.53 _refine_hist.d_res_low 37.35 _refine_hist.number_atoms_solvent 15 _refine_hist.number_atoms_total 1714 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1671 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 28 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0158 ? 1735 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.5549 ? 2345 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0714 ? 268 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0132 ? 300 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 21.4253 ? 651 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.53 2.66 . . 144 1293 100.00 . . . . 0.2562 . . . . . . . . . . . . . . . 0.3106 'X-RAY DIFFRACTION' 2.66 2.83 . . 144 1305 100.00 . . . . 0.2666 . . . . . . . . . . . . . . . 0.3429 'X-RAY DIFFRACTION' 2.83 3.05 . . 146 1310 100.00 . . . . 0.2616 . . . . . . . . . . . . . . . 0.3673 'X-RAY DIFFRACTION' 3.05 3.36 . . 146 1310 99.86 . . . . 0.2381 . . . . . . . . . . . . . . . 0.2804 'X-RAY DIFFRACTION' 3.36 3.84 . . 149 1336 100.00 . . . . 0.2197 . . . . . . . . . . . . . . . 0.2735 'X-RAY DIFFRACTION' 3.84 4.84 . . 149 1345 100.00 . . . . 0.1711 . . . . . . . . . . . . . . . 0.2287 'X-RAY DIFFRACTION' 4.84 37.35 . . 161 1448 99.88 . . . . 0.1994 . . . . . . . . . . . . . . . 0.2416 # _struct.entry_id 9MSQ _struct.title 'Candida albicans Hsp90 nucleotide binding domain in complex with HSP990' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9MSQ _struct_keywords.text 'Inhibitor complex, CHAPERONE, CHAPERONE-INHIBITOR complex' _struct_keywords.pdbx_keywords CHAPERONE/INHIBITOR # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code HSP90_CANAL _struct_ref.pdbx_db_accession P46598 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MADAKVETHEFTAEISQLMSLIINTVYSNKEIFLRELISNASDALDKIRYQALSDPSQLESEPELFIRIIPQKDQKVLEI RDSGIGMTKADLVNNLGTIAKSGTKSFMEALSAGADVSMIGQFGVGFYSLFLVADHVQVISKHNDDEQYVWESNAGGKFT VTLDETNERLGRGTMLRLFLKEDQLEYLEEKRIKEVVKKHSEFVAYPIQLVVTKEVEK ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9MSQ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 218 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P46598 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 218 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 218 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9MSQ ASN A 219 ? UNP P46598 ? ? 'expression tag' 219 1 1 9MSQ LEU A 220 ? UNP P46598 ? ? 'expression tag' 220 2 1 9MSQ TYR A 221 ? UNP P46598 ? ? 'expression tag' 221 3 1 9MSQ PHE A 222 ? UNP P46598 ? ? 'expression tag' 222 4 1 9MSQ GLN A 223 ? UNP P46598 ? ? 'expression tag' 223 5 1 9MSQ SER A 224 ? UNP P46598 ? ? 'expression tag' 224 6 1 9MSQ GLY A 225 ? UNP P46598 ? ? 'expression tag' 225 7 1 9MSQ SER A 226 ? UNP P46598 ? ? 'expression tag' 226 8 1 9MSQ HIS A 227 ? UNP P46598 ? ? 'expression tag' 227 9 1 9MSQ HIS A 228 ? UNP P46598 ? ? 'expression tag' 228 10 1 9MSQ HIS A 229 ? UNP P46598 ? ? 'expression tag' 229 11 1 9MSQ HIS A 230 ? UNP P46598 ? ? 'expression tag' 230 12 1 9MSQ HIS A 231 ? UNP P46598 ? ? 'expression tag' 231 13 1 9MSQ HIS A 232 ? UNP P46598 ? ? 'expression tag' 232 14 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 12 ? THR A 25 ? THR A 12 THR A 25 1 ? 14 HELX_P HELX_P2 AA2 GLU A 31 ? ASP A 55 ? GLU A 31 ASP A 55 1 ? 25 HELX_P HELX_P3 AA3 PRO A 56 ? GLU A 62 ? PRO A 56 GLU A 62 5 ? 7 HELX_P HELX_P4 AA4 THR A 88 ? ASN A 94 ? THR A 88 ASN A 94 1 ? 7 HELX_P HELX_P5 AA5 ILE A 99 ? ALA A 113 ? ILE A 99 ALA A 113 1 ? 15 HELX_P HELX_P6 AA6 ASP A 116 ? GLY A 124 ? ASP A 116 GLY A 124 5 ? 9 HELX_P HELX_P7 AA7 VAL A 125 ? LEU A 132 ? VAL A 125 LEU A 132 5 ? 8 HELX_P HELX_P8 AA8 GLU A 182 ? LEU A 188 ? GLU A 182 LEU A 188 5 ? 7 HELX_P HELX_P9 AA9 GLU A 189 ? SER A 201 ? GLU A 189 SER A 201 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 8 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA1 7 8 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLU A 7 ? GLU A 10 ? GLU A 7 GLU A 10 AA1 2 LYS A 158 ? LEU A 163 ? LYS A 158 LEU A 163 AA1 3 GLN A 148 ? SER A 153 ? GLN A 148 SER A 153 AA1 4 ALA A 134 ? LYS A 142 ? ALA A 134 LYS A 142 AA1 5 GLY A 173 ? LEU A 180 ? GLY A 173 LEU A 180 AA1 6 VAL A 77 ? ASP A 82 ? VAL A 77 ASP A 82 AA1 7 ILE A 67 ? GLN A 72 ? ILE A 67 GLN A 72 AA1 8 ILE A 208 ? LEU A 210 ? ILE A 208 LEU A 210 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N HIS A 9 ? N HIS A 9 O PHE A 159 ? O PHE A 159 AA1 2 3 O THR A 162 ? O THR A 162 N VAL A 150 ? N VAL A 150 AA1 3 4 O TRP A 151 ? O TRP A 151 N VAL A 139 ? N VAL A 139 AA1 4 5 N GLN A 138 ? N GLN A 138 O ARG A 177 ? O ARG A 177 AA1 5 6 O LEU A 178 ? O LEU A 178 N LEU A 78 ? N LEU A 78 AA1 6 7 O ARG A 81 ? O ARG A 81 N ARG A 68 ? N ARG A 68 AA1 7 8 N ILE A 69 ? N ILE A 69 O GLN A 209 ? O GLN A 209 # _pdbx_entry_details.entry_id 9MSQ _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TYR A 27 ? ? -31.74 137.81 2 1 GLU A 31 ? ? -55.30 -7.68 3 1 GLU A 62 ? ? -169.38 83.81 4 1 SER A 83 ? ? -99.67 43.88 5 1 ASN A 94 ? ? -155.22 47.20 6 1 ALA A 155 ? ? 80.94 8.52 7 1 SER A 201 ? ? -140.50 50.00 8 1 PHE A 203 ? ? -105.11 57.95 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 1 _pdbx_validate_planes.auth_comp_id ARG _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 192 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.081 _pdbx_validate_planes.type 'SIDE CHAIN' # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y,x,z+3/4 3 y,-x,z+1/4 4 x,-y,-z+1/2 5 -x,y,-z 6 -x,-y,z+1/2 7 y,x,-z+1/4 8 -y,-x,-z+3/4 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ALA 2 ? A ALA 2 3 1 Y 1 A ASP 3 ? A ASP 3 4 1 Y 1 A LEU 96 ? A LEU 96 5 1 Y 1 A GLY 97 ? A GLY 97 6 1 Y 1 A LYS 218 ? A LYS 218 7 1 Y 1 A ASN 219 ? A ASN 219 8 1 Y 1 A LEU 220 ? A LEU 220 9 1 Y 1 A TYR 221 ? A TYR 221 10 1 Y 1 A PHE 222 ? A PHE 222 11 1 Y 1 A GLN 223 ? A GLN 223 12 1 Y 1 A SER 224 ? A SER 224 13 1 Y 1 A GLY 225 ? A GLY 225 14 1 Y 1 A SER 226 ? A SER 226 15 1 Y 1 A HIS 227 ? A HIS 227 16 1 Y 1 A HIS 228 ? A HIS 228 17 1 Y 1 A HIS 229 ? A HIS 229 18 1 Y 1 A HIS 230 ? A HIS 230 19 1 Y 1 A HIS 231 ? A HIS 231 20 1 Y 1 A HIS 232 ? A HIS 232 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 990 F17 F N N 1 990 C16 C Y N 2 990 C18 C Y N 3 990 C8 C Y N 4 990 C21 C Y N 5 990 N26 N Y N 6 990 C25 C Y N 7 990 O27 O N N 8 990 C28 C N N 9 990 C24 C Y N 10 990 C23 C Y N 11 990 C22 C Y N 12 990 C19 C Y N 13 990 C20 C Y N 14 990 C7 C Y N 15 990 C6 C N R 16 990 N9 N N N 17 990 C1 C N N 18 990 O2 O N N 19 990 C5 C N N 20 990 C4 C Y N 21 990 N15 N Y N 22 990 C13 C Y N 23 990 N14 N N N 24 990 N12 N Y N 25 990 C10 C Y N 26 990 C3 C Y N 27 990 C11 C N N 28 990 H1 H N N 29 990 H2 H N N 30 990 H3 H N N 31 990 H4 H N N 32 990 H5 H N N 33 990 H6 H N N 34 990 H7 H N N 35 990 H8 H N N 36 990 H9 H N N 37 990 H10 H N N 38 990 H11 H N N 39 990 H12 H N N 40 990 H13 H N N 41 990 H14 H N N 42 990 H15 H N N 43 990 H16 H N N 44 990 H17 H N N 45 990 H18 H N N 46 ALA N N N N 47 ALA CA C N S 48 ALA C C N N 49 ALA O O N N 50 ALA CB C N N 51 ALA OXT O N N 52 ALA H H N N 53 ALA H2 H N N 54 ALA HA H N N 55 ALA HB1 H N N 56 ALA HB2 H N N 57 ALA HB3 H N N 58 ALA HXT H N N 59 ARG N N N N 60 ARG CA C N S 61 ARG C C N N 62 ARG O O N N 63 ARG CB C N N 64 ARG CG C N N 65 ARG CD C N N 66 ARG NE N N N 67 ARG CZ C N N 68 ARG NH1 N N N 69 ARG NH2 N N N 70 ARG OXT O N N 71 ARG H H N N 72 ARG H2 H N N 73 ARG HA H N N 74 ARG HB2 H N N 75 ARG HB3 H N N 76 ARG HG2 H N N 77 ARG HG3 H N N 78 ARG HD2 H N N 79 ARG HD3 H N N 80 ARG HE H N N 81 ARG HH11 H N N 82 ARG HH12 H N N 83 ARG HH21 H N N 84 ARG HH22 H N N 85 ARG HXT H N N 86 ASN N N N N 87 ASN CA C N S 88 ASN C C N N 89 ASN O O N N 90 ASN CB C N N 91 ASN CG C N N 92 ASN OD1 O N N 93 ASN ND2 N N N 94 ASN OXT O N N 95 ASN H H N N 96 ASN H2 H N N 97 ASN HA H N N 98 ASN HB2 H N N 99 ASN HB3 H N N 100 ASN HD21 H N N 101 ASN HD22 H N N 102 ASN HXT H N N 103 ASP N N N N 104 ASP CA C N S 105 ASP C C N N 106 ASP O O N N 107 ASP CB C N N 108 ASP CG C N N 109 ASP OD1 O N N 110 ASP OD2 O N N 111 ASP OXT O N N 112 ASP H H N N 113 ASP H2 H N N 114 ASP HA H N N 115 ASP HB2 H N N 116 ASP HB3 H N N 117 ASP HD2 H N N 118 ASP HXT H N N 119 GLN N N N N 120 GLN CA C N S 121 GLN C C N N 122 GLN O O N N 123 GLN CB C N N 124 GLN CG C N N 125 GLN CD C N N 126 GLN OE1 O N N 127 GLN NE2 N N N 128 GLN OXT O N N 129 GLN H H N N 130 GLN H2 H N N 131 GLN HA H N N 132 GLN HB2 H N N 133 GLN HB3 H N N 134 GLN HG2 H N N 135 GLN HG3 H N N 136 GLN HE21 H N N 137 GLN HE22 H N N 138 GLN HXT H N N 139 GLU N N N N 140 GLU CA C N S 141 GLU C C N N 142 GLU O O N N 143 GLU CB C N N 144 GLU CG C N N 145 GLU CD C N N 146 GLU OE1 O N N 147 GLU OE2 O N N 148 GLU OXT O N N 149 GLU H H N N 150 GLU H2 H N N 151 GLU HA H N N 152 GLU HB2 H N N 153 GLU HB3 H N N 154 GLU HG2 H N N 155 GLU HG3 H N N 156 GLU HE2 H N N 157 GLU HXT H N N 158 GLY N N N N 159 GLY CA C N N 160 GLY C C N N 161 GLY O O N N 162 GLY OXT O N N 163 GLY H H N N 164 GLY H2 H N N 165 GLY HA2 H N N 166 GLY HA3 H N N 167 GLY HXT H N N 168 HIS N N N N 169 HIS CA C N S 170 HIS C C N N 171 HIS O O N N 172 HIS CB C N N 173 HIS CG C Y N 174 HIS ND1 N Y N 175 HIS CD2 C Y N 176 HIS CE1 C Y N 177 HIS NE2 N Y N 178 HIS OXT O N N 179 HIS H H N N 180 HIS H2 H N N 181 HIS HA H N N 182 HIS HB2 H N N 183 HIS HB3 H N N 184 HIS HD1 H N N 185 HIS HD2 H N N 186 HIS HE1 H N N 187 HIS HE2 H N N 188 HIS HXT H N N 189 HOH O O N N 190 HOH H1 H N N 191 HOH H2 H N N 192 ILE N N N N 193 ILE CA C N S 194 ILE C C N N 195 ILE O O N N 196 ILE CB C N S 197 ILE CG1 C N N 198 ILE CG2 C N N 199 ILE CD1 C N N 200 ILE OXT O N N 201 ILE H H N N 202 ILE H2 H N N 203 ILE HA H N N 204 ILE HB H N N 205 ILE HG12 H N N 206 ILE HG13 H N N 207 ILE HG21 H N N 208 ILE HG22 H N N 209 ILE HG23 H N N 210 ILE HD11 H N N 211 ILE HD12 H N N 212 ILE HD13 H N N 213 ILE HXT H N N 214 LEU N N N N 215 LEU CA C N S 216 LEU C C N N 217 LEU O O N N 218 LEU CB C N N 219 LEU CG C N N 220 LEU CD1 C N N 221 LEU CD2 C N N 222 LEU OXT O N N 223 LEU H H N N 224 LEU H2 H N N 225 LEU HA H N N 226 LEU HB2 H N N 227 LEU HB3 H N N 228 LEU HG H N N 229 LEU HD11 H N N 230 LEU HD12 H N N 231 LEU HD13 H N N 232 LEU HD21 H N N 233 LEU HD22 H N N 234 LEU HD23 H N N 235 LEU HXT H N N 236 LYS N N N N 237 LYS CA C N S 238 LYS C C N N 239 LYS O O N N 240 LYS CB C N N 241 LYS CG C N N 242 LYS CD C N N 243 LYS CE C N N 244 LYS NZ N N N 245 LYS OXT O N N 246 LYS H H N N 247 LYS H2 H N N 248 LYS HA H N N 249 LYS HB2 H N N 250 LYS HB3 H N N 251 LYS HG2 H N N 252 LYS HG3 H N N 253 LYS HD2 H N N 254 LYS HD3 H N N 255 LYS HE2 H N N 256 LYS HE3 H N N 257 LYS HZ1 H N N 258 LYS HZ2 H N N 259 LYS HZ3 H N N 260 LYS HXT H N N 261 MET N N N N 262 MET CA C N S 263 MET C C N N 264 MET O O N N 265 MET CB C N N 266 MET CG C N N 267 MET SD S N N 268 MET CE C N N 269 MET OXT O N N 270 MET H H N N 271 MET H2 H N N 272 MET HA H N N 273 MET HB2 H N N 274 MET HB3 H N N 275 MET HG2 H N N 276 MET HG3 H N N 277 MET HE1 H N N 278 MET HE2 H N N 279 MET HE3 H N N 280 MET HXT H N N 281 PHE N N N N 282 PHE CA C N S 283 PHE C C N N 284 PHE O O N N 285 PHE CB C N N 286 PHE CG C Y N 287 PHE CD1 C Y N 288 PHE CD2 C Y N 289 PHE CE1 C Y N 290 PHE CE2 C Y N 291 PHE CZ C Y N 292 PHE OXT O N N 293 PHE H H N N 294 PHE H2 H N N 295 PHE HA H N N 296 PHE HB2 H N N 297 PHE HB3 H N N 298 PHE HD1 H N N 299 PHE HD2 H N N 300 PHE HE1 H N N 301 PHE HE2 H N N 302 PHE HZ H N N 303 PHE HXT H N N 304 PRO N N N N 305 PRO CA C N S 306 PRO C C N N 307 PRO O O N N 308 PRO CB C N N 309 PRO CG C N N 310 PRO CD C N N 311 PRO OXT O N N 312 PRO H H N N 313 PRO HA H N N 314 PRO HB2 H N N 315 PRO HB3 H N N 316 PRO HG2 H N N 317 PRO HG3 H N N 318 PRO HD2 H N N 319 PRO HD3 H N N 320 PRO HXT H N N 321 SER N N N N 322 SER CA C N S 323 SER C C N N 324 SER O O N N 325 SER CB C N N 326 SER OG O N N 327 SER OXT O N N 328 SER H H N N 329 SER H2 H N N 330 SER HA H N N 331 SER HB2 H N N 332 SER HB3 H N N 333 SER HG H N N 334 SER HXT H N N 335 THR N N N N 336 THR CA C N S 337 THR C C N N 338 THR O O N N 339 THR CB C N R 340 THR OG1 O N N 341 THR CG2 C N N 342 THR OXT O N N 343 THR H H N N 344 THR H2 H N N 345 THR HA H N N 346 THR HB H N N 347 THR HG1 H N N 348 THR HG21 H N N 349 THR HG22 H N N 350 THR HG23 H N N 351 THR HXT H N N 352 TRP N N N N 353 TRP CA C N S 354 TRP C C N N 355 TRP O O N N 356 TRP CB C N N 357 TRP CG C Y N 358 TRP CD1 C Y N 359 TRP CD2 C Y N 360 TRP NE1 N Y N 361 TRP CE2 C Y N 362 TRP CE3 C Y N 363 TRP CZ2 C Y N 364 TRP CZ3 C Y N 365 TRP CH2 C Y N 366 TRP OXT O N N 367 TRP H H N N 368 TRP H2 H N N 369 TRP HA H N N 370 TRP HB2 H N N 371 TRP HB3 H N N 372 TRP HD1 H N N 373 TRP HE1 H N N 374 TRP HE3 H N N 375 TRP HZ2 H N N 376 TRP HZ3 H N N 377 TRP HH2 H N N 378 TRP HXT H N N 379 TYR N N N N 380 TYR CA C N S 381 TYR C C N N 382 TYR O O N N 383 TYR CB C N N 384 TYR CG C Y N 385 TYR CD1 C Y N 386 TYR CD2 C Y N 387 TYR CE1 C Y N 388 TYR CE2 C Y N 389 TYR CZ C Y N 390 TYR OH O N N 391 TYR OXT O N N 392 TYR H H N N 393 TYR H2 H N N 394 TYR HA H N N 395 TYR HB2 H N N 396 TYR HB3 H N N 397 TYR HD1 H N N 398 TYR HD2 H N N 399 TYR HE1 H N N 400 TYR HE2 H N N 401 TYR HH H N N 402 TYR HXT H N N 403 VAL N N N N 404 VAL CA C N S 405 VAL C C N N 406 VAL O O N N 407 VAL CB C N N 408 VAL CG1 C N N 409 VAL CG2 C N N 410 VAL OXT O N N 411 VAL H H N N 412 VAL H2 H N N 413 VAL HA H N N 414 VAL HB H N N 415 VAL HG11 H N N 416 VAL HG12 H N N 417 VAL HG13 H N N 418 VAL HG21 H N N 419 VAL HG22 H N N 420 VAL HG23 H N N 421 VAL HXT H N N 422 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 990 O2 C1 doub N N 1 990 C19 C20 doub Y N 2 990 C19 C16 sing Y N 3 990 C20 C7 sing Y N 4 990 C1 N9 sing N N 5 990 C1 C3 sing N N 6 990 C11 C10 sing N N 7 990 N9 C6 sing N N 8 990 F17 C16 sing N N 9 990 C10 C3 doub Y N 10 990 C10 N12 sing Y N 11 990 C3 C4 sing Y N 12 990 C16 C18 doub Y N 13 990 C7 C6 sing N N 14 990 C7 C8 doub Y N 15 990 N12 C13 doub Y N 16 990 C4 C5 sing N N 17 990 C4 N15 doub Y N 18 990 C5 C6 sing N N 19 990 C13 N15 sing Y N 20 990 C13 N14 sing N N 21 990 C18 C8 sing Y N 22 990 C8 C21 sing N N 23 990 C21 N26 doub Y N 24 990 C21 C22 sing Y N 25 990 N26 C25 sing Y N 26 990 C22 C23 doub Y N 27 990 C28 O27 sing N N 28 990 C25 O27 sing N N 29 990 C25 C24 doub Y N 30 990 C23 C24 sing Y N 31 990 C18 H1 sing N N 32 990 C28 H2 sing N N 33 990 C28 H3 sing N N 34 990 C28 H4 sing N N 35 990 C24 H5 sing N N 36 990 C23 H6 sing N N 37 990 C22 H7 sing N N 38 990 C19 H8 sing N N 39 990 C20 H9 sing N N 40 990 C6 H10 sing N N 41 990 N9 H11 sing N N 42 990 C5 H12 sing N N 43 990 C5 H13 sing N N 44 990 N14 H14 sing N N 45 990 N14 H15 sing N N 46 990 C11 H16 sing N N 47 990 C11 H17 sing N N 48 990 C11 H18 sing N N 49 ALA N CA sing N N 50 ALA N H sing N N 51 ALA N H2 sing N N 52 ALA CA C sing N N 53 ALA CA CB sing N N 54 ALA CA HA sing N N 55 ALA C O doub N N 56 ALA C OXT sing N N 57 ALA CB HB1 sing N N 58 ALA CB HB2 sing N N 59 ALA CB HB3 sing N N 60 ALA OXT HXT sing N N 61 ARG N CA sing N N 62 ARG N H sing N N 63 ARG N H2 sing N N 64 ARG CA C sing N N 65 ARG CA CB sing N N 66 ARG CA HA sing N N 67 ARG C O doub N N 68 ARG C OXT sing N N 69 ARG CB CG sing N N 70 ARG CB HB2 sing N N 71 ARG CB HB3 sing N N 72 ARG CG CD sing N N 73 ARG CG HG2 sing N N 74 ARG CG HG3 sing N N 75 ARG CD NE sing N N 76 ARG CD HD2 sing N N 77 ARG CD HD3 sing N N 78 ARG NE CZ sing N N 79 ARG NE HE sing N N 80 ARG CZ NH1 sing N N 81 ARG CZ NH2 doub N N 82 ARG NH1 HH11 sing N N 83 ARG NH1 HH12 sing N N 84 ARG NH2 HH21 sing N N 85 ARG NH2 HH22 sing N N 86 ARG OXT HXT sing N N 87 ASN N CA sing N N 88 ASN N H sing N N 89 ASN N H2 sing N N 90 ASN CA C sing N N 91 ASN CA CB sing N N 92 ASN CA HA sing N N 93 ASN C O doub N N 94 ASN C OXT sing N N 95 ASN CB CG sing N N 96 ASN CB HB2 sing N N 97 ASN CB HB3 sing N N 98 ASN CG OD1 doub N N 99 ASN CG ND2 sing N N 100 ASN ND2 HD21 sing N N 101 ASN ND2 HD22 sing N N 102 ASN OXT HXT sing N N 103 ASP N CA sing N N 104 ASP N H sing N N 105 ASP N H2 sing N N 106 ASP CA C sing N N 107 ASP CA CB sing N N 108 ASP CA HA sing N N 109 ASP C O doub N N 110 ASP C OXT sing N N 111 ASP CB CG sing N N 112 ASP CB HB2 sing N N 113 ASP CB HB3 sing N N 114 ASP CG OD1 doub N N 115 ASP CG OD2 sing N N 116 ASP OD2 HD2 sing N N 117 ASP OXT HXT sing N N 118 GLN N CA sing N N 119 GLN N H sing N N 120 GLN N H2 sing N N 121 GLN CA C sing N N 122 GLN CA CB sing N N 123 GLN CA HA sing N N 124 GLN C O doub N N 125 GLN C OXT sing N N 126 GLN CB CG sing N N 127 GLN CB HB2 sing N N 128 GLN CB HB3 sing N N 129 GLN CG CD sing N N 130 GLN CG HG2 sing N N 131 GLN CG HG3 sing N N 132 GLN CD OE1 doub N N 133 GLN CD NE2 sing N N 134 GLN NE2 HE21 sing N N 135 GLN NE2 HE22 sing N N 136 GLN OXT HXT sing N N 137 GLU N CA sing N N 138 GLU N H sing N N 139 GLU N H2 sing N N 140 GLU CA C sing N N 141 GLU CA CB sing N N 142 GLU CA HA sing N N 143 GLU C O doub N N 144 GLU C OXT sing N N 145 GLU CB CG sing N N 146 GLU CB HB2 sing N N 147 GLU CB HB3 sing N N 148 GLU CG CD sing N N 149 GLU CG HG2 sing N N 150 GLU CG HG3 sing N N 151 GLU CD OE1 doub N N 152 GLU CD OE2 sing N N 153 GLU OE2 HE2 sing N N 154 GLU OXT HXT sing N N 155 GLY N CA sing N N 156 GLY N H sing N N 157 GLY N H2 sing N N 158 GLY CA C sing N N 159 GLY CA HA2 sing N N 160 GLY CA HA3 sing N N 161 GLY C O doub N N 162 GLY C OXT sing N N 163 GLY OXT HXT sing N N 164 HIS N CA sing N N 165 HIS N H sing N N 166 HIS N H2 sing N N 167 HIS CA C sing N N 168 HIS CA CB sing N N 169 HIS CA HA sing N N 170 HIS C O doub N N 171 HIS C OXT sing N N 172 HIS CB CG sing N N 173 HIS CB HB2 sing N N 174 HIS CB HB3 sing N N 175 HIS CG ND1 sing Y N 176 HIS CG CD2 doub Y N 177 HIS ND1 CE1 doub Y N 178 HIS ND1 HD1 sing N N 179 HIS CD2 NE2 sing Y N 180 HIS CD2 HD2 sing N N 181 HIS CE1 NE2 sing Y N 182 HIS CE1 HE1 sing N N 183 HIS NE2 HE2 sing N N 184 HIS OXT HXT sing N N 185 HOH O H1 sing N N 186 HOH O H2 sing N N 187 ILE N CA sing N N 188 ILE N H sing N N 189 ILE N H2 sing N N 190 ILE CA C sing N N 191 ILE CA CB sing N N 192 ILE CA HA sing N N 193 ILE C O doub N N 194 ILE C OXT sing N N 195 ILE CB CG1 sing N N 196 ILE CB CG2 sing N N 197 ILE CB HB sing N N 198 ILE CG1 CD1 sing N N 199 ILE CG1 HG12 sing N N 200 ILE CG1 HG13 sing N N 201 ILE CG2 HG21 sing N N 202 ILE CG2 HG22 sing N N 203 ILE CG2 HG23 sing N N 204 ILE CD1 HD11 sing N N 205 ILE CD1 HD12 sing N N 206 ILE CD1 HD13 sing N N 207 ILE OXT HXT sing N N 208 LEU N CA sing N N 209 LEU N H sing N N 210 LEU N H2 sing N N 211 LEU CA C sing N N 212 LEU CA CB sing N N 213 LEU CA HA sing N N 214 LEU C O doub N N 215 LEU C OXT sing N N 216 LEU CB CG sing N N 217 LEU CB HB2 sing N N 218 LEU CB HB3 sing N N 219 LEU CG CD1 sing N N 220 LEU CG CD2 sing N N 221 LEU CG HG sing N N 222 LEU CD1 HD11 sing N N 223 LEU CD1 HD12 sing N N 224 LEU CD1 HD13 sing N N 225 LEU CD2 HD21 sing N N 226 LEU CD2 HD22 sing N N 227 LEU CD2 HD23 sing N N 228 LEU OXT HXT sing N N 229 LYS N CA sing N N 230 LYS N H sing N N 231 LYS N H2 sing N N 232 LYS CA C sing N N 233 LYS CA CB sing N N 234 LYS CA HA sing N N 235 LYS C O doub N N 236 LYS C OXT sing N N 237 LYS CB CG sing N N 238 LYS CB HB2 sing N N 239 LYS CB HB3 sing N N 240 LYS CG CD sing N N 241 LYS CG HG2 sing N N 242 LYS CG HG3 sing N N 243 LYS CD CE sing N N 244 LYS CD HD2 sing N N 245 LYS CD HD3 sing N N 246 LYS CE NZ sing N N 247 LYS CE HE2 sing N N 248 LYS CE HE3 sing N N 249 LYS NZ HZ1 sing N N 250 LYS NZ HZ2 sing N N 251 LYS NZ HZ3 sing N N 252 LYS OXT HXT sing N N 253 MET N CA sing N N 254 MET N H sing N N 255 MET N H2 sing N N 256 MET CA C sing N N 257 MET CA CB sing N N 258 MET CA HA sing N N 259 MET C O doub N N 260 MET C OXT sing N N 261 MET CB CG sing N N 262 MET CB HB2 sing N N 263 MET CB HB3 sing N N 264 MET CG SD sing N N 265 MET CG HG2 sing N N 266 MET CG HG3 sing N N 267 MET SD CE sing N N 268 MET CE HE1 sing N N 269 MET CE HE2 sing N N 270 MET CE HE3 sing N N 271 MET OXT HXT sing N N 272 PHE N CA sing N N 273 PHE N H sing N N 274 PHE N H2 sing N N 275 PHE CA C sing N N 276 PHE CA CB sing N N 277 PHE CA HA sing N N 278 PHE C O doub N N 279 PHE C OXT sing N N 280 PHE CB CG sing N N 281 PHE CB HB2 sing N N 282 PHE CB HB3 sing N N 283 PHE CG CD1 doub Y N 284 PHE CG CD2 sing Y N 285 PHE CD1 CE1 sing Y N 286 PHE CD1 HD1 sing N N 287 PHE CD2 CE2 doub Y N 288 PHE CD2 HD2 sing N N 289 PHE CE1 CZ doub Y N 290 PHE CE1 HE1 sing N N 291 PHE CE2 CZ sing Y N 292 PHE CE2 HE2 sing N N 293 PHE CZ HZ sing N N 294 PHE OXT HXT sing N N 295 PRO N CA sing N N 296 PRO N CD sing N N 297 PRO N H sing N N 298 PRO CA C sing N N 299 PRO CA CB sing N N 300 PRO CA HA sing N N 301 PRO C O doub N N 302 PRO C OXT sing N N 303 PRO CB CG sing N N 304 PRO CB HB2 sing N N 305 PRO CB HB3 sing N N 306 PRO CG CD sing N N 307 PRO CG HG2 sing N N 308 PRO CG HG3 sing N N 309 PRO CD HD2 sing N N 310 PRO CD HD3 sing N N 311 PRO OXT HXT sing N N 312 SER N CA sing N N 313 SER N H sing N N 314 SER N H2 sing N N 315 SER CA C sing N N 316 SER CA CB sing N N 317 SER CA HA sing N N 318 SER C O doub N N 319 SER C OXT sing N N 320 SER CB OG sing N N 321 SER CB HB2 sing N N 322 SER CB HB3 sing N N 323 SER OG HG sing N N 324 SER OXT HXT sing N N 325 THR N CA sing N N 326 THR N H sing N N 327 THR N H2 sing N N 328 THR CA C sing N N 329 THR CA CB sing N N 330 THR CA HA sing N N 331 THR C O doub N N 332 THR C OXT sing N N 333 THR CB OG1 sing N N 334 THR CB CG2 sing N N 335 THR CB HB sing N N 336 THR OG1 HG1 sing N N 337 THR CG2 HG21 sing N N 338 THR CG2 HG22 sing N N 339 THR CG2 HG23 sing N N 340 THR OXT HXT sing N N 341 TRP N CA sing N N 342 TRP N H sing N N 343 TRP N H2 sing N N 344 TRP CA C sing N N 345 TRP CA CB sing N N 346 TRP CA HA sing N N 347 TRP C O doub N N 348 TRP C OXT sing N N 349 TRP CB CG sing N N 350 TRP CB HB2 sing N N 351 TRP CB HB3 sing N N 352 TRP CG CD1 doub Y N 353 TRP CG CD2 sing Y N 354 TRP CD1 NE1 sing Y N 355 TRP CD1 HD1 sing N N 356 TRP CD2 CE2 doub Y N 357 TRP CD2 CE3 sing Y N 358 TRP NE1 CE2 sing Y N 359 TRP NE1 HE1 sing N N 360 TRP CE2 CZ2 sing Y N 361 TRP CE3 CZ3 doub Y N 362 TRP CE3 HE3 sing N N 363 TRP CZ2 CH2 doub Y N 364 TRP CZ2 HZ2 sing N N 365 TRP CZ3 CH2 sing Y N 366 TRP CZ3 HZ3 sing N N 367 TRP CH2 HH2 sing N N 368 TRP OXT HXT sing N N 369 TYR N CA sing N N 370 TYR N H sing N N 371 TYR N H2 sing N N 372 TYR CA C sing N N 373 TYR CA CB sing N N 374 TYR CA HA sing N N 375 TYR C O doub N N 376 TYR C OXT sing N N 377 TYR CB CG sing N N 378 TYR CB HB2 sing N N 379 TYR CB HB3 sing N N 380 TYR CG CD1 doub Y N 381 TYR CG CD2 sing Y N 382 TYR CD1 CE1 sing Y N 383 TYR CD1 HD1 sing N N 384 TYR CD2 CE2 doub Y N 385 TYR CD2 HD2 sing N N 386 TYR CE1 CZ doub Y N 387 TYR CE1 HE1 sing N N 388 TYR CE2 CZ sing Y N 389 TYR CE2 HE2 sing N N 390 TYR CZ OH sing N N 391 TYR OH HH sing N N 392 TYR OXT HXT sing N N 393 VAL N CA sing N N 394 VAL N H sing N N 395 VAL N H2 sing N N 396 VAL CA C sing N N 397 VAL CA CB sing N N 398 VAL CA HA sing N N 399 VAL C O doub N N 400 VAL C OXT sing N N 401 VAL CB CG1 sing N N 402 VAL CB CG2 sing N N 403 VAL CB HB sing N N 404 VAL CG1 HG11 sing N N 405 VAL CG1 HG12 sing N N 406 VAL CG1 HG13 sing N N 407 VAL CG2 HG21 sing N N 408 VAL CG2 HG22 sing N N 409 VAL CG2 HG23 sing N N 410 VAL OXT HXT sing N N 411 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' T32GM148376-01A1 1 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' 1R35GM152079-01 2 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 6CJI _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'P 43 2 2' _space_group.name_Hall 'P 4cw 2c' _space_group.IT_number 95 _space_group.crystal_system tetragonal _space_group.id 1 # _atom_sites.entry_id 9MSQ _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.013558 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013558 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009345 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? F ? ? 8.95735 ? ? ? 7.27484 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? 0.51345 0.48472 ? ? 24.73122 6.32584 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ #