data_9NGH # _entry.id 9NGH # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.403 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9NGH pdb_00009ngh 10.2210/pdb9ngh/pdb WWPDB D_1000293337 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2025-04-02 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9NGH _pdbx_database_status.recvd_initial_deposition_date 2025-02-22 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible N # loop_ _pdbx_contact_author.id _pdbx_contact_author.email _pdbx_contact_author.name_first _pdbx_contact_author.name_last _pdbx_contact_author.name_mi _pdbx_contact_author.role _pdbx_contact_author.identifier_ORCID 2 geiger@chemistry.msu.edu James Geiger H 'principal investigator/group leader' 0000-0002-9443-4488 3 draths@chemistry.msu.edu Karen Draths ? 'principal investigator/group leader' 0000-0001-7852-1090 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Silva, K.' 1 ? 'Nayebi, G.H.' 2 ? 'Geiger, J.H.' 3 ? 'Draths, K.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Cg10062 E114N mutant with acetylenecarboxylic acid' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Silva, K.' 1 ? primary 'Geiger, J.H.' 2 ? primary 'Draths, K.' 3 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man '4-oxalocrotonate tautomerase' 16927.951 1 ? E114N ? ? 2 non-polymer syn 'prop-2-ynoic acid' 70.047 1 ? ? ? ? 3 water nat water 18.015 12 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;PTYTCWSQRIAISAEAKQRIAEAITDAHHELAHAPKYLVQVIFNEVEPDSYFIAAQSASENHIWVQATIRSGRTEKQKEE LLLRLTQEIALILGIPNEEVWVYITEIPGSNMTNYGRLLMEPGEEEKWFNSLPEGLRERLTELEGSSE ; _entity_poly.pdbx_seq_one_letter_code_can ;PTYTCWSQRIAISAEAKQRIAEAITDAHHELAHAPKYLVQVIFNEVEPDSYFIAAQSASENHIWVQATIRSGRTEKQKEE LLLRLTQEIALILGIPNEEVWVYITEIPGSNMTNYGRLLMEPGEEEKWFNSLPEGLRERLTELEGSSE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'prop-2-ynoic acid' A1BXY 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 PRO n 1 2 THR n 1 3 TYR n 1 4 THR n 1 5 CYS n 1 6 TRP n 1 7 SER n 1 8 GLN n 1 9 ARG n 1 10 ILE n 1 11 ALA n 1 12 ILE n 1 13 SER n 1 14 ALA n 1 15 GLU n 1 16 ALA n 1 17 LYS n 1 18 GLN n 1 19 ARG n 1 20 ILE n 1 21 ALA n 1 22 GLU n 1 23 ALA n 1 24 ILE n 1 25 THR n 1 26 ASP n 1 27 ALA n 1 28 HIS n 1 29 HIS n 1 30 GLU n 1 31 LEU n 1 32 ALA n 1 33 HIS n 1 34 ALA n 1 35 PRO n 1 36 LYS n 1 37 TYR n 1 38 LEU n 1 39 VAL n 1 40 GLN n 1 41 VAL n 1 42 ILE n 1 43 PHE n 1 44 ASN n 1 45 GLU n 1 46 VAL n 1 47 GLU n 1 48 PRO n 1 49 ASP n 1 50 SER n 1 51 TYR n 1 52 PHE n 1 53 ILE n 1 54 ALA n 1 55 ALA n 1 56 GLN n 1 57 SER n 1 58 ALA n 1 59 SER n 1 60 GLU n 1 61 ASN n 1 62 HIS n 1 63 ILE n 1 64 TRP n 1 65 VAL n 1 66 GLN n 1 67 ALA n 1 68 THR n 1 69 ILE n 1 70 ARG n 1 71 SER n 1 72 GLY n 1 73 ARG n 1 74 THR n 1 75 GLU n 1 76 LYS n 1 77 GLN n 1 78 LYS n 1 79 GLU n 1 80 GLU n 1 81 LEU n 1 82 LEU n 1 83 LEU n 1 84 ARG n 1 85 LEU n 1 86 THR n 1 87 GLN n 1 88 GLU n 1 89 ILE n 1 90 ALA n 1 91 LEU n 1 92 ILE n 1 93 LEU n 1 94 GLY n 1 95 ILE n 1 96 PRO n 1 97 ASN n 1 98 GLU n 1 99 GLU n 1 100 VAL n 1 101 TRP n 1 102 VAL n 1 103 TYR n 1 104 ILE n 1 105 THR n 1 106 GLU n 1 107 ILE n 1 108 PRO n 1 109 GLY n 1 110 SER n 1 111 ASN n 1 112 MET n 1 113 THR n 1 114 ASN n 1 115 TYR n 1 116 GLY n 1 117 ARG n 1 118 LEU n 1 119 LEU n 1 120 MET n 1 121 GLU n 1 122 PRO n 1 123 GLY n 1 124 GLU n 1 125 GLU n 1 126 GLU n 1 127 LYS n 1 128 TRP n 1 129 PHE n 1 130 ASN n 1 131 SER n 1 132 LEU n 1 133 PRO n 1 134 GLU n 1 135 GLY n 1 136 LEU n 1 137 ARG n 1 138 GLU n 1 139 ARG n 1 140 LEU n 1 141 THR n 1 142 GLU n 1 143 LEU n 1 144 GLU n 1 145 GLY n 1 146 SER n 1 147 SER n 1 148 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 148 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'AUP69_07050, AUP70_06515' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Corynebacterium glutamicum' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1718 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight A1BXY non-polymer . 'prop-2-ynoic acid' ? 