data_9N5S # _entry.id 9N5S # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.416 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9N5S pdb_00009n5s 10.2210/pdb9n5s/pdb WWPDB D_1000292603 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2026-07-29 ? 2 'Structure model' 1 1 2026-08-12 ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.pdbx_database_id_PubMed' 5 2 'Structure model' '_citation.title' 6 2 'Structure model' '_citation_author.identifier_ORCID' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9N5S _pdbx_database_status.recvd_initial_deposition_date 2025-02-04 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB . 9BWU unspecified PDB . 9N2U unspecified PDB . 9N33 unspecified PDB . 9N34 unspecified PDB . 9N53 unspecified PDB . 9N56 unspecified PDB . 9N57 unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email mirkin-Office@northwestern.edu _pdbx_contact_author.name_first Chad _pdbx_contact_author.name_last Mirkin _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-6634-7627 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Han, Z.' 1 0000-0003-3798-9345 'Mirkin, C.A.' 2 0000-0002-6634-7627 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Sci Adv' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2375-2548 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 12 _citation.language ? _citation.page_first eaeh2948 _citation.page_last eaeh2948 _citation.title 'Diffraction-quality, ultraflexible protein single crystals engineered with DNA.' _citation.year 2026 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1126/sciadv.aeh2948 _citation.pdbx_database_id_PubMed 42525757 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Han, Z.' 1 0000-0003-3798-9345 primary 'Mirkin, C.A.' 2 0000-0002-6634-7627 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Glutarate 2-hydroxylase' 37286.203 1 1.14.11.64 ? ? ? 2 non-polymer syn 'FE (II) ION' 55.845 1 ? ? ? ? 3 non-polymer nat 'SULFATE ION' 96.063 2 ? ? ? ? 4 water nat water 18.015 40 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name G-2-H # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MNALTAVHNNAVDSGQDYSGFTLTPSAQSPRLLELTFTEQTTKQFLEQVAEWPVQALEYKSFLRFRVGKILDDLCANQLQ PLLLKTLLNRAEGALLINAVGIDDVAQADEMVKLATAVAHLIGRSNFDAMSGQYYARFVVKNVDNSDSYLRQPHRVMELH NDGTYVEEITDYVLMMKIDEQNMQGGNSLLLHLDDWEHLDHYFRHPLARRPMRFAAPPSKNVSKDVFHPVFDVDQQGRPV MRYIDQFVQPKDFEEGVWLSELSDAIETSCGILSVPVPVGKFLLINNLFWLHGRDRFTPHPDLRRELMRQRGYFAYATHH HHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MNALTAVHNNAVDSGQDYSGFTLTPSAQSPRLLELTFTEQTTKQFLEQVAEWPVQALEYKSFLRFRVGKILDDLCANQLQ PLLLKTLLNRAEGALLINAVGIDDVAQADEMVKLATAVAHLIGRSNFDAMSGQYYARFVVKNVDNSDSYLRQPHRVMELH NDGTYVEEITDYVLMMKIDEQNMQGGNSLLLHLDDWEHLDHYFRHPLARRPMRFAAPPSKNVSKDVFHPVFDVDQQGRPV MRYIDQFVQPKDFEEGVWLSELSDAIETSCGILSVPVPVGKFLLINNLFWLHGRDRFTPHPDLRRELMRQRGYFAYATHH HHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'FE (II) ION' FE2 3 'SULFATE ION' SO4 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASN n 1 3 ALA n 1 4 LEU n 1 5 THR n 1 6 ALA n 1 7 VAL n 1 8 HIS n 1 9 ASN n 1 10 ASN n 1 11 ALA n 1 12 VAL n 1 13 ASP n 1 14 SER n 1 15 GLY n 1 16 GLN n 1 17 ASP n 1 18 TYR n 1 19 SER n 1 20 GLY n 1 21 PHE n 1 22 THR n 1 23 LEU n 1 24 THR n 1 25 PRO n 1 26 SER n 1 27 ALA n 1 28 GLN n 1 29 SER n 1 30 PRO n 1 31 ARG n 1 32 LEU n 1 33 LEU n 1 34 GLU n 1 35 LEU n 1 36 THR n 1 37 PHE n 1 38 THR n 1 39 GLU n 1 40 GLN n 1 41 THR n 1 42 THR n 1 43 LYS n 1 44 GLN n 1 45 PHE n 1 46 LEU n 1 47 GLU n 1 48 GLN n 1 49 VAL n 1 50 ALA n 1 51 GLU n 1 52 TRP n 1 53 PRO n 1 54 VAL n 1 55 GLN n 1 56 ALA n 1 57 LEU n 1 58 GLU n 1 59 TYR n 1 60 LYS n 1 61 SER n 1 62 PHE n 1 63 LEU n 1 64 ARG n 1 65 PHE n 1 66 ARG n 1 67 VAL n 1 68 GLY n 1 69 LYS n 1 70 ILE n 1 71 LEU n 1 72 ASP n 1 73 ASP n 1 74 LEU n 1 75 CYS n 1 76 ALA n 1 77 ASN n 1 78 GLN n 1 79 LEU n 1 80 GLN n 1 81 PRO n 1 82 LEU n 1 83 LEU n 1 84 LEU n 1 85 LYS n 1 86 THR n 1 87 LEU n 1 88 LEU n 1 89 ASN n 1 90 ARG n 1 91 ALA n 1 92 GLU n 1 93 GLY n 1 94 ALA n 1 95 LEU n 1 96 LEU n 1 97 ILE n 1 98 ASN n 1 99 ALA n 1 100 VAL n 1 101 GLY n 1 102 ILE n 1 103 ASP n 1 104 ASP n 1 105 VAL n 1 106 ALA n 1 107 GLN n 1 108 ALA n 1 109 ASP n 1 110 GLU n 1 111 MET n 1 112 VAL n 1 113 LYS n 1 114 LEU n 1 115 ALA n 1 116 THR n 1 117 ALA n 1 118 VAL n 1 119 ALA n 1 120 HIS n 1 121 LEU n 1 122 ILE n 1 123 GLY n 1 124 ARG n 1 125 SER n 1 126 ASN n 1 127 PHE n 1 128 ASP n 1 129 ALA n 1 130 MET n 1 131 SER n 1 132 GLY n 1 133 GLN n 1 134 TYR n 1 135 TYR n 1 136 ALA n 1 137 ARG n 1 138 PHE n 1 139 VAL n 1 140 VAL n 1 141 LYS n 1 142 ASN n 1 143 VAL n 1 144 ASP n 1 145 ASN n 1 146 SER n 1 147 ASP n 1 148 SER n 1 149 TYR n 1 150 LEU n 1 151 ARG n 1 152 GLN n 1 153 PRO n 1 154 HIS n 1 155 ARG n 1 156 VAL n 1 157 MET n 1 158 GLU n 1 159 LEU n 1 160 HIS n 1 161 ASN n 1 162 ASP n 1 163 GLY n 1 164 THR n 1 165 TYR n 1 166 VAL n 1 167 GLU n 1 168 GLU n 1 169 ILE n 1 170 THR n 1 171 ASP n 1 172 TYR n 1 173 VAL n 1 174 LEU n 1 175 MET n 1 176 MET n 1 177 LYS n 1 178 ILE n 1 179 ASP n 1 180 GLU n 1 181 GLN n 1 182 ASN n 1 183 MET n 1 184 GLN n 1 185 GLY n 1 186 GLY n 1 187 ASN n 1 188 SER n 1 189 LEU n 1 190 LEU n 1 191 LEU n 1 192 HIS n 1 193 LEU n 1 194 ASP n 1 195 ASP n 1 196 TRP n 1 197 GLU n 1 198 HIS n 1 199 LEU n 1 200 ASP n 1 201 HIS n 1 202 TYR n 1 203 PHE n 1 204 ARG n 1 205 HIS n 1 206 PRO n 1 207 LEU n 1 208 ALA n 1 209 ARG n 1 210 ARG n 1 211 PRO n 1 212 MET n 1 213 ARG n 1 214 PHE n 1 215 ALA n 1 216 ALA n 1 217 PRO n 1 218 PRO n 1 219 SER n 1 220 LYS n 1 221 ASN n 1 222 VAL n 1 223 SER n 1 224 LYS n 1 225 ASP n 1 226 VAL n 1 227 PHE n 1 228 HIS n 1 229 PRO n 1 230 VAL n 1 231 PHE n 1 232 ASP n 1 233 VAL n 1 234 ASP n 1 235 GLN n 1 236 GLN n 1 237 GLY n 1 238 ARG n 1 239 PRO n 1 240 VAL n 1 241 MET n 1 242 ARG n 1 243 TYR n 1 244 ILE n 1 245 ASP n 1 246 GLN n 1 247 PHE n 1 248 VAL n 1 249 GLN n 1 250 PRO n 1 251 LYS n 1 252 ASP n 1 253 PHE n 1 254 GLU n 1 255 GLU n 1 256 GLY n 1 257 VAL n 1 258 TRP n 1 259 LEU n 1 260 SER n 1 261 GLU n 1 262 LEU n 1 263 SER n 1 264 ASP n 1 265 ALA n 1 266 ILE n 1 267 GLU n 1 268 THR n 1 269 SER n 1 270 CYS n 1 271 GLY n 1 272 ILE n 1 273 LEU n 1 274 SER n 1 275 VAL n 1 276 PRO n 1 277 VAL n 1 278 PRO n 1 279 VAL n 1 280 GLY n 1 281 LYS n 1 282 PHE n 1 283 LEU n 1 284 LEU n 1 285 ILE n 1 286 ASN n 1 287 ASN n 1 288 LEU n 1 289 PHE n 1 290 TRP n 1 291 LEU n 1 292 HIS n 1 293 GLY n 1 294 ARG n 1 295 ASP n 1 296 ARG n 1 297 PHE n 1 298 THR n 1 299 PRO n 1 300 HIS n 1 301 PRO n 1 302 ASP n 1 303 LEU n 1 304 ARG n 1 305 ARG n 1 306 GLU n 1 307 LEU n 1 308 MET n 1 309 ARG n 1 310 GLN n 1 311 ARG n 1 312 GLY n 1 313 TYR n 1 314 PHE n 1 315 ALA n 1 316 TYR n 1 317 ALA n 1 318 THR n 1 319 HIS n 1 320 HIS n 1 321 HIS n 1 322 HIS n 1 323 HIS n 1 324 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 324 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'glaH, EcolC_1047' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FE2 non-polymer . 'FE (II) ION' ? 'Fe 2' 55.845 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ASN 2 2 ? ? ? A . n A 1 3 ALA 3 3 ? ? ? A . n A 1 4 LEU 4 4 ? ? ? A . n A 1 5 THR 5 5 ? ? ? A . n A 1 6 ALA 6 6 ? ? ? A . n A 1 7 VAL 7 7 ? ? ? A . n A 1 8 HIS 8 8 ? ? ? A . n A 1 9 ASN 9 9 ? ? ? A . n A 1 10 ASN 10 10 ? ? ? A . n A 1 11 ALA 11 11 ? ? ? A . n A 1 12 VAL 12 12 ? ? ? A . n A 1 13 ASP 13 13 ? ? ? A . n A 1 14 SER 14 14 ? ? ? A . n A 1 15 GLY 15 15 ? ? ? A . n A 1 16 GLN 16 16 16 GLN GLN A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 TYR 18 18 18 TYR TYR A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 PHE 21 21 21 PHE PHE A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 PRO 25 25 25 PRO PRO A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 PRO 30 30 30 PRO PRO A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 THR 36 36 36 THR THR A . n A 1 37 PHE 37 37 37 PHE PHE A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 GLN 40 40 40 GLN GLN A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 THR 42 42 42 THR THR A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 GLN 44 44 44 GLN GLN A . n A 1 45 PHE 45 45 45 PHE PHE A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 GLN 48 48 48 GLN GLN A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 TRP 52 52 52 TRP TRP A . n A 1 53 PRO 53 53 53 PRO PRO A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 TYR 59 59 59 TYR TYR A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 PHE 62 62 62 PHE PHE A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 ARG 64 64 64 ARG ARG A . n A 1 65 PHE 65 65 65 PHE PHE A . n A 1 66 ARG 66 66 66 ARG ARG A . n A 1 67 VAL 67 67 67 VAL VAL A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 ILE 70 70 70 ILE ILE A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 ASP 72 72 72 ASP ASP A . n A 1 73 ASP 73 73 73 ASP ASP A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 CYS 75 75 75 CYS CYS A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 ASN 77 77 77 ASN ASN A . n A 1 78 GLN 78 78 78 GLN GLN A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 GLN 80 80 80 GLN GLN A . n A 1 81 PRO 81 81 81 PRO PRO A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 THR 86 86 86 THR THR A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 ASN 89 89 89 ASN ASN A . n A 1 90 ARG 90 90 90 ARG ARG A . n A 1 91 ALA 91 91 91 ALA ALA A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 GLY 93 93 93 GLY GLY A . n A 1 94 ALA 94 94 94 ALA ALA A . n A 1 95 LEU 95 95 95 LEU LEU A . n A 1 96 LEU 96 96 96 LEU LEU A . n A 1 97 ILE 97 97 97 ILE ILE A . n A 1 98 ASN 98 98 98 ASN ASN A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 VAL 100 100 100 VAL VAL A . n A 1 101 GLY 101 101 101 GLY GLY A . n A 1 102 ILE 102 102 102 ILE ILE A . n A 1 103 ASP 103 103 103 ASP ASP A . n A 1 104 ASP 104 104 104 ASP ASP A . n A 1 105 VAL 105 105 105 VAL VAL A . n A 1 106 ALA 106 106 106 ALA ALA A . n A 1 107 GLN 107 107 107 GLN GLN A . n A 1 108 ALA 108 108 108 ALA ALA A . n A 1 109 ASP 109 109 109 ASP ASP A . n A 1 110 GLU 110 110 110 GLU GLU A . n A 1 111 MET 111 111 111 MET MET A . n A 1 112 VAL 112 112 112 VAL VAL A . n A 1 113 LYS 113 113 113 LYS LYS A . n A 1 114 LEU 114 114 114 LEU LEU A . n A 1 115 ALA 115 115 115 ALA ALA A . n A 1 116 THR 116 116 116 THR THR A . n A 1 117 ALA 117 117 117 ALA ALA A . n A 1 118 VAL 118 118 118 VAL VAL A . n A 1 119 ALA 119 119 119 ALA ALA A . n A 1 120 HIS 120 120 120 HIS HIS A . n A 1 121 LEU 121 121 121 LEU LEU A . n A 1 122 ILE 122 122 122 ILE ILE A . n A 1 123 GLY 123 123 123 GLY GLY A . n A 1 124 ARG 124 124 124 ARG ARG A . n A 1 125 SER 125 125 125 SER SER A . n A 1 126 ASN 126 126 126 ASN ASN A . n A 1 127 PHE 127 127 127 PHE PHE A . n A 1 128 ASP 128 128 128 ASP ASP A . n A 1 129 ALA 129 129 129 ALA ALA A . n A 1 130 MET 130 130 130 MET MET A . n A 1 131 SER 131 131 131 SER SER A . n A 1 132 GLY 132 132 132 GLY GLY A . n A 1 133 GLN 133 133 133 GLN GLN A . n A 1 134 TYR 134 134 134 TYR TYR A . n A 1 135 TYR 135 135 135 TYR TYR A . n A 1 136 ALA 136 136 136 ALA ALA A . n A 1 137 ARG 137 137 137 ARG ARG A . n A 1 138 PHE 138 138 138 PHE PHE A . n A 1 139 VAL 139 139 139 VAL VAL A . n A 1 140 VAL 140 140 140 VAL VAL A . n A 1 141 LYS 141 141 141 LYS LYS A . n A 1 142 ASN 142 142 142 ASN ASN A . n A 1 143 VAL 143 143 ? ? ? A . n A 1 144 ASP 144 144 ? ? ? A . n A 1 145 ASN 145 145 ? ? ? A . n A 1 146 SER 146 146 ? ? ? A . n A 1 147 ASP 147 147 ? ? ? A . n A 1 148 SER 148 148 ? ? ? A . n A 1 149 TYR 149 149 ? ? ? A . n A 1 150 LEU 150 150 ? ? ? A . n A 1 151 ARG 151 151 151 ARG ARG A . n A 1 152 GLN 152 152 152 GLN GLN A . n A 1 153 PRO 153 153 153 PRO PRO A . n A 1 154 HIS 154 154 154 HIS HIS A . n A 1 155 ARG 155 155 155 ARG ARG A . n A 1 156 VAL 156 156 156 VAL VAL A . n A 1 157 MET 157 157 157 MET MET A . n A 1 158 GLU 158 158 158 GLU GLU A . n A 1 159 LEU 159 159 159 LEU LEU A . n A 1 160 HIS 160 160 160 HIS HIS A . n A 1 161 ASN 161 161 161 ASN ASN A . n A 1 162 ASP 162 162 162 ASP ASP A . n A 1 163 GLY 163 163 163 GLY GLY A . n A 1 164 THR 164 164 164 THR THR A . n A 1 165 TYR 165 165 165 TYR TYR A . n A 1 166 VAL 166 166 166 VAL VAL A . n A 1 167 GLU 167 167 167 GLU GLU A . n A 1 168 GLU 168 168 168 GLU GLU A . n A 1 169 ILE 169 169 169 ILE ILE A . n A 1 170 THR 170 170 170 THR THR A . n A 1 171 ASP 171 171 171 ASP ASP A . n A 1 172 TYR 172 172 172 TYR TYR A . n A 1 173 VAL 173 173 173 VAL VAL A . n A 1 174 LEU 174 174 174 LEU LEU A . n A 1 175 MET 175 175 175 MET MET A . n A 1 176 MET 176 176 176 MET MET A . n A 1 177 LYS 177 177 177 LYS LYS A . n A 1 178 ILE 178 178 178 ILE ILE A . n A 1 179 ASP 179 179 179 ASP ASP A . n A 1 180 GLU 180 180 180 GLU GLU A . n A 1 181 GLN 181 181 181 GLN GLN A . n A 1 182 ASN 182 182 182 ASN ASN A . n A 1 183 MET 183 183 183 MET MET A . n A 1 184 GLN 184 184 184 GLN GLN A . n A 1 185 GLY 185 185 185 GLY GLY A . n A 1 186 GLY 186 186 186 GLY GLY A . n A 1 187 ASN 187 187 187 ASN ASN A . n A 1 188 SER 188 188 188 SER SER A . n A 1 189 LEU 189 189 189 LEU LEU A . n A 1 190 LEU 190 190 190 LEU LEU A . n A 1 191 LEU 191 191 191 LEU LEU A . n A 1 192 HIS 192 192 192 HIS HIS A . n A 1 193 LEU 193 193 193 LEU LEU A . n A 1 194 ASP 194 194 194 ASP ASP A . n A 1 195 ASP 195 195 195 ASP ASP A . n A 1 196 TRP 196 196 196 TRP TRP A . n A 1 197 GLU 197 197 197 GLU GLU A . n A 1 198 HIS 198 198 198 HIS HIS A . n A 1 199 LEU 199 199 199 LEU LEU A . n A 1 200 ASP 200 200 200 ASP ASP A . n A 1 201 HIS 201 201 201 HIS HIS A . n A 1 202 TYR 202 202 202 TYR TYR A . n A 1 203 PHE 203 203 203 PHE PHE A . n A 1 204 ARG 204 204 204 ARG ARG A . n A 1 205 HIS 205 205 205 HIS HIS A . n A 1 206 PRO 206 206 206 PRO PRO A . n A 1 207 LEU 207 207 207 LEU LEU A . n A 1 208 ALA 208 208 208 ALA ALA A . n A 1 209 ARG 209 209 209 ARG ARG A . n A 1 210 ARG 210 210 210 ARG ARG A . n A 1 211 PRO 211 211 211 PRO PRO A . n A 1 212 MET 212 212 212 MET MET A . n A 1 213 ARG 213 213 213 ARG ARG A . n A 1 214 PHE 214 214 214 PHE PHE A . n A 1 215 ALA 215 215 215 ALA ALA A . n A 1 216 ALA 216 216 216 ALA ALA A . n A 1 217 PRO 217 217 217 PRO PRO A . n A 1 218 PRO 218 218 218 PRO PRO A . n A 1 219 SER 219 219 ? ? ? A . n A 1 220 LYS 220 220 ? ? ? A . n A 1 221 ASN 221 221 ? ? ? A . n A 1 222 VAL 222 222 ? ? ? A . n A 1 223 SER 223 223 ? ? ? A . n A 1 224 LYS 224 224 224 LYS LYS A . n A 1 225 ASP 225 225 225 ASP ASP A . n A 1 226 VAL 226 226 226 VAL VAL A . n A 1 227 PHE 227 227 227 PHE PHE A . n A 1 228 HIS 228 228 228 HIS HIS A . n A 1 229 PRO 229 229 229 PRO PRO A . n A 1 230 VAL 230 230 230 VAL VAL A . n A 1 231 PHE 231 231 231 PHE PHE A . n A 1 232 ASP 232 232 232 ASP ASP A . n A 1 233 VAL 233 233 233 VAL VAL A . n A 1 234 ASP 234 234 234 ASP ASP A . n A 1 235 GLN 235 235 235 GLN GLN A . n A 1 236 GLN 236 236 236 GLN GLN A . n A 1 237 GLY 237 237 237 GLY GLY A . n A 1 238 ARG 238 238 238 ARG ARG A . n A 1 239 PRO 239 239 239 PRO PRO A . n A 1 240 VAL 240 240 240 VAL VAL A . n A 1 241 MET 241 241 241 MET MET A . n A 1 242 ARG 242 242 242 ARG ARG A . n A 1 243 TYR 243 243 243 TYR TYR A . n A 1 244 ILE 244 244 244 ILE ILE A . n A 1 245 ASP 245 245 245 ASP ASP A . n A 1 246 GLN 246 246 246 GLN GLN A . n A 1 247 PHE 247 247 247 PHE PHE A . n A 1 248 VAL 248 248 248 VAL VAL A . n A 1 249 GLN 249 249 249 GLN GLN A . n A 1 250 PRO 250 250 250 PRO PRO A . n A 1 251 LYS 251 251 251 LYS LYS A . n A 1 252 ASP 252 252 252 ASP ASP A . n A 1 253 PHE 253 253 253 PHE PHE A . n A 1 254 GLU 254 254 254 GLU GLU A . n A 1 255 GLU 255 255 255 GLU GLU A . n A 1 256 GLY 256 256 256 GLY GLY A . n A 1 257 VAL 257 257 257 VAL VAL A . n A 1 258 TRP 258 258 258 TRP TRP A . n A 1 259 LEU 259 259 259 LEU LEU A . n A 1 260 SER 260 260 260 SER SER A . n A 1 261 GLU 261 261 261 GLU GLU A . n A 1 262 LEU 262 262 262 LEU LEU A . n A 1 263 SER 263 263 263 SER SER A . n A 1 264 ASP 264 264 264 ASP ASP A . n A 1 265 ALA 265 265 265 ALA ALA A . n A 1 266 ILE 266 266 266 ILE ILE A . n A 1 267 GLU 267 267 267 GLU GLU A . n A 1 268 THR 268 268 268 THR THR A . n A 1 269 SER 269 269 269 SER SER A . n A 1 270 CYS 270 270 270 CYS CYS A . n A 1 271 GLY 271 271 271 GLY GLY A . n A 1 272 ILE 272 272 272 ILE ILE A . n A 1 273 LEU 273 273 273 LEU LEU A . n A 1 274 SER 274 274 274 SER SER A . n A 1 275 VAL 275 275 275 VAL VAL A . n A 1 276 PRO 276 276 276 PRO PRO A . n A 1 277 VAL 277 277 277 VAL VAL A . n A 1 278 PRO 278 278 278 PRO PRO A . n A 1 279 VAL 279 279 279 VAL VAL A . n A 1 280 GLY 280 280 280 GLY GLY A . n A 1 281 LYS 281 281 281 LYS LYS A . n A 1 282 PHE 282 282 282 PHE PHE A . n A 1 283 LEU 283 283 283 LEU LEU A . n A 1 284 LEU 284 284 284 LEU LEU A . n A 1 285 ILE 285 285 285 ILE ILE A . n A 1 286 ASN 286 286 286 ASN ASN A . n A 1 287 ASN 287 287 287 ASN ASN A . n A 1 288 LEU 288 288 288 LEU LEU A . n A 1 289 PHE 289 289 289 PHE PHE A . n A 1 290 TRP 290 290 290 TRP TRP A . n A 1 291 LEU 291 291 291 LEU LEU A . n A 1 292 HIS 292 292 292 HIS HIS A . n A 1 293 GLY 293 293 293 GLY GLY A . n A 1 294 ARG 294 294 294 ARG ARG A . n A 1 295 ASP 295 295 295 ASP ASP A . n A 1 296 ARG 296 296 296 ARG ARG A . n A 1 297 PHE 297 297 297 PHE PHE A . n A 1 298 THR 298 298 298 THR THR A . n A 1 299 PRO 299 299 299 PRO PRO A . n A 1 300 HIS 300 300 300 HIS HIS A . n A 1 301 PRO 301 301 301 PRO PRO A . n A 1 302 ASP 302 302 302 ASP ASP A . n A 1 303 LEU 303 303 303 LEU LEU A . n A 1 304 ARG 304 304 304 ARG ARG A . n A 1 305 ARG 305 305 305 ARG ARG A . n A 1 306 GLU 306 306 306 GLU GLU A . n A 1 307 LEU 307 307 307 LEU LEU A . n A 1 308 MET 308 308 308 MET MET A . n A 1 309 ARG 309 309 309 ARG ARG A . n A 1 310 GLN 310 310 310 GLN GLN A . n A 1 311 ARG 311 311 311 ARG ARG A . n A 1 312 GLY 312 312 312 GLY GLY A . n A 1 313 TYR 313 313 313 TYR TYR A . n A 1 314 PHE 314 314 314 PHE PHE A . n A 1 315 ALA 315 315 315 ALA ALA A . n A 1 316 TYR 316 316 316 TYR TYR A . n A 1 317 ALA 317 317 317 ALA ALA A . n A 1 318 THR 318 318 ? ? ? A . n A 1 319 HIS 319 319 ? ? ? A . n A 1 320 HIS 320 320 ? ? ? A . n A 1 321 HIS 321 321 ? ? ? A . n A 1 322 HIS 322 322 ? ? ? A . n A 1 323 HIS 323 323 ? ? ? A . n A 1 324 HIS 324 324 ? ? ? A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id FE2 _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id FE2 _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 FE2 1 401 401 FE2 FE2 A . C 3 SO4 1 402 402 SO4 SO4 A . D 3 SO4 1 403 403 SO4 SO4 A . E 4 HOH 1 501 501 HOH HOH A . E 4 HOH 2 502 503 HOH HOH A . E 4 HOH 3 503 502 HOH HOH A . E 4 HOH 4 504 511 HOH HOH A . E 4 HOH 5 505 510 HOH HOH A . E 4 HOH 6 506 504 HOH HOH A . E 4 HOH 7 507 506 HOH HOH A . E 4 HOH 8 508 507 HOH HOH A . E 4 HOH 9 509 516 HOH HOH A . E 4 HOH 10 510 515 HOH HOH A . E 4 HOH 11 511 512 HOH HOH A . E 4 HOH 12 512 505 HOH HOH A . E 4 HOH 13 513 509 HOH HOH A . E 4 HOH 14 514 508 HOH HOH A . E 4 HOH 15 515 521 HOH HOH A . E 4 HOH 16 516 513 HOH HOH A . E 4 HOH 17 517 514 HOH HOH A . E 4 HOH 18 518 520 HOH HOH A . E 4 HOH 19 519 517 HOH HOH A . E 4 HOH 20 520 524 HOH HOH A . E 4 HOH 21 521 519 HOH HOH A . E 4 HOH 22 522 518 HOH HOH A . E 4 HOH 23 523 522 HOH HOH A . E 4 HOH 24 524 523 HOH HOH A . E 4 HOH 25 525 525 HOH HOH A . E 4 HOH 26 526 538 HOH HOH A . E 4 HOH 27 527 528 HOH HOH A . E 4 HOH 28 528 527 HOH HOH A . E 4 HOH 29 529 529 HOH HOH A . E 4 HOH 30 530 530 HOH HOH A . E 4 HOH 31 531 526 HOH HOH A . E 4 HOH 32 532 531 HOH HOH A . E 4 HOH 33 533 532 HOH HOH A . E 4 HOH 34 534 535 HOH HOH A . E 4 HOH 35 535 536 HOH HOH A . E 4 HOH 36 536 533 HOH HOH A . E 4 HOH 37 537 534 HOH HOH A . E 4 HOH 38 538 537 HOH HOH A . E 4 HOH 39 539 539 HOH HOH A . E 4 HOH 40 540 540 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0430 1 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? 0.9.8.92 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? DIALS ? ? ? 3.17.0 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.7.15 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 2.8.3 5 # _cell.angle_alpha 90 _cell.angle_alpha_esd ? _cell.angle_beta 90 _cell.angle_beta_esd ? _cell.angle_gamma 90 _cell.angle_gamma_esd ? _cell.entry_id 9N5S _cell.details ? _cell.formula_units_Z ? _cell.length_a 122.525 _cell.length_a_esd ? _cell.length_b 122.525 _cell.length_b_esd ? _cell.length_c 136.661 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 16 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9N5S _symmetry.cell_setting ? _symmetry.Int_Tables_number 97 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 4 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9N5S _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.44 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 64.23 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '20 % v/v Glycerol, 5 % w/v PEG 3350, 0.05 M Bis-Tris pH 7, 1 M Ammonium sulfate' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 295 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER2 XE 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2023-12-08 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.976284 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I03' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.976284 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I03 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 9N5S _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.73 _reflns.d_resolution_low 53.65 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 14176 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.0 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 26.7 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 7.4 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.97 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.395 _reflns.pdbx_Rpim_I_all 0.105 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.995 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.381 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.percent_possible_all _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 9.05 53.65 ? 18.1 ? ? ? ? 452 ? ? ? ? ? ? ? ? ? ? ? 23.6 0.40 ? ? 0.090 0.024 ? 1 ? 0.998 ? ? 99.7 ? 0.087 ? ? ? ? ? ? ? ? ? 2.73 2.86 ? 1.7 ? ? ? ? 1846 ? ? ? ? ? ? ? ? ? ? ? 27.6 0.97 ? ? 2.764 0.726 ? 2 ? 0.865 ? ? 100.0 ? 2.667 ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] 3.040 _refine.aniso_B[1][2] -0.000 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][2] 3.040 _refine.aniso_B[2][3] -0.000 _refine.aniso_B[3][3] -6.080 _refine.B_iso_max ? _refine.B_iso_mean 58.770 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.956 _refine.correlation_coeff_Fo_to_Fc_free 0.930 _refine.details 'Hydrogens have not been used' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9N5S _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.730 _refine.ls_d_res_low 50.911 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 14147 _refine.ls_number_reflns_R_free 674 _refine.ls_number_reflns_R_work 13473 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.767 _refine.ls_percent_reflns_R_free 4.764 _refine.ls_R_factor_all 0.188 _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.2197 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1865 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'MASK BULK SOLVENT' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.410 _refine.pdbx_overall_ESU_R_Free 0.258 _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.730 _refine_hist.d_res_low 50.911 _refine_hist.number_atoms_solvent 40 _refine_hist.number_atoms_total 2408 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2357 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 11 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.011 0.012 2426 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 1.861 1.831 3285 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 6.615 5.000 286 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 20.006 5.000 20 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 15.443 10.000 407 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 14.506 10.000 127 ? r_dihedral_angle_6_deg ? ? 'X-RAY DIFFRACTION' ? 0.118 0.200 355 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.008 0.020 1875 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.219 0.200 997 ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.314 0.200 1618 ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? 0.167 0.200 74 ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.227 0.200 37 ? r_symmetry_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.081 0.200 9 ? r_symmetry_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 6.032 5.679 1153 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 8.888 10.162 1436 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 7.134 5.998 1273 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 9.918 10.820 1849 ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 12.189 59.345 3490 ? r_lrange_it ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.730 2.801 1023 . 38 979 99.4135 . 0.302 . . 0.301 . . . . . 0.288 . 20 . 0.927 0.907 0.339 'X-RAY DIFFRACTION' 2.801 2.877 992 . 48 938 99.3952 . 0.275 . . 0.273 . . . . . 0.257 . 20 . 0.943 0.924 0.308 'X-RAY DIFFRACTION' 2.877 2.960 988 . 35 949 99.5951 . 0.269 . . 0.268 . . . . . 0.250 . 20 . 0.948 0.932 0.299 'X-RAY DIFFRACTION' 2.960 3.051 946 . 48 897 99.8943 . 0.270 . . 0.269 . . . . . 0.247 . 20 . 0.951 0.938 0.288 'X-RAY DIFFRACTION' 3.051 3.151 914 . 42 870 99.7812 . 0.233 . . 0.231 . . . . . 0.209 . 20 . 0.963 0.951 0.277 'X-RAY DIFFRACTION' 3.151 3.261 891 . 54 836 99.8878 . 0.214 . . 0.211 . . . . . 0.187 . 20 . 0.969 0.959 0.248 'X-RAY DIFFRACTION' 3.261 3.384 846 . 44 800 99.7636 . 0.201 . . 0.198 . . . . . 0.176 . 20 . 0.974 0.948 0.270 'X-RAY DIFFRACTION' 3.384 3.521 839 . 34 804 99.8808 . 0.181 . . 0.179 . . . . . 0.155 . 20 . 0.980 0.970 0.237 'X-RAY DIFFRACTION' 3.521 3.677 806 . 44 760 99.7519 . 0.178 . . 0.178 . . . . . 0.158 . 20 . 0.981 0.972 0.184 'X-RAY DIFFRACTION' 3.677 3.855 755 . 40 715 100.0000 . 0.170 . . 0.168 . . . . . 0.151 . 20 . 0.981 0.975 0.186 'X-RAY DIFFRACTION' 3.855 4.063 733 . 37 696 100.0000 . 0.160 . . 0.159 . . . . . 0.147 . 20 . 0.984 0.981 0.176 'X-RAY DIFFRACTION' 4.063 4.307 684 . 40 644 100.0000 . 0.161 . . 0.156 . . . . . 0.145 . 20 . 0.985 0.964 0.256 'X-RAY DIFFRACTION' 4.307 4.602 665 . 32 633 100.0000 . 0.143 . . 0.142 . . . . . 0.138 . 20 . 0.988 0.981 0.170 'X-RAY DIFFRACTION' 4.602 4.968 609 . 28 581 100.0000 . 0.144 . . 0.143 . . . . . 0.134 . 20 . 0.988 0.982 0.184 'X-RAY DIFFRACTION' 4.968 5.437 567 . 27 540 100.0000 . 0.152 . . 0.152 . . . . . 0.147 . 20 . 0.988 0.990 0.152 'X-RAY DIFFRACTION' 5.437 6.070 516 . 21 492 99.4186 . 0.191 . . 0.192 . . . . . 0.183 . 20 . 0.982 0.984 0.165 'X-RAY DIFFRACTION' 6.070 6.992 464 . 19 445 100.0000 . 0.216 . . 0.213 . . . . . 0.203 . 20 . 0.977 0.979 0.288 'X-RAY DIFFRACTION' 6.992 8.524 407 . 17 390 100.0000 . 0.168 . . 0.171 . . . . . 0.174 . 20 . 0.984 0.994 0.114 'X-RAY DIFFRACTION' 8.524 11.889 318 . 8 310 100.0000 . 0.137 . . 0.137 . . . . . 0.143 . 20 . 0.989 0.995 0.115 'X-RAY DIFFRACTION' 11.889 50.911 212 . 18 194 100.0000 . 0.258 . . 0.249 . . . . . 0.253 . 20 . 0.956 0.884 0.392 # _struct.entry_id 9N5S _struct.title ;Glutarate L-2-hydroxylase K270C mutant-5'-Mal-C2-GC DNA conjugate ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9N5S _struct_keywords.text 'Oxygenase, Hydroxylase, Metal binding, METAL BINDING PROTEIN' _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code GLAH_ECOLC _struct_ref.pdbx_db_accession B1IVJ9 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MNALTAVHNNAVDSGQDYSGFTLIPSAQSPRLLELTFTEQTTKQFLEQVAEWPVQALEYKSFLRFRVGKILDDLCANQLQ PLLLKTLLNRAEGALLINAVGIDDVAQADEMVKLATAVAHLIGRSNFDAMSGQYYARFVVKNVDNSDSYLRQPHRVMELH NDGTYVEEITDYVLMMKIDEQNMQGGNSLLLHLDDWEHLDHYFRHPLARRPMRFAAPPSKNVSKDVFHPVFDVDQQGRPV MRYIDQFVQPKDFEEGVWLSELSDAIETSKGILSVPVPVGKFLLINNLFWLHGRDRFTPHPDLRRELMRQRGYFAYATHH ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9N5S _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 320 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession B1IVJ9 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 320 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 320 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9N5S THR A 24 ? UNP B1IVJ9 ILE 24 conflict 24 1 1 9N5S CYS A 270 ? UNP B1IVJ9 LYS 270 'engineered mutation' 270 2 1 9N5S HIS A 321 ? UNP B1IVJ9 ? ? 'expression tag' 321 3 1 9N5S HIS A 322 ? UNP B1IVJ9 ? ? 'expression tag' 322 4 1 9N5S HIS A 323 ? UNP B1IVJ9 ? ? 'expression tag' 323 5 1 9N5S HIS A 324 ? UNP B1IVJ9 ? ? 'expression tag' 324 6 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details octameric _pdbx_struct_assembly.oligomeric_count 8 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4,5,6,7,8 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_555 -x,-y,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_555 -y,x,z 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 4 'crystal symmetry operation' 4_555 y,-x,z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 5 'crystal symmetry operation' 5_555 -x,y,-z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 6 'crystal symmetry operation' 6_555 x,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 7 'crystal symmetry operation' 7_555 y,x,-z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 8 'crystal symmetry operation' 8_555 -y,-x,-z 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 38 ? ALA A 50 ? THR A 38 ALA A 50 1 ? 13 HELX_P HELX_P2 AA2 PRO A 53 ? LYS A 60 ? PRO A 53 LYS A 60 1 ? 8 HELX_P HELX_P3 AA3 SER A 61 ? LEU A 74 ? SER A 61 LEU A 74 1 ? 14 HELX_P HELX_P4 AA4 GLN A 78 ? ASN A 89 ? GLN A 78 ASN A 89 1 ? 12 HELX_P HELX_P5 AA5 ASP A 104 ? ALA A 106 ? ASP A 104 ALA A 106 5 ? 3 HELX_P HELX_P6 AA6 GLN A 107 ? ILE A 122 ? GLN A 107 ILE A 122 1 ? 16 HELX_P HELX_P7 AA7 ASP A 194 ? TRP A 196 ? ASP A 194 TRP A 196 5 ? 3 HELX_P HELX_P8 AA8 HIS A 198 ? ARG A 204 ? HIS A 198 ARG A 204 1 ? 7 HELX_P HELX_P9 AA9 HIS A 205 ? ARG A 209 ? HIS A 205 ARG A 209 5 ? 5 HELX_P HELX_P10 AB1 ASP A 252 ? THR A 268 ? ASP A 252 THR A 268 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 160 NE2 ? ? ? 1_555 B FE2 . FE ? ? A HIS 160 A FE2 401 1_555 ? ? ? ? ? ? ? 2.088 ? ? metalc2 metalc ? ? A ASP 162 OD1 ? ? ? 1_555 B FE2 . FE ? ? A ASP 162 A FE2 401 1_555 ? ? ? ? ? ? ? 1.987 ? ? metalc3 metalc ? ? A HIS 292 NE2 ? ? ? 1_555 B FE2 . FE ? ? A HIS 292 A FE2 401 1_555 ? ? ? ? ? ? ? 2.097 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 160 ? A HIS 160 ? 1_555 FE ? B FE2 . ? A FE2 401 ? 1_555 OD1 ? A ASP 162 ? A ASP 162 ? 1_555 86.5 ? 2 NE2 ? A HIS 160 ? A HIS 160 ? 1_555 FE ? B FE2 . ? A FE2 401 ? 1_555 NE2 ? A HIS 292 ? A HIS 292 ? 1_555 86.9 ? 3 OD1 ? A ASP 162 ? A ASP 162 ? 1_555 FE ? B FE2 . ? A FE2 401 ? 1_555 NE2 ? A HIS 292 ? A HIS 292 ? 1_555 85.9 ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 7 ? AA2 ? 7 ? AA3 ? 4 ? AA4 ? 3 ? AA5 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel AA2 6 7 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA4 1 2 ? anti-parallel AA4 2 3 ? anti-parallel AA5 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 21 ? PRO A 25 ? PHE A 21 PRO A 25 AA1 2 LEU A 32 ? PHE A 37 ? LEU A 32 PHE A 37 AA1 3 ALA A 94 ? ALA A 99 ? ALA A 94 ALA A 99 AA1 4 LYS A 281 ? ASN A 286 ? LYS A 281 ASN A 286 AA1 5 TYR A 172 ? GLN A 181 ? TYR A 172 GLN A 181 AA1 6 ARG A 304 ? PHE A 314 ? ARG A 304 PHE A 314 AA1 7 GLY A 123 ? SER A 125 ? GLY A 123 SER A 125 AA2 1 PHE A 21 ? PRO A 25 ? PHE A 21 PRO A 25 AA2 2 LEU A 32 ? PHE A 37 ? LEU A 32 PHE A 37 AA2 3 ALA A 94 ? ALA A 99 ? ALA A 94 ALA A 99 AA2 4 LYS A 281 ? ASN A 286 ? LYS A 281 ASN A 286 AA2 5 TYR A 172 ? GLN A 181 ? TYR A 172 GLN A 181 AA2 6 ARG A 304 ? PHE A 314 ? ARG A 304 PHE A 314 AA2 7 ALA A 136 ? VAL A 140 ? ALA A 136 VAL A 140 AA3 1 MET A 157 ? HIS A 160 ? MET A 157 HIS A 160 AA3 2 TRP A 290 ? ARG A 294 ? TRP A 290 ARG A 294 AA3 3 SER A 188 ? HIS A 192 ? SER A 188 HIS A 192 AA3 4 LEU A 273 ? VAL A 275 ? LEU A 273 VAL A 275 AA4 1 VAL A 226 ? PHE A 227 ? VAL A 226 PHE A 227 AA4 2 ARG A 213 ? PHE A 214 ? ARG A 213 PHE A 214 AA4 3 VAL A 248 ? GLN A 249 ? VAL A 248 GLN A 249 AA5 1 PHE A 231 ? VAL A 233 ? PHE A 231 VAL A 233 AA5 2 PRO A 239 ? MET A 241 ? PRO A 239 MET A 241 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N THR A 24 ? N THR A 24 O GLU A 34 ? O GLU A 34 AA1 2 3 N LEU A 33 ? N LEU A 33 O LEU A 96 ? O LEU A 96 AA1 3 4 N ILE A 97 ? N ILE A 97 O PHE A 282 ? O PHE A 282 AA1 4 5 O LYS A 281 ? O LYS A 281 N LYS A 177 ? N LYS A 177 AA1 5 6 N LEU A 174 ? N LEU A 174 O GLN A 310 ? O GLN A 310 AA1 6 7 O TYR A 313 ? O TYR A 313 N ARG A 124 ? N ARG A 124 AA2 1 2 N THR A 24 ? N THR A 24 O GLU A 34 ? O GLU A 34 AA2 2 3 N LEU A 33 ? N LEU A 33 O LEU A 96 ? O LEU A 96 AA2 3 4 N ILE A 97 ? N ILE A 97 O PHE A 282 ? O PHE A 282 AA2 4 5 O LYS A 281 ? O LYS A 281 N LYS A 177 ? N LYS A 177 AA2 5 6 N LEU A 174 ? N LEU A 174 O GLN A 310 ? O GLN A 310 AA2 6 7 O ARG A 305 ? O ARG A 305 N VAL A 140 ? N VAL A 140 AA3 1 2 N HIS A 160 ? N HIS A 160 O HIS A 292 ? O HIS A 292 AA3 2 3 O GLY A 293 ? O GLY A 293 N LEU A 189 ? N LEU A 189 AA3 3 4 N SER A 188 ? N SER A 188 O VAL A 275 ? O VAL A 275 AA4 1 2 O VAL A 226 ? O VAL A 226 N PHE A 214 ? N PHE A 214 AA4 2 3 N ARG A 213 ? N ARG A 213 O GLN A 249 ? O GLN A 249 AA5 1 2 N ASP A 232 ? N ASP A 232 O VAL A 240 ? O VAL A 240 # _pdbx_entry_details.entry_id 9N5S _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 92 ? ? -115.01 -101.76 2 1 ASP A 103 ? ? -149.88 16.12 3 1 PRO A 211 ? ? -43.26 -96.17 4 1 MET A 212 ? ? 100.57 135.98 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 31 ? ? 0.095 'SIDE CHAIN' 2 1 ARG A 204 ? ? 0.121 'SIDE CHAIN' 3 1 ARG A 209 ? ? 0.206 'SIDE CHAIN' 4 1 ARG A 210 ? ? 0.138 'SIDE CHAIN' 5 1 ARG A 238 ? ? 0.091 'SIDE CHAIN' 6 1 ARG A 294 ? ? 0.098 'SIDE CHAIN' 7 1 ARG A 309 ? ? 0.137 'SIDE CHAIN' 8 1 ARG A 311 ? ? 0.268 'SIDE CHAIN' # _pdbx_distant_solvent_atoms.id 1 _pdbx_distant_solvent_atoms.PDB_model_num 1 _pdbx_distant_solvent_atoms.auth_atom_id O _pdbx_distant_solvent_atoms.label_alt_id ? _pdbx_distant_solvent_atoms.auth_asym_id A _pdbx_distant_solvent_atoms.auth_comp_id HOH _pdbx_distant_solvent_atoms.auth_seq_id 540 _pdbx_distant_solvent_atoms.PDB_ins_code ? _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 6.56 _pdbx_distant_solvent_atoms.neighbor_ligand_distance . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ASN 2 ? A ASN 2 3 1 Y 1 A ALA 3 ? A ALA 3 4 1 Y 1 A LEU 4 ? A LEU 4 5 1 Y 1 A THR 5 ? A THR 5 6 1 Y 1 A ALA 6 ? A ALA 6 7 1 Y 1 A VAL 7 ? A VAL 7 8 1 Y 1 A HIS 8 ? A HIS 8 9 1 Y 1 A ASN 9 ? A ASN 9 10 1 Y 1 A ASN 10 ? A ASN 10 11 1 Y 1 A ALA 11 ? A ALA 11 12 1 Y 1 A VAL 12 ? A VAL 12 13 1 Y 1 A ASP 13 ? A ASP 13 14 1 Y 1 A SER 14 ? A SER 14 15 1 Y 1 A GLY 15 ? A GLY 15 16 1 Y 1 A VAL 143 ? A VAL 143 17 1 Y 1 A ASP 144 ? A ASP 144 18 1 Y 1 A ASN 145 ? A ASN 145 19 1 Y 1 A SER 146 ? A SER 146 20 1 Y 1 A ASP 147 ? A ASP 147 21 1 Y 1 A SER 148 ? A SER 148 22 1 Y 1 A TYR 149 ? A TYR 149 23 1 Y 1 A LEU 150 ? A LEU 150 24 1 Y 1 A SER 219 ? A SER 219 25 1 Y 1 A LYS 220 ? A LYS 220 26 1 Y 1 A ASN 221 ? A ASN 221 27 1 Y 1 A VAL 222 ? A VAL 222 28 1 Y 1 A SER 223 ? A SER 223 29 1 Y 1 A THR 318 ? A THR 318 30 1 Y 1 A HIS 319 ? A HIS 319 31 1 Y 1 A HIS 320 ? A HIS 320 32 1 Y 1 A HIS 321 ? A HIS 321 33 1 Y 1 A HIS 322 ? A HIS 322 34 1 Y 1 A HIS 323 ? A HIS 323 35 1 Y 1 A HIS 324 ? A HIS 324 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 FE2 FE FE N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 HIS N N N N 138 HIS CA C N S 139 HIS C C N N 140 HIS O O N N 141 HIS CB C N N 142 HIS CG C Y N 143 HIS ND1 N Y N 144 HIS CD2 C Y N 145 HIS CE1 C Y N 146 HIS NE2 N Y N 147 HIS OXT O N N 148 HIS H H N N 149 HIS H2 H N N 150 HIS HA H N N 151 HIS HB2 H N N 152 HIS HB3 H N N 153 HIS HD1 H N N 154 HIS HD2 H N N 155 HIS HE1 H N N 156 HIS HE2 H N N 157 HIS HXT H N N 158 HOH O O N N 159 HOH H1 H N N 160 HOH H2 H N N 161 ILE N N N N 162 ILE CA C N S 163 ILE C C N N 164 ILE O O N N 165 ILE CB C N S 166 ILE CG1 C N N 167 ILE CG2 C N N 168 ILE CD1 C N N 169 ILE OXT O N N 170 ILE H H N N 171 ILE H2 H N N 172 ILE HA H N N 173 ILE HB H N N 174 ILE HG12 H N N 175 ILE HG13 H N N 176 ILE HG21 H N N 177 ILE HG22 H N N 178 ILE HG23 H N N 179 ILE HD11 H N N 180 ILE HD12 H N N 181 ILE HD13 H N N 182 ILE HXT H N N 183 LEU N N N N 184 LEU CA C N S 185 LEU C C N N 186 LEU O O N N 187 LEU CB C N N 188 LEU CG C N N 189 LEU CD1 C N N 190 LEU CD2 C N N 191 LEU OXT O N N 192 LEU H H N N 193 LEU H2 H N N 194 LEU HA H N N 195 LEU HB2 H N N 196 LEU HB3 H N N 197 LEU HG H N N 198 LEU HD11 H N N 199 LEU HD12 H N N 200 LEU HD13 H N N 201 LEU HD21 H N N 202 LEU HD22 H N N 203 LEU HD23 H N N 204 LEU HXT H N N 205 LYS N N N N 206 LYS CA C N S 207 LYS C C N N 208 LYS O O N N 209 LYS CB C N N 210 LYS CG C N N 211 LYS CD C N N 212 LYS CE C N N 213 LYS NZ N N N 214 LYS OXT O N N 215 LYS H H N N 216 LYS H2 H N N 217 LYS HA H N N 218 LYS HB2 H N N 219 LYS HB3 H N N 220 LYS HG2 H N N 221 LYS HG3 H N N 222 LYS HD2 H N N 223 LYS HD3 H N N 224 LYS HE2 H N N 225 LYS HE3 H N N 226 LYS HZ1 H N N 227 LYS HZ2 H N N 228 LYS HZ3 H N N 229 LYS HXT H N N 230 MET N N N N 231 MET CA C N S 232 MET C C N N 233 MET O O N N 234 MET CB C N N 235 MET CG C N N 236 MET SD S N N 237 MET CE C N N 238 MET OXT O N N 239 MET H H N N 240 MET H2 H N N 241 MET HA H N N 242 MET HB2 H N N 243 MET HB3 H N N 244 MET HG2 H N N 245 MET HG3 H N N 246 MET HE1 H N N 247 MET HE2 H N N 248 MET HE3 H N N 249 MET HXT H N N 250 PHE N N N N 251 PHE CA C N S 252 PHE C C N N 253 PHE O O N N 254 PHE CB C N N 255 PHE CG C Y N 256 PHE CD1 C Y N 257 PHE CD2 C Y N 258 PHE CE1 C Y N 259 PHE CE2 C Y N 260 PHE CZ C Y N 261 PHE OXT O N N 262 PHE H H N N 263 PHE H2 H N N 264 PHE HA H N N 265 PHE HB2 H N N 266 PHE HB3 H N N 267 PHE HD1 H N N 268 PHE HD2 H N N 269 PHE HE1 H N N 270 PHE HE2 H N N 271 PHE HZ H N N 272 PHE HXT H N N 273 PRO N N N N 274 PRO CA C N S 275 PRO C C N N 276 PRO O O N N 277 PRO CB C N N 278 PRO CG C N N 279 PRO CD C N N 280 PRO OXT O N N 281 PRO H H N N 282 PRO HA H N N 283 PRO HB2 H N N 284 PRO HB3 H N N 285 PRO HG2 H N N 286 PRO HG3 H N N 287 PRO HD2 H N N 288 PRO HD3 H N N 289 PRO HXT H N N 290 SER N N N N 291 SER CA C N S 292 SER C C N N 293 SER O O N N 294 SER CB C N N 295 SER OG O N N 296 SER OXT O N N 297 SER H H N N 298 SER H2 H N N 299 SER HA H N N 300 SER HB2 H N N 301 SER HB3 H N N 302 SER HG H N N 303 SER HXT H N N 304 SO4 S S N N 305 SO4 O1 O N N 306 SO4 O2 O N N 307 SO4 O3 O N N 308 SO4 O4 O N N 309 THR N N N N 310 THR CA C N S 311 THR C C N N 312 THR O O N N 313 THR CB C N R 314 THR OG1 O N N 315 THR CG2 C N N 316 THR OXT O N N 317 THR H H N N 318 THR H2 H N N 319 THR HA H N N 320 THR HB H N N 321 THR HG1 H N N 322 THR HG21 H N N 323 THR HG22 H N N 324 THR HG23 H N N 325 THR HXT H N N 326 TRP N N N N 327 TRP CA C N S 328 TRP C C N N 329 TRP O O N N 330 TRP CB C N N 331 TRP CG C Y N 332 TRP CD1 C Y N 333 TRP CD2 C Y N 334 TRP NE1 N Y N 335 TRP CE2 C Y N 336 TRP CE3 C Y N 337 TRP CZ2 C Y N 338 TRP CZ3 C Y N 339 TRP CH2 C Y N 340 TRP OXT O N N 341 TRP H H N N 342 TRP H2 H N N 343 TRP HA H N N 344 TRP HB2 H N N 345 TRP HB3 H N N 346 TRP HD1 H N N 347 TRP HE1 H N N 348 TRP HE3 H N N 349 TRP HZ2 H N N 350 TRP HZ3 H N N 351 TRP HH2 H N N 352 TRP HXT H N N 353 TYR N N N N 354 TYR CA C N S 355 TYR C C N N 356 TYR O O N N 357 TYR CB C N N 358 TYR CG C Y N 359 TYR CD1 C Y N 360 TYR CD2 C Y N 361 TYR CE1 C Y N 362 TYR CE2 C Y N 363 TYR CZ C Y N 364 TYR OH O N N 365 TYR OXT O N N 366 TYR H H N N 367 TYR H2 H N N 368 TYR HA H N N 369 TYR HB2 H N N 370 TYR HB3 H N N 371 TYR HD1 H N N 372 TYR HD2 H N N 373 TYR HE1 H N N 374 TYR HE2 H N N 375 TYR HH H N N 376 TYR HXT H N N 377 VAL N N N N 378 VAL CA C N S 379 VAL C C N N 380 VAL O O N N 381 VAL CB C N N 382 VAL CG1 C N N 383 VAL CG2 C N N 384 VAL OXT O N N 385 VAL H H N N 386 VAL H2 H N N 387 VAL HA H N N 388 VAL HB H N N 389 VAL HG11 H N N 390 VAL HG12 H N N 391 VAL HG13 H N N 392 VAL HG21 H N N 393 VAL HG22 H N N 394 VAL HG23 H N N 395 VAL HXT H N N 396 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 SO4 S O1 doub N N 290 SO4 S O2 doub N N 291 SO4 S O3 sing N N 292 SO4 S O4 sing N N 293 THR N CA sing N N 294 THR N H sing N N 295 THR N H2 sing N N 296 THR CA C sing N N 297 THR CA CB sing N N 298 THR CA HA sing N N 299 THR C O doub N N 300 THR C OXT sing N N 301 THR CB OG1 sing N N 302 THR CB CG2 sing N N 303 THR CB HB sing N N 304 THR OG1 HG1 sing N N 305 THR CG2 HG21 sing N N 306 THR CG2 HG22 sing N N 307 THR CG2 HG23 sing N N 308 THR OXT HXT sing N N 309 TRP N CA sing N N 310 TRP N H sing N N 311 TRP N H2 sing N N 312 TRP CA C sing N N 313 TRP CA CB sing N N 314 TRP CA HA sing N N 315 TRP C O doub N N 316 TRP C OXT sing N N 317 TRP CB CG sing N N 318 TRP CB HB2 sing N N 319 TRP CB HB3 sing N N 320 TRP CG CD1 doub Y N 321 TRP CG CD2 sing Y N 322 TRP CD1 NE1 sing Y N 323 TRP CD1 HD1 sing N N 324 TRP CD2 CE2 doub Y N 325 TRP CD2 CE3 sing Y N 326 TRP NE1 CE2 sing Y N 327 TRP NE1 HE1 sing N N 328 TRP CE2 CZ2 sing Y N 329 TRP CE3 CZ3 doub Y N 330 TRP CE3 HE3 sing N N 331 TRP CZ2 CH2 doub Y N 332 TRP CZ2 HZ2 sing N N 333 TRP CZ3 CH2 sing Y N 334 TRP CZ3 HZ3 sing N N 335 TRP CH2 HH2 sing N N 336 TRP OXT HXT sing N N 337 TYR N CA sing N N 338 TYR N H sing N N 339 TYR N H2 sing N N 340 TYR CA C sing N N 341 TYR CA CB sing N N 342 TYR CA HA sing N N 343 TYR C O doub N N 344 TYR C OXT sing N N 345 TYR CB CG sing N N 346 TYR CB HB2 sing N N 347 TYR CB HB3 sing N N 348 TYR CG CD1 doub Y N 349 TYR CG CD2 sing Y N 350 TYR CD1 CE1 sing Y N 351 TYR CD1 HD1 sing N N 352 TYR CD2 CE2 doub Y N 353 TYR CD2 HD2 sing N N 354 TYR CE1 CZ doub Y N 355 TYR CE1 HE1 sing N N 356 TYR CE2 CZ sing Y N 357 TYR CE2 HE2 sing N N 358 TYR CZ OH sing N N 359 TYR OH HH sing N N 360 TYR OXT HXT sing N N 361 VAL N CA sing N N 362 VAL N H sing N N 363 VAL N H2 sing N N 364 VAL CA C sing N N 365 VAL CA CB sing N N 366 VAL CA HA sing N N 367 VAL C O doub N N 368 VAL C OXT sing N N 369 VAL CB CG1 sing N N 370 VAL CB CG2 sing N N 371 VAL CB HB sing N N 372 VAL CG1 HG11 sing N N 373 VAL CG1 HG12 sing N N 374 VAL CG1 HG13 sing N N 375 VAL CG2 HG21 sing N N 376 VAL CG2 HG22 sing N N 377 VAL CG2 HG23 sing N N 378 VAL OXT HXT sing N N 379 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Science Foundation (NSF, United States)' 'United States' DMR-2428112 1 'Other government' ? 'Air Force Office of Scientific Research FA9550-22-1-0300' 2 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2R6S _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 9N5S _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.008162 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008162 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007317 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.pdbx_scat_Z _atom_type.pdbx_N_electrons _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c C 6 6 2.3103 20.8439 1.0201 10.2075 1.5888 0.5687 0.8651 51.6512 0.2156 FE 26 26 11.7738 4.7611 7.3600 0.3072 3.5235 15.3535 2.3054 76.8805 1.2812 N 7 7 12.2220 0.0057 3.1346 9.8933 2.0141 28.9975 1.1672 0.5826 -11.5379 O 8 8 3.0487 13.2771 2.2870 5.7011 1.5464 0.3239 0.8671 32.9089 0.2508 S 16 16 6.9054 1.4679 5.2035 22.2151 1.4379 0.2536 1.5863 56.1720 1.0487 # loop_ #