'C3 H2 O2' 70.047 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 PRO 1 1 1 PRO PRO A . n A 1 2 THR 2 2 2 THR THR A . n A 1 3 TYR 3 3 3 TYR TYR A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 CYS 5 5 5 CYS CYS A . n A 1 6 TRP 6 6 6 TRP TRP A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 GLN 8 8 8 GLN GLN A . n A 1 9 ARG 9 9 9 ARG ARG A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 GLN 18 18 18 GLN GLN A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 HIS 28 28 28 HIS HIS A . n A 1 29 HIS 29 29 29 HIS HIS A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 HIS 33 33 33 HIS HIS A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 PRO 35 35 35 PRO PRO A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 TYR 37 37 37 TYR TYR A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 GLN 40 40 40 GLN GLN A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 ILE 42 42 42 ILE ILE A . n A 1 43 PHE 43 43 43 PHE PHE A . n A 1 44 ASN 44 44 44 ASN ASN A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 PRO 48 48 48 PRO PRO A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 TYR 51 51 51 TYR TYR A . n A 1 52 PHE 52 52 52 PHE PHE A . n A 1 53 ILE 53 53 53 ILE ILE A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 GLN 56 56 56 GLN GLN A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 HIS 62 62 62 HIS HIS A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 TRP 64 64 64 TRP TRP A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 GLN 66 66 66 GLN GLN A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 THR 68 68 68 THR THR A . n A 1 69 ILE 69 69 69 ILE ILE A . n A 1 70 ARG 70 70 70 ARG ARG A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 ARG 73 73 73 ARG ARG A . n A 1 74 THR 74 74 74 THR THR A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 LYS 76 76 76 LYS LYS A . n A 1 77 GLN 77 77 77 GLN GLN A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 GLU 79 79 79 GLU GLU A . n A 1 80 GLU 80 80 80 GLU GLU A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 ARG 84 84 84 ARG ARG A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 THR 86 86 86 THR THR A . n A 1 87 GLN 87 87 87 GLN GLN A . n A 1 88 GLU 88 88 88 GLU GLU A . n A 1 89 ILE 89 89 89 ILE ILE A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 ILE 92 92 92 ILE ILE A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 GLY 94 94 94 GLY GLY A . n A 1 95 ILE 95 95 95 ILE ILE A . n A 1 96 PRO 96 96 96 PRO PRO A . n A 1 97 ASN 97 97 97 ASN ASN A . n A 1 98 GLU 98 98 98 GLU GLU A . n A 1 99 GLU 99 99 99 GLU GLU A . n A 1 100 VAL 100 100 100 VAL VAL A . n A 1 101 TRP 101 101 101 TRP TRP A . n A 1 102 VAL 102 102 102 VAL VAL A . n A 1 103 TYR 103 103 103 TYR TYR A . n A 1 104 ILE 104 104 104 ILE ILE A . n A 1 105 THR 105 105 105 THR THR A . n A 1 106 GLU 106 106 106 GLU GLU A . n A 1 107 ILE 107 107 107 ILE ILE A . n A 1 108 PRO 108 108 108 PRO PRO A . n A 1 109 GLY 109 109 109 GLY GLY A . n A 1 110 SER 110 110 110 SER SER A . n A 1 111 ASN 111 111 111 ASN ASN A . n A 1 112 MET 112 112 112 MET MET A . n A 1 113 THR 113 113 113 THR THR A . n A 1 114 ASN 114 114 114 ASN ASN A . n A 1 115 TYR 115 115 115 TYR TYR A . n A 1 116 GLY 116 116 116 GLY GLY A . n A 1 117 ARG 117 117 117 ARG ARG A . n A 1 118 LEU 118 118 118 LEU LEU A . n A 1 119 LEU 119 119 119 LEU LEU A . n A 1 120 MET 120 120 120 MET MET A . n A 1 121 GLU 121 121 121 GLU GLU A . n A 1 122 PRO 122 122 122 PRO PRO A . n A 1 123 GLY 123 123 123 GLY GLY A . n A 1 124 GLU 124 124 124 GLU GLU A . n A 1 125 GLU 125 125 125 GLU GLU A . n A 1 126 GLU 126 126 126 GLU GLU A . n A 1 127 LYS 127 127 127 LYS LYS A . n A 1 128 TRP 128 128 128 TRP TRP A . n A 1 129 PHE 129 129 129 PHE PHE A . n A 1 130 ASN 130 130 130 ASN ASN A . n A 1 131 SER 131 131 131 SER SER A . n A 1 132 LEU 132 132 132 LEU LEU A . n A 1 133 PRO 133 133 133 PRO PRO A . n A 1 134 GLU 134 134 134 GLU GLU A . n A 1 135 GLY 135 135 135 GLY GLY A . n A 1 136 LEU 136 136 136 LEU LEU A . n A 1 137 ARG 137 137 137 ARG ARG A . n A 1 138 GLU 138 138 138 GLU GLU A . n A 1 139 ARG 139 139 139 ARG ARG A . n A 1 140 LEU 140 140 140 LEU LEU A . n A 1 141 THR 141 141 141 THR THR A . n A 1 142 GLU 142 142 142 GLU GLU A . n A 1 143 LEU 143 143 143 LEU LEU A . n A 1 144 GLU 144 144 144 GLU GLU A . n A 1 145 GLY 145 145 145 GLY GLY A . n A 1 146 SER 146 146 146 SER SER A . n A 1 147 SER 147 147 ? ? ? A . n A 1 148 GLU 148 148 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 A1BXY 1 201 201 A1BXY ACA A . C 3 HOH 1 301 3 HOH HOH A . C 3 HOH 2 302 2 HOH HOH A . C 3 HOH 3 303 8 HOH HOH A . C 3 HOH 4 304 6 HOH HOH A . C 3 HOH 5 305 10 HOH HOH A . C 3 HOH 6 306 4 HOH HOH A . C 3 HOH 7 307 5 HOH HOH A . C 3 HOH 8 308 1 HOH HOH A . C 3 HOH 9 309 12 HOH HOH A . C 3 HOH 10 310 9 HOH HOH A . C 3 HOH 11 311 7 HOH HOH A . C 3 HOH 12 312 11 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 0 A ARG 9 ? CZ ? A ARG 9 CZ 2 1 Y 0 A GLU 22 ? CD ? A GLU 22 CD 3 1 Y 0 A TYR 37 ? C ? A TYR 37 C 4 1 Y 0 A GLU 45 ? CD ? A GLU 45 CD 5 1 Y 0 A ALA 55 ? C ? A ALA 55 C 6 1 Y 0 A GLN 66 ? CD ? A GLN 66 CD 7 1 Y 0 A ARG 73 ? CZ ? A ARG 73 CZ 8 1 Y 0 A LYS 76 ? CD ? A LYS 76 CD 9 1 Y 0 A GLU 121 ? CD ? A GLU 121 CD 10 1 Y 0 A GLU 124 ? CD ? A GLU 124 CD 11 1 Y 0 A GLU 125 ? CD ? A GLU 125 CD 12 1 Y 0 A GLU 126 ? O ? A GLU 126 O 13 1 Y 0 A GLU 126 ? CD ? A GLU 126 CD 14 1 Y 0 A ASN 130 ? CG ? A ASN 130 CG 15 1 Y 0 A GLU 134 ? CD ? A GLU 134 CD 16 1 Y 0 A GLU 138 ? CD ? A GLU 138 CD 17 1 Y 0 A GLU 142 ? C ? A GLU 142 C 18 1 Y 0 A GLU 142 ? CD ? A GLU 142 CD 19 1 Y 0 A GLY 145 ? C ? A GLY 145 C 20 1 Y 0 A SER 146 ? CA ? A SER 146 CA # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.17.1_3660 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.17.1_3660 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 9NGH _cell.details ? _cell.formula_units_Z ? _cell.length_a 146.162 _cell.length_a_esd ? _cell.length_b 146.162 _cell.length_b_esd ? _cell.length_c 146.162 _cell.length_c_esd ? _cell.volume 3122507.075 _cell.volume_esd ? _cell.Z_PDB 24 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9NGH _symmetry.cell_setting ? _symmetry.Int_Tables_number 213 _symmetry.space_group_name_Hall 'P 4bd 2ab 3' _symmetry.space_group_name_H-M 'P 41 3 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9NGH _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '2% v/v TacsimateTM pH 5.0 5% w/v PEG 3,350' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 296 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER2 S 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-06-21 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.98 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 21-ID-D' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.98 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 21-ID-D _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 51.68 _reflns.entry_id 9NGH _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.60 _reflns.d_resolution_low 50.00 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 17302 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.8 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 10.2 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 13.5 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.056 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.60 _reflns_shell.d_res_low 2.64 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 843 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.664 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 38.02 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9NGH _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.92 _refine.ls_d_res_low 35.45 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 10828 _refine.ls_number_reflns_R_free 1959 _refine.ls_number_reflns_R_work 17721 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 89.34 _refine.ls_percent_reflns_R_free 9.95 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2579 _refine.ls_R_factor_R_free 0.3117 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2519 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 31.3971 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.4137 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.92 _refine_hist.d_res_low 35.45 _refine_hist.number_atoms_solvent 12 _refine_hist.number_atoms_total 1194 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1177 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 5 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0112 ? 1231 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.2065 ? 1672 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0572 ? 183 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0064 ? 218 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 31.8911 ? 165 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.92 2.99 . . 65 593 41.23 . . . . 0.2492 . . . . . . . . . . . . . . . 0.2987 'X-RAY DIFFRACTION' 2.99 3.07 . . 117 1077 77.18 . . . . 0.2415 . . . . . . . . . . . . . . . 0.3229 'X-RAY DIFFRACTION' 3.07 3.16 . . 148 1320 92.15 . . . . 0.2413 . . . . . . . . . . . . . . . 0.3271 'X-RAY DIFFRACTION' 3.16 3.26 . . 143 1314 94.92 . . . . 0.2347 . . . . . . . . . . . . . . . 0.3045 'X-RAY DIFFRACTION' 3.26 3.38 . . 153 1374 94.79 . . . . 0.2454 . . . . . . . . . . . . . . . 0.2780 'X-RAY DIFFRACTION' 3.38 3.51 . . 140 1283 91.28 . . . . 0.2663 . . . . . . . . . . . . . . . 0.3114 'X-RAY DIFFRACTION' 3.51 3.67 . . 147 1373 96.39 . . . . 0.2952 . . . . . . . . . . . . . . . 0.3692 'X-RAY DIFFRACTION' 3.67 3.87 . . 151 1356 97.10 . . . . 0.2553 . . . . . . . . . . . . . . . 0.3318 'X-RAY DIFFRACTION' 3.87 4.11 . . 151 1367 96.81 . . . . 0.2308 . . . . . . . . . . . . . . . 0.3487 'X-RAY DIFFRACTION' 4.11 4.42 . . 156 1384 97.35 . . . . 0.2249 . . . . . . . . . . . . . . . 0.2394 'X-RAY DIFFRACTION' 4.43 4.87 . . 155 1358 96.06 . . . . 0.2162 . . . . . . . . . . . . . . . 0.2603 'X-RAY DIFFRACTION' 4.87 5.57 . . 150 1363 95.58 . . . . 0.2265 . . . . . . . . . . . . . . . 0.3447 'X-RAY DIFFRACTION' 5.57 7.01 . . 145 1305 92.71 . . . . 0.2782 . . . . . . . . . . . . . . . 0.3434 'X-RAY DIFFRACTION' 7.02 35.45 . . 138 1254 87.82 . . . . 0.2980 . . . . . . . . . . . . . . . 0.3238 # _struct.entry_id 9NGH _struct.title 'Cg10062 E114N mutant with acetylenecarboxylic acid' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9NGH _struct_keywords.text 'Tautomerase, Cg10062, acetylenecaarboxylic acid, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A0S2T163_CORGT _struct_ref.pdbx_db_accession A0A0S2T163 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;PTYTCWSQRIRISREAKQRIAEAITDAHHELAHAPKYLVQVIFNEVEPDSYFIAAQSASENHIWVQATIRSGRTEKQKEE LLLRLTQEIALILGIPNEEVWVYITEIPGSNMTEYGRLLMEPGEEEKWFNSLPEGLRERLTELEGSSE ; _struct_ref.pdbx_align_begin 2 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9NGH _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 148 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A0S2T163 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 149 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 148 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9NGH ALA A 11 ? UNP A0A0S2T163 ARG 12 conflict 11 1 1 9NGH ALA A 14 ? UNP A0A0S2T163 ARG 15 conflict 14 2 1 9NGH ASN A 114 ? UNP A0A0S2T163 GLU 115 'engineered mutation' 114 3 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 8060 ? 1 MORE -38 ? 1 'SSA (A^2)' 17140 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 5_555 z,x,y 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 3 'crystal symmetry operation' 9_555 y,z,x 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 13 ? HIS A 33 ? SER A 13 HIS A 33 1 ? 21 HELX_P HELX_P2 AA2 PRO A 35 ? VAL A 39 ? PRO A 35 VAL A 39 5 ? 5 HELX_P HELX_P3 AA3 GLU A 47 ? SER A 50 ? GLU A 47 SER A 50 5 ? 4 HELX_P HELX_P4 AA4 THR A 74 ? GLY A 94 ? THR A 74 GLY A 94 1 ? 21 HELX_P HELX_P5 AA5 PRO A 96 ? GLU A 98 ? PRO A 96 GLU A 98 5 ? 3 HELX_P HELX_P6 AA6 PRO A 108 ? ASN A 111 ? PRO A 108 ASN A 111 5 ? 4 HELX_P HELX_P7 AA7 GLU A 124 ? ASN A 130 ? GLU A 124 ASN A 130 1 ? 7 HELX_P HELX_P8 AA8 PRO A 133 ? LEU A 143 ? PRO A 133 LEU A 143 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 2 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLN A 40 ? VAL A 46 ? GLN A 40 VAL A 46 AA1 2 THR A 2 ? GLN A 8 ? THR A 2 GLN A 8 AA1 3 ILE A 63 ? ARG A 70 ? ILE A 63 ARG A 70 AA1 4 VAL A 100 ? ILE A 107 ? VAL A 100 ILE A 107 AA2 1 PHE A 52 ? ILE A 53 ? PHE A 52 ILE A 53 AA2 2 GLN A 56 ? SER A 57 ? GLN A 56 SER A 57 AA3 1 THR A 113 ? ASN A 114 ? THR A 113 ASN A 114 AA3 2 ARG A 117 ? LEU A 118 ? ARG A 117 LEU A 118 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O GLN A 40 ? O GLN A 40 N TYR A 3 ? N TYR A 3 AA1 2 3 N THR A 4 ? N THR A 4 O GLN A 66 ? O GLN A 66 AA1 3 4 N ALA A 67 ? N ALA A 67 O TYR A 103 ? O TYR A 103 AA2 1 2 N ILE A 53 ? N ILE A 53 O GLN A 56 ? O GLN A 56 AA3 1 2 N ASN A 114 ? N ASN A 114 O ARG A 117 ? O ARG A 117 # _pdbx_entry_details.entry_id 9NGH _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ILE A 10 ? ? 50.42 4.64 2 1 ASP A 49 ? ? -68.30 1.85 3 1 ALA A 54 ? ? 54.98 -110.15 4 1 ALA A 55 ? ? -146.61 22.97 5 1 LEU A 143 ? ? -68.88 15.84 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x+1/4,-z+1/4,y+3/4 3 x+3/4,z+1/4,-y+1/4 4 z+3/4,y+1/4,-x+1/4 5 -z+1/4,y+3/4,x+1/4 6 -y+1/4,x+3/4,z+1/4 7 y+1/4,-x+1/4,z+3/4 8 z,x,y 9 y,z,x 10 -y+1/2,-z,x+1/2 11 z+1/2,-x+1/2,-y 12 -y,z+1/2,-x+1/2 13 -z+1/2,-x,y+1/2 14 -z,x+1/2,-y+1/2 15 y+1/2,-z+1/2,-x 16 x+1/2,-y+1/2,-z 17 -x,y+1/2,-z+1/2 18 -x+1/2,-y,z+1/2 19 y+3/4,x+1/4,-z+1/4 20 -y+3/4,-x+3/4,-z+3/4 21 z+1/4,-y+1/4,x+3/4 22 -z+3/4,-y+3/4,-x+3/4 23 -x+1/4,z+3/4,y+1/4 24 -x+3/4,-z+3/4,-y+3/4 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 147 ? A SER 147 2 1 Y 1 A GLU 148 ? A GLU 148 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal A1BXY C01 C N N 1 A1BXY C02 C N N 2 A1BXY C03 C N N 3 A1BXY O04 O N N 4 A1BXY O05 O N N 5 A1BXY H1 H N N 6 A1BXY H2 H N N 7 ALA N N N N 8 ALA CA C N S 9 ALA C C N N 10 ALA O O N N 11 ALA CB C N N 12 ALA OXT O N N 13 ALA H H N N 14 ALA H2 H N N 15 ALA HA H N N 16 ALA HB1 H N N 17 ALA HB2 H N N 18 ALA HB3 H N N 19 ALA HXT H N N 20 ARG N N N N 21 ARG CA C N S 22 ARG C C N N 23 ARG O O N N 24 ARG CB C N N 25 ARG CG C N N 26 ARG CD C N N 27 ARG NE N N N 28 ARG CZ C N N 29 ARG NH1 N N N 30 ARG NH2 N N N 31 ARG OXT O N N 32 ARG H H N N 33 ARG H2 H N N 34 ARG HA H N N 35 ARG HB2 H N N 36 ARG HB3 H N N 37 ARG HG2 H N N 38 ARG HG3 H N N 39 ARG HD2 H N N 40 ARG HD3 H N N 41 ARG HE H N N 42 ARG HH11 H N N 43 ARG HH12 H N N 44 ARG HH21 H N N 45 ARG HH22 H N N 46 ARG HXT H N N 47 ASN N N N N 48 ASN CA C N S 49 ASN C C N N 50 ASN O O N N 51 ASN CB C N N 52 ASN CG C N N 53 ASN OD1 O N N 54 ASN ND2 N N N 55 ASN OXT O N N 56 ASN H H N N 57 ASN H2 H N N 58 ASN HA H N N 59 ASN HB2 H N N 60 ASN HB3 H N N 61 ASN HD21 H N N 62 ASN HD22 H N N 63 ASN HXT H N N 64 ASP N N N N 65 ASP CA C N S 66 ASP C C N N 67 ASP O O N N 68 ASP CB C N N 69 ASP CG C N N 70 ASP OD1 O N N 71 ASP OD2 O N N 72 ASP OXT O N N 73 ASP H H N N 74 ASP H2 H N N 75 ASP HA H N N 76 ASP HB2 H N N 77 ASP HB3 H N N 78 ASP HD2 H N N 79 ASP HXT H N N 80 CYS N N N N 81 CYS CA C N R 82 CYS C C N N 83 CYS O O N N 84 CYS CB C N N 85 CYS SG S N N 86 CYS OXT O N N 87 CYS H H N N 88 CYS H2 H N N 89 CYS HA H N N 90 CYS HB2 H N N 91 CYS HB3 H N N 92 CYS HG H N N 93 CYS HXT H N N 94 GLN N N N N 95 GLN CA C N S 96 GLN C C N N 97 GLN O O N N 98 GLN CB C N N 99 GLN CG C N N 100 GLN CD C N N 101 GLN OE1 O N N 102 GLN NE2 N N N 103 GLN OXT O N N 104 GLN H H N N 105 GLN H2 H N N 106 GLN HA H N N 107 GLN HB2 H N N 108 GLN HB3 H N N 109 GLN HG2 H N N 110 GLN HG3 H N N 111 GLN HE21 H N N 112 GLN HE22 H N N 113 GLN HXT H N N 114 GLU N N N N 115 GLU CA C N S 116 GLU C C N N 117 GLU O O N N 118 GLU CB C N N 119 GLU CG C N N 120 GLU CD C N N 121 GLU OE1 O N N 122 GLU OE2 O N N 123 GLU OXT O N N 124 GLU H H N N 125 GLU H2 H N N 126 GLU HA H N N 127 GLU HB2 H N N 128 GLU HB3 H N N 129 GLU HG2 H N N 130 GLU HG3 H N N 131 GLU HE2 H N N 132 GLU HXT H N N 133 GLY N N N N 134 GLY CA C N N 135 GLY C C N N 136 GLY O O N N 137 GLY OXT O N N 138 GLY H H N N 139 GLY H2 H N N 140 GLY HA2 H N N 141 GLY HA3 H N N 142 GLY HXT H N N 143 HIS N N N N 144 HIS CA C N S 145 HIS C C N N 146 HIS O O N N 147 HIS CB C N N 148 HIS CG C Y N 149 HIS ND1 N Y N 150 HIS CD2 C Y N 151 HIS CE1 C Y N 152 HIS NE2 N Y N 153 HIS OXT O N N 154 HIS H H N N 155 HIS H2 H N N 156 HIS HA H N N 157 HIS HB2 H N N 158 HIS HB3 H N N 159 HIS HD1 H N N 160 HIS HD2 H N N 161 HIS HE1 H N N 162 HIS HE2 H N N 163 HIS HXT H N N 164 HOH O O N N 165 HOH H1 H N N 166 HOH H2 H N N 167 ILE N N N N 168 ILE CA C N S 169 ILE C C N N 170 ILE O O N N 171 ILE CB C N S 172 ILE CG1 C N N 173 ILE CG2 C N N 174 ILE CD1 C N N 175 ILE OXT O N N 176 ILE H H N N 177 ILE H2 H N N 178 ILE HA H N N 179 ILE HB H N N 180 ILE HG12 H N N 181 ILE HG13 H N N 182 ILE HG21 H N N 183 ILE HG22 H N N 184 ILE HG23 H N N 185 ILE HD11 H N N 186 ILE HD12 H N N 187 ILE HD13 H N N 188 ILE HXT H N N 189 LEU N N N N 190 LEU CA C N S 191 LEU C C N N 192 LEU O O N N 193 LEU CB C N N 194 LEU CG C N N 195 LEU CD1 C N N 196 LEU CD2 C N N 197 LEU OXT O N N 198 LEU H H N N 199 LEU H2 H N N 200 LEU HA H N N 201 LEU HB2 H N N 202 LEU HB3 H N N 203 LEU HG H N N 204 LEU HD11 H N N 205 LEU HD12 H N N 206 LEU HD13 H N N 207 LEU HD21 H N N 208 LEU HD22 H N N 209 LEU HD23 H N N 210 LEU HXT H N N 211 LYS N N N N 212 LYS CA C N S 213 LYS C C N N 214 LYS O O N N 215 LYS CB C N N 216 LYS CG C N N 217 LYS CD C N N 218 LYS CE C N N 219 LYS NZ N N N 220 LYS OXT O N N 221 LYS H H N N 222 LYS H2 H N N 223 LYS HA H N N 224 LYS HB2 H N N 225 LYS HB3 H N N 226 LYS HG2 H N N 227 LYS HG3 H N N 228 LYS HD2 H N N 229 LYS HD3 H N N 230 LYS HE2 H N N 231 LYS HE3 H N N 232 LYS HZ1 H N N 233 LYS HZ2 H N N 234 LYS HZ3 H N N 235 LYS HXT H N N 236 MET N N N N 237 MET CA C N S 238 MET C C N N 239 MET O O N N 240 MET CB C N N 241 MET CG C N N 242 MET SD S N N 243 MET CE C N N 244 MET OXT O N N 245 MET H H N N 246 MET H2 H N N 247 MET HA H N N 248 MET HB2 H N N 249 MET HB3 H N N 250 MET HG2 H N N 251 MET HG3 H N N 252 MET HE1 H N N 253 MET HE2 H N N 254 MET HE3 H N N 255 MET HXT H N N 256 PHE N N N N 257 PHE CA C N S 258 PHE C C N N 259 PHE O O N N 260 PHE CB C N N 261 PHE CG C Y N 262 PHE CD1 C Y N 263 PHE CD2 C Y N 264 PHE CE1 C Y N 265 PHE CE2 C Y N 266 PHE CZ C Y N 267 PHE OXT O N N 268 PHE H H N N 269 PHE H2 H N N 270 PHE HA H N N 271 PHE HB2 H N N 272 PHE HB3 H N N 273 PHE HD1 H N N 274 PHE HD2 H N N 275 PHE HE1 H N N 276 PHE HE2 H N N 277 PHE HZ H N N 278 PHE HXT H N N 279 PRO N N N N 280 PRO CA C N S 281 PRO C C N N 282 PRO O O N N 283 PRO CB C N N 284 PRO CG C N N 285 PRO CD C N N 286 PRO OXT O N N 287 PRO H H N N 288 PRO HA H N N 289 PRO HB2 H N N 290 PRO HB3 H N N 291 PRO HG2 H N N 292 PRO HG3 H N N 293 PRO HD2 H N N 294 PRO HD3 H N N 295 PRO HXT H N N 296 SER N N N N 297 SER CA C N S 298 SER C C N N 299 SER O O N N 300 SER CB C N N 301 SER OG O N N 302 SER OXT O N N 303 SER H H N N 304 SER H2 H N N 305 SER HA H N N 306 SER HB2 H N N 307 SER HB3 H N N 308 SER HG H N N 309 SER HXT H N N 310 THR N N N N 311 THR CA C N S 312 THR C C N N 313 THR O O N N 314 THR CB C N R 315 THR OG1 O N N 316 THR CG2 C N N 317 THR OXT O N N 318 THR H H N N 319 THR H2 H N N 320 THR HA H N N 321 THR HB H N N 322 THR HG1 H N N 323 THR HG21 H N N 324 THR HG22 H N N 325 THR HG23 H N N 326 THR HXT H N N 327 TRP N N N N 328 TRP CA C N S 329 TRP C C N N 330 TRP O O N N 331 TRP CB C N N 332 TRP CG C Y N 333 TRP CD1 C Y N 334 TRP CD2 C Y N 335 TRP NE1 N Y N 336 TRP CE2 C Y N 337 TRP CE3 C Y N 338 TRP CZ2 C Y N 339 TRP CZ3 C Y N 340 TRP CH2 C Y N 341 TRP OXT O N N 342 TRP H H N N 343 TRP H2 H N N 344 TRP HA H N N 345 TRP HB2 H N N 346 TRP HB3 H N N 347 TRP HD1 H N N 348 TRP HE1 H N N 349 TRP HE3 H N N 350 TRP HZ2 H N N 351 TRP HZ3 H N N 352 TRP HH2 H N N 353 TRP HXT H N N 354 TYR N N N N 355 TYR CA C N S 356 TYR C C N N 357 TYR O O N N 358 TYR CB C N N 359 TYR CG C Y N 360 TYR CD1 C Y N 361 TYR CD2 C Y N 362 TYR CE1 C Y N 363 TYR CE2 C Y N 364 TYR CZ C Y N 365 TYR OH O N N 366 TYR OXT O N N 367 TYR H H N N 368 TYR H2 H N N 369 TYR HA H N N 370 TYR HB2 H N N 371 TYR HB3 H N N 372 TYR HD1 H N N 373 TYR HD2 H N N 374 TYR HE1 H N N 375 TYR HE2 H N N 376 TYR HH H N N 377 TYR HXT H N N 378 VAL N N N N 379 VAL CA C N S 380 VAL C C N N 381 VAL O O N N 382 VAL CB C N N 383 VAL CG1 C N N 384 VAL CG2 C N N 385 VAL OXT O N N 386 VAL H H N N 387 VAL H2 H N N 388 VAL HA H N N 389 VAL HB H N N 390 VAL HG11 H N N 391 VAL HG12 H N N 392 VAL HG13 H N N 393 VAL HG21 H N N 394 VAL HG22 H N N 395 VAL HG23 H N N 396 VAL HXT H N N 397 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal A1BXY C02 C01 trip N N 1 A1BXY C03 C02 sing N N 2 A1BXY O04 C03 doub N N 3 A1BXY O05 C03 sing N N 4 A1BXY C01 H1 sing N N 5 A1BXY O05 H2 sing N N 6 ALA N CA sing N N 7 ALA N H sing N N 8 ALA N H2 sing N N 9 ALA CA C sing N N 10 ALA CA CB sing N N 11 ALA CA HA sing N N 12 ALA C O doub N N 13 ALA C OXT sing N N 14 ALA CB HB1 sing N N 15 ALA CB HB2 sing N N 16 ALA CB HB3 sing N N 17 ALA OXT HXT sing N N 18 ARG N CA sing N N 19 ARG N H sing N N 20 ARG N H2 sing N N 21 ARG CA C sing N N 22 ARG CA CB sing N N 23 ARG CA HA sing N N 24 ARG C O doub N N 25 ARG C OXT sing N N 26 ARG CB CG sing N N 27 ARG CB HB2 sing N N 28 ARG CB HB3 sing N N 29 ARG CG CD sing N N 30 ARG CG HG2 sing N N 31 ARG CG HG3 sing N N 32 ARG CD NE sing N N 33 ARG CD HD2 sing N N 34 ARG CD HD3 sing N N 35 ARG NE CZ sing N N 36 ARG NE HE sing N N 37 ARG CZ NH1 sing N N 38 ARG CZ NH2 doub N N 39 ARG NH1 HH11 sing N N 40 ARG NH1 HH12 sing N N 41 ARG NH2 HH21 sing N N 42 ARG NH2 HH22 sing N N 43 ARG OXT HXT sing N N 44 ASN N CA sing N N 45 ASN N H sing N N 46 ASN N H2 sing N N 47 ASN CA C sing N N 48 ASN CA CB sing N N 49 ASN CA HA sing N N 50 ASN C O doub N N 51 ASN C OXT sing N N 52 ASN CB CG sing N N 53 ASN CB HB2 sing N N 54 ASN CB HB3 sing N N 55 ASN CG OD1 doub N N 56 ASN CG ND2 sing N N 57 ASN ND2 HD21 sing N N 58 ASN ND2 HD22 sing N N 59 ASN OXT HXT sing N N 60 ASP N CA sing N N 61 ASP N H sing N N 62 ASP N H2 sing N N 63 ASP CA C sing N N 64 ASP CA CB sing N N 65 ASP CA HA sing N N 66 ASP C O doub N N 67 ASP C OXT sing N N 68 ASP CB CG sing N N 69 ASP CB HB2 sing N N 70 ASP CB HB3 sing N N 71 ASP CG OD1 doub N N 72 ASP CG OD2 sing N N 73 ASP OD2 HD2 sing N N 74 ASP OXT HXT sing N N 75 CYS N CA sing N N 76 CYS N H sing N N 77 CYS N H2 sing N N 78 CYS CA C sing N N 79 CYS CA CB sing N N 80 CYS CA HA sing N N 81 CYS C O doub N N 82 CYS C OXT sing N N 83 CYS CB SG sing N N 84 CYS CB HB2 sing N N 85 CYS CB HB3 sing N N 86 CYS SG HG sing N N 87 CYS OXT HXT sing N N 88 GLN N CA sing N N 89 GLN N H sing N N 90 GLN N H2 sing N N 91 GLN CA C sing N N 92 GLN CA CB sing N N 93 GLN CA HA sing N N 94 GLN C O doub N N 95 GLN C OXT sing N N 96 GLN CB CG sing N N 97 GLN CB HB2 sing N N 98 GLN CB HB3 sing N N 99 GLN CG CD sing N N 100 GLN CG HG2 sing N N 101 GLN CG HG3 sing N N 102 GLN CD OE1 doub N N 103 GLN CD NE2 sing N N 104 GLN NE2 HE21 sing N N 105 GLN NE2 HE22 sing N N 106 GLN OXT HXT sing N N 107 GLU N CA sing N N 108 GLU N H sing N N 109 GLU N H2 sing N N 110 GLU CA C sing N N 111 GLU CA CB sing N N 112 GLU CA HA sing N N 113 GLU C O doub N N 114 GLU C OXT sing N N 115 GLU CB CG sing N N 116 GLU CB HB2 sing N N 117 GLU CB HB3 sing N N 118 GLU CG CD sing N N 119 GLU CG HG2 sing N N 120 GLU CG HG3 sing N N 121 GLU CD OE1 doub N N 122 GLU CD OE2 sing N N 123 GLU OE2 HE2 sing N N 124 GLU OXT HXT sing N N 125 GLY N CA sing N N 126 GLY N H sing N N 127 GLY N H2 sing N N 128 GLY CA C sing N N 129 GLY CA HA2 sing N N 130 GLY CA HA3 sing N N 131 GLY C O doub N N 132 GLY C OXT sing N N 133 GLY OXT HXT sing N N 134 HIS N CA sing N N 135 HIS N H sing N N 136 HIS N H2 sing N N 137 HIS CA C sing N N 138 HIS CA CB sing N N 139 HIS CA HA sing N N 140 HIS C O doub N N 141 HIS C OXT sing N N 142 HIS CB CG sing N N 143 HIS CB HB2 sing N N 144 HIS CB HB3 sing N N 145 HIS CG ND1 sing Y N 146 HIS CG CD2 doub Y N 147 HIS ND1 CE1 doub Y N 148 HIS ND1 HD1 sing N N 149 HIS CD2 NE2 sing Y N 150 HIS CD2 HD2 sing N N 151 HIS CE1 NE2 sing Y N 152 HIS CE1 HE1 sing N N 153 HIS NE2 HE2 sing N N 154 HIS OXT HXT sing N N 155 HOH O H1 sing N N 156 HOH O H2 sing N N 157 ILE N CA sing N N 158 ILE N H sing N N 159 ILE N H2 sing N N 160 ILE CA C sing N N 161 ILE CA CB sing N N 162 ILE CA HA sing N N 163 ILE C O doub N N 164 ILE C OXT sing N N 165 ILE CB CG1 sing N N 166 ILE CB CG2 sing N N 167 ILE CB HB sing N N 168 ILE CG1 CD1 sing N N 169 ILE CG1 HG12 sing N N 170 ILE CG1 HG13 sing N N 171 ILE CG2 HG21 sing N N 172 ILE CG2 HG22 sing N N 173 ILE CG2 HG23 sing N N 174 ILE CD1 HD11 sing N N 175 ILE CD1 HD12 sing N N 176 ILE CD1 HD13 sing N N 177 ILE OXT HXT sing N N 178 LEU N CA sing N N 179 LEU N H sing N N 180 LEU N H2 sing N N 181 LEU CA C sing N N 182 LEU CA CB sing N N 183 LEU CA HA sing N N 184 LEU C O doub N N 185 LEU C OXT sing N N 186 LEU CB CG sing N N 187 LEU CB HB2 sing N N 188 LEU CB HB3 sing N N 189 LEU CG CD1 sing N N 190 LEU CG CD2 sing N N 191 LEU CG HG sing N N 192 LEU CD1 HD11 sing N N 193 LEU CD1 HD12 sing N N 194 LEU CD1 HD13 sing N N 195 LEU CD2 HD21 sing N N 196 LEU CD2 HD22 sing N N 197 LEU CD2 HD23 sing N N 198 LEU OXT HXT sing N N 199 LYS N CA sing N N 200 LYS N H sing N N 201 LYS N H2 sing N N 202 LYS CA C sing N N 203 LYS CA CB sing N N 204 LYS CA HA sing N N 205 LYS C O doub N N 206 LYS C OXT sing N N 207 LYS CB CG sing N N 208 LYS CB HB2 sing N N 209 LYS CB HB3 sing N N 210 LYS CG CD sing N N 211 LYS CG HG2 sing N N 212 LYS CG HG3 sing N N 213 LYS CD CE sing N N 214 LYS CD HD2 sing N N 215 LYS CD HD3 sing N N 216 LYS CE NZ sing N N 217 LYS CE HE2 sing N N 218 LYS CE HE3 sing N N 219 LYS NZ HZ1 sing N N 220 LYS NZ HZ2 sing N N 221 LYS NZ HZ3 sing N N 222 LYS OXT HXT sing N N 223 MET N CA sing N N 224 MET N H sing N N 225 MET N H2 sing N N 226 MET CA C sing N N 227 MET CA CB sing N N 228 MET CA HA sing N N 229 MET C O doub N N 230 MET C OXT sing N N 231 MET CB CG sing N N 232 MET CB HB2 sing N N 233 MET CB HB3 sing N N 234 MET CG SD sing N N 235 MET CG HG2 sing N N 236 MET CG HG3 sing N N 237 MET SD CE sing N N 238 MET CE HE1 sing N N 239 MET CE HE2 sing N N 240 MET CE HE3 sing N N 241 MET OXT HXT sing N N 242 PHE N CA sing N N 243 PHE N H sing N N 244 PHE N H2 sing N N 245 PHE CA C sing N N 246 PHE CA CB sing N N 247 PHE CA HA sing N N 248 PHE C O doub N N 249 PHE C OXT sing N N 250 PHE CB CG sing N N 251 PHE CB HB2 sing N N 252 PHE CB HB3 sing N N 253 PHE CG CD1 doub Y N 254 PHE CG CD2 sing Y N 255 PHE CD1 CE1 sing Y N 256 PHE CD1 HD1 sing N N 257 PHE CD2 CE2 doub Y N 258 PHE CD2 HD2 sing N N 259 PHE CE1 CZ doub Y N 260 PHE CE1 HE1 sing N N 261 PHE CE2 CZ sing Y N 262 PHE CE2 HE2 sing N N 263 PHE CZ HZ sing N N 264 PHE OXT HXT sing N N 265 PRO N CA sing N N 266 PRO N CD sing N N 267 PRO N H sing N N 268 PRO CA C sing N N 269 PRO CA CB sing N N 270 PRO CA HA sing N N 271 PRO C O doub N N 272 PRO C OXT sing N N 273 PRO CB CG sing N N 274 PRO CB HB2 sing N N 275 PRO CB HB3 sing N N 276 PRO CG CD sing N N 277 PRO CG HG2 sing N N 278 PRO CG HG3 sing N N 279 PRO CD HD2 sing N N 280 PRO CD HD3 sing N N 281 PRO OXT HXT sing N N 282 SER N CA sing N N 283 SER N H sing N N 284 SER N H2 sing N N 285 SER CA C sing N N 286 SER CA CB sing N N 287 SER CA HA sing N N 288 SER C O doub N N 289 SER C OXT sing N N 290 SER CB OG sing N N 291 SER CB HB2 sing N N 292 SER CB HB3 sing N N 293 SER OG HG sing N N 294 SER OXT HXT sing N N 295 THR N CA sing N N 296 THR N H sing N N 297 THR N H2 sing N N 298 THR CA C sing N N 299 THR CA CB sing N N 300 THR CA HA sing N N 301 THR C O doub N N 302 THR C OXT sing N N 303 THR CB OG1 sing N N 304 THR CB CG2 sing N N 305 THR CB HB sing N N 306 THR OG1 HG1 sing N N 307 THR CG2 HG21 sing N N 308 THR CG2 HG22 sing N N 309 THR CG2 HG23 sing N N 310 THR OXT HXT sing N N 311 TRP N CA sing N N 312 TRP N H sing N N 313 TRP N H2 sing N N 314 TRP CA C sing N N 315 TRP CA CB sing N N 316 TRP CA HA sing N N 317 TRP C O doub N N 318 TRP C OXT sing N N 319 TRP CB CG sing N N 320 TRP CB HB2 sing N N 321 TRP CB HB3 sing N N 322 TRP CG CD1 doub Y N 323 TRP CG CD2 sing Y N 324 TRP CD1 NE1 sing Y N 325 TRP CD1 HD1 sing N N 326 TRP CD2 CE2 doub Y N 327 TRP CD2 CE3 sing Y N 328 TRP NE1 CE2 sing Y N 329 TRP NE1 HE1 sing N N 330 TRP CE2 CZ2 sing Y N 331 TRP CE3 CZ3 doub Y N 332 TRP CE3 HE3 sing N N 333 TRP CZ2 CH2 doub Y N 334 TRP CZ2 HZ2 sing N N 335 TRP CZ3 CH2 sing Y N 336 TRP CZ3 HZ3 sing N N 337 TRP CH2 HH2 sing N N 338 TRP OXT HXT sing N N 339 TYR N CA sing N N 340 TYR N H sing N N 341 TYR N H2 sing N N 342 TYR CA C sing N N 343 TYR CA CB sing N N 344 TYR CA HA sing N N 345 TYR C O doub N N 346 TYR C OXT sing N N 347 TYR CB CG sing N N 348 TYR CB HB2 sing N N 349 TYR CB HB3 sing N N 350 TYR CG CD1 doub Y N 351 TYR CG CD2 sing Y N 352 TYR CD1 CE1 sing Y N 353 TYR CD1 HD1 sing N N 354 TYR CD2 CE2 doub Y N 355 TYR CD2 HD2 sing N N 356 TYR CE1 CZ doub Y N 357 TYR CE1 HE1 sing N N 358 TYR CE2 CZ sing Y N 359 TYR CE2 HE2 sing N N 360 TYR CZ OH sing N N 361 TYR OH HH sing N N 362 TYR OXT HXT sing N N 363 VAL N CA sing N N 364 VAL N H sing N N 365 VAL N H2 sing N N 366 VAL CA C sing N N 367 VAL CA CB sing N N 368 VAL CA HA sing N N 369 VAL C O doub N N 370 VAL C OXT sing N N 371 VAL CB CG1 sing N N 372 VAL CB CG2 sing N N 373 VAL CB HB sing N N 374 VAL CG1 HG11 sing N N 375 VAL CG1 HG12 sing N N 376 VAL CG1 HG13 sing N N 377 VAL CG2 HG21 sing N N 378 VAL CG2 HG22 sing N N 379 VAL CG2 HG23 sing N N 380 VAL OXT HXT sing N N 381 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3MF8 _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'P 41 3 2' _space_group.name_Hall 'P 4bd 2ab 3' _space_group.IT_number 213 _space_group.crystal_system cubic _space_group.id 1 # _atom_sites.entry_id 9NGH _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.006842 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.006842 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006842 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 7.96527 ? ? ? 9.05267 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O1- ? ? 5.12366 3.84317 ? ? 3.49406 27.47979 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ #