data_9O00 # _entry.id 9O00 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.413 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9O00 pdb_00009o00 10.2210/pdb9o00/pdb WWPDB D_1000292506 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-04-15 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9O00 _pdbx_database_status.recvd_initial_deposition_date 2025-04-01 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email JTainer@mdanderson.org _pdbx_contact_author.name_first John _pdbx_contact_author.name_last Tainer _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-1659-2429 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Huffman, J.L.' 1 ? 'Tang, H.Y.H.' 2 ? 'Syed, A.' 3 0000-0001-7942-3900 'Arvai, A.S.' 4 0000-0002-5376-3728 'Mol, C.D.' 5 ? 'Tainer, J.A.' 6 0000-0003-1659-2429 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Crystal structure of AfOgg1 in a DNA-free state' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Huffman, J.L.' 1 ? primary 'Tang, H.Y.H.' 2 ? primary 'Syed, A.' 3 0000-0001-7942-3900 primary 'Arvai, A.S.' 4 0000-0002-5376-3728 primary 'Mol, C.D.' 5 ? primary 'Tainer, J.A.' 6 0000-0003-1659-2429 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man '8-oxoguanine DNA glycosylase/AP lyase' 23402.398 1 3.2.2.-,4.2.99.18 ? ? ? 2 water nat water 18.015 63 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;ISEFGSIEKAISRRIKEFRQLGEKGEVEFDFRPFLDFSVKATIRTELAFCISTANSSATAGLKFQRLLGQGVGVKEALTL AGVRFHNRKAEYIREAFKSFKLVEKALEAESSKAREILLKIKGLG(MSE)KEASHFLRNVGREDVAIIDRHILRWLERQG YEVPGT(MSE)TAKKYLEVEKIL(MSE)EISEERGESLAE(MSE)DLRIWAE(MSE)TGKVLK ; _entity_poly.pdbx_seq_one_letter_code_can ;ISEFGSIEKAISRRIKEFRQLGEKGEVEFDFRPFLDFSVKATIRTELAFCISTANSSATAGLKFQRLLGQGVGVKEALTL AGVRFHNRKAEYIREAFKSFKLVEKALEAESSKAREILLKIKGLGMKEASHFLRNVGREDVAIIDRHILRWLERQGYEVP GTMTAKKYLEVEKILMEISEERGESLAEMDLRIWAEMTGKVLK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ILE n 1 2 SER n 1 3 GLU n 1 4 PHE n 1 5 GLY n 1 6 SER n 1 7 ILE n 1 8 GLU n 1 9 LYS n 1 10 ALA n 1 11 ILE n 1 12 SER n 1 13 ARG n 1 14 ARG n 1 15 ILE n 1 16 LYS n 1 17 GLU n 1 18 PHE n 1 19 ARG n 1 20 GLN n 1 21 LEU n 1 22 GLY n 1 23 GLU n 1 24 LYS n 1 25 GLY n 1 26 GLU n 1 27 VAL n 1 28 GLU n 1 29 PHE n 1 30 ASP n 1 31 PHE n 1 32 ARG n 1 33 PRO n 1 34 PHE n 1 35 LEU n 1 36 ASP n 1 37 PHE n 1 38 SER n 1 39 VAL n 1 40 LYS n 1 41 ALA n 1 42 THR n 1 43 ILE n 1 44 ARG n 1 45 THR n 1 46 GLU n 1 47 LEU n 1 48 ALA n 1 49 PHE n 1 50 CYS n 1 51 ILE n 1 52 SER n 1 53 THR n 1 54 ALA n 1 55 ASN n 1 56 SER n 1 57 SER n 1 58 ALA n 1 59 THR n 1 60 ALA n 1 61 GLY n 1 62 LEU n 1 63 LYS n 1 64 PHE n 1 65 GLN n 1 66 ARG n 1 67 LEU n 1 68 LEU n 1 69 GLY n 1 70 GLN n 1 71 GLY n 1 72 VAL n 1 73 GLY n 1 74 VAL n 1 75 LYS n 1 76 GLU n 1 77 ALA n 1 78 LEU n 1 79 THR n 1 80 LEU n 1 81 ALA n 1 82 GLY n 1 83 VAL n 1 84 ARG n 1 85 PHE n 1 86 HIS n 1 87 ASN n 1 88 ARG n 1 89 LYS n 1 90 ALA n 1 91 GLU n 1 92 TYR n 1 93 ILE n 1 94 ARG n 1 95 GLU n 1 96 ALA n 1 97 PHE n 1 98 LYS n 1 99 SER n 1 100 PHE n 1 101 LYS n 1 102 LEU n 1 103 VAL n 1 104 GLU n 1 105 LYS n 1 106 ALA n 1 107 LEU n 1 108 GLU n 1 109 ALA n 1 110 GLU n 1 111 SER n 1 112 SER n 1 113 LYS n 1 114 ALA n 1 115 ARG n 1 116 GLU n 1 117 ILE n 1 118 LEU n 1 119 LEU n 1 120 LYS n 1 121 ILE n 1 122 LYS n 1 123 GLY n 1 124 LEU n 1 125 GLY n 1 126 MSE n 1 127 LYS n 1 128 GLU n 1 129 ALA n 1 130 SER n 1 131 HIS n 1 132 PHE n 1 133 LEU n 1 134 ARG n 1 135 ASN n 1 136 VAL n 1 137 GLY n 1 138 ARG n 1 139 GLU n 1 140 ASP n 1 141 VAL n 1 142 ALA n 1 143 ILE n 1 144 ILE n 1 145 ASP n 1 146 ARG n 1 147 HIS n 1 148 ILE n 1 149 LEU n 1 150 ARG n 1 151 TRP n 1 152 LEU n 1 153 GLU n 1 154 ARG n 1 155 GLN n 1 156 GLY n 1 157 TYR n 1 158 GLU n 1 159 VAL n 1 160 PRO n 1 161 GLY n 1 162 THR n 1 163 MSE n 1 164 THR n 1 165 ALA n 1 166 LYS n 1 167 LYS n 1 168 TYR n 1 169 LEU n 1 170 GLU n 1 171 VAL n 1 172 GLU n 1 173 LYS n 1 174 ILE n 1 175 LEU n 1 176 MSE n 1 177 GLU n 1 178 ILE n 1 179 SER n 1 180 GLU n 1 181 GLU n 1 182 ARG n 1 183 GLY n 1 184 GLU n 1 185 SER n 1 186 LEU n 1 187 ALA n 1 188 GLU n 1 189 MSE n 1 190 ASP n 1 191 LEU n 1 192 ARG n 1 193 ILE n 1 194 TRP n 1 195 ALA n 1 196 GLU n 1 197 MSE n 1 198 THR n 1 199 GLY n 1 200 LYS n 1 201 VAL n 1 202 LEU n 1 203 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 203 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'ogg, AF_0371' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Archaeoglobus fulgidus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 2234 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ILE 1 -4 -4 ILE ILE A . n A 1 2 SER 2 -3 -3 SER SER A . n A 1 3 GLU 3 -2 -2 GLU GLU A . n A 1 4 PHE 4 -1 -1 PHE PHE A . n A 1 5 GLY 5 0 0 GLY GLY A . n A 1 6 SER 6 1 1 SER SER A . n A 1 7 ILE 7 2 2 ILE ILE A . n A 1 8 GLU 8 3 3 GLU GLU A . n A 1 9 LYS 9 4 4 LYS LYS A . n A 1 10 ALA 10 5 5 ALA ALA A . n A 1 11 ILE 11 6 6 ILE ILE A . n A 1 12 SER 12 7 7 SER SER A . n A 1 13 ARG 13 8 8 ARG ARG A . n A 1 14 ARG 14 9 9 ARG ARG A . n A 1 15 ILE 15 10 10 ILE ILE A . n A 1 16 LYS 16 11 11 LYS LYS A . n A 1 17 GLU 17 12 12 GLU GLU A . n A 1 18 PHE 18 13 13 PHE PHE A . n A 1 19 ARG 19 14 14 ARG ARG A . n A 1 20 GLN 20 15 15 GLN GLN A . n A 1 21 LEU 21 16 16 LEU LEU A . n A 1 22 GLY 22 17 17 GLY GLY A . n A 1 23 GLU 23 18 18 GLU GLU A . n A 1 24 LYS 24 19 19 LYS LYS A . n A 1 25 GLY 25 20 20 GLY GLY A . n A 1 26 GLU 26 21 21 GLU GLU A . n A 1 27 VAL 27 22 22 VAL VAL A . n A 1 28 GLU 28 23 23 GLU GLU A . n A 1 29 PHE 29 24 24 PHE PHE A . n A 1 30 ASP 30 25 25 ASP ASP A . n A 1 31 PHE 31 26 26 PHE PHE A . n A 1 32 ARG 32 27 27 ARG ARG A . n A 1 33 PRO 33 28 28 PRO PRO A . n A 1 34 PHE 34 29 29 PHE PHE A . n A 1 35 LEU 35 30 30 LEU LEU A . n A 1 36 ASP 36 31 31 ASP ASP A . n A 1 37 PHE 37 32 32 PHE PHE A . n A 1 38 SER 38 33 33 SER SER A . n A 1 39 VAL 39 34 34 VAL VAL A . n A 1 40 LYS 40 35 35 LYS LYS A . n A 1 41 ALA 41 36 36 ALA ALA A . n A 1 42 THR 42 37 37 THR THR A . n A 1 43 ILE 43 38 38 ILE ILE A . n A 1 44 ARG 44 39 39 ARG ARG A . n A 1 45 THR 45 40 40 THR THR A . n A 1 46 GLU 46 41 41 GLU GLU A . n A 1 47 LEU 47 42 42 LEU LEU A . n A 1 48 ALA 48 43 43 ALA ALA A . n A 1 49 PHE 49 44 44 PHE PHE A . n A 1 50 CYS 50 45 45 CYS CYS A . n A 1 51 ILE 51 46 46 ILE ILE A . n A 1 52 SER 52 47 47 SER SER A . n A 1 53 THR 53 48 48 THR THR A . n A 1 54 ALA 54 49 49 ALA ALA A . n A 1 55 ASN 55 50 50 ASN ASN A . n A 1 56 SER 56 51 51 SER SER A . n A 1 57 SER 57 52 52 SER SER A . n A 1 58 ALA 58 53 53 ALA ALA A . n A 1 59 THR 59 54 54 THR THR A . n A 1 60 ALA 60 55 55 ALA ALA A . n A 1 61 GLY 61 56 56 GLY GLY A . n A 1 62 LEU 62 57 57 LEU LEU A . n A 1 63 LYS 63 58 58 LYS LYS A . n A 1 64 PHE 64 59 59 PHE PHE A . n A 1 65 GLN 65 60 60 GLN GLN A . n A 1 66 ARG 66 61 61 ARG ARG A . n A 1 67 LEU 67 62 62 LEU LEU A . n A 1 68 LEU 68 63 63 LEU LEU A . n A 1 69 GLY 69 64 64 GLY GLY A . n A 1 70 GLN 70 65 65 GLN GLN A . n A 1 71 GLY 71 66 66 GLY GLY A . n A 1 72 VAL 72 67 67 VAL VAL A . n A 1 73 GLY 73 68 68 GLY GLY A . n A 1 74 VAL 74 69 69 VAL VAL A . n A 1 75 LYS 75 70 70 LYS LYS A . n A 1 76 GLU 76 71 71 GLU GLU A . n A 1 77 ALA 77 72 72 ALA ALA A . n A 1 78 LEU 78 73 73 LEU LEU A . n A 1 79 THR 79 74 74 THR THR A . n A 1 80 LEU 80 75 75 LEU LEU A . n A 1 81 ALA 81 76 76 ALA ALA A . n A 1 82 GLY 82 77 77 GLY GLY A . n A 1 83 VAL 83 78 78 VAL VAL A . n A 1 84 ARG 84 79 79 ARG ARG A . n A 1 85 PHE 85 80 80 PHE PHE A . n A 1 86 HIS 86 81 81 HIS HIS A . n A 1 87 ASN 87 82 82 ASN ASN A . n A 1 88 ARG 88 83 83 ARG ARG A . n A 1 89 LYS 89 84 84 LYS LYS A . n A 1 90 ALA 90 85 85 ALA ALA A . n A 1 91 GLU 91 86 86 GLU GLU A . n A 1 92 TYR 92 87 87 TYR TYR A . n A 1 93 ILE 93 88 88 ILE ILE A . n A 1 94 ARG 94 89 89 ARG ARG A . n A 1 95 GLU 95 90 90 GLU GLU A . n A 1 96 ALA 96 91 91 ALA ALA A . n A 1 97 PHE 97 92 92 PHE PHE A . n A 1 98 LYS 98 93 93 LYS LYS A . n A 1 99 SER 99 94 94 SER SER A . n A 1 100 PHE 100 95 95 PHE PHE A . n A 1 101 LYS 101 96 96 LYS LYS A . n A 1 102 LEU 102 97 97 LEU LEU A . n A 1 103 VAL 103 98 98 VAL VAL A . n A 1 104 GLU 104 99 99 GLU GLU A . n A 1 105 LYS 105 100 100 LYS LYS A . n A 1 106 ALA 106 101 101 ALA ALA A . n A 1 107 LEU 107 102 102 LEU LEU A . n A 1 108 GLU 108 103 103 GLU GLU A . n A 1 109 ALA 109 104 104 ALA ALA A . n A 1 110 GLU 110 105 105 GLU GLU A . n A 1 111 SER 111 106 106 SER SER A . n A 1 112 SER 112 107 107 SER SER A . n A 1 113 LYS 113 108 108 LYS LYS A . n A 1 114 ALA 114 109 109 ALA ALA A . n A 1 115 ARG 115 110 110 ARG ARG A . n A 1 116 GLU 116 111 111 GLU GLU A . n A 1 117 ILE 117 112 112 ILE ILE A . n A 1 118 LEU 118 113 113 LEU LEU A . n A 1 119 LEU 119 114 114 LEU LEU A . n A 1 120 LYS 120 115 115 LYS LYS A . n A 1 121 ILE 121 116 116 ILE ILE A . n A 1 122 LYS 122 117 117 LYS LYS A . n A 1 123 GLY 123 118 118 GLY GLY A . n A 1 124 LEU 124 119 119 LEU LEU A . n A 1 125 GLY 125 120 120 GLY GLY A . n A 1 126 MSE 126 121 121 MSE MSE A . n A 1 127 LYS 127 122 122 LYS LYS A . n A 1 128 GLU 128 123 123 GLU GLU A . n A 1 129 ALA 129 124 124 ALA ALA A . n A 1 130 SER 130 125 125 SER SER A . n A 1 131 HIS 131 126 126 HIS HIS A . n A 1 132 PHE 132 127 127 PHE PHE A . n A 1 133 LEU 133 128 128 LEU LEU A . n A 1 134 ARG 134 129 129 ARG ARG A . n A 1 135 ASN 135 130 130 ASN ASN A . n A 1 136 VAL 136 131 131 VAL VAL A . n A 1 137 GLY 137 132 132 GLY GLY A . n A 1 138 ARG 138 133 133 ARG ARG A . n A 1 139 GLU 139 134 134 GLU GLU A . n A 1 140 ASP 140 135 135 ASP ASP A . n A 1 141 VAL 141 136 136 VAL VAL A . n A 1 142 ALA 142 137 137 ALA ALA A . n A 1 143 ILE 143 138 138 ILE ILE A . n A 1 144 ILE 144 139 139 ILE ILE A . n A 1 145 ASP 145 140 140 ASP ASP A . n A 1 146 ARG 146 141 141 ARG ARG A . n A 1 147 HIS 147 142 142 HIS HIS A . n A 1 148 ILE 148 143 143 ILE ILE A . n A 1 149 LEU 149 144 144 LEU LEU A . n A 1 150 ARG 150 145 145 ARG ARG A . n A 1 151 TRP 151 146 146 TRP TRP A . n A 1 152 LEU 152 147 147 LEU LEU A . n A 1 153 GLU 153 148 148 GLU GLU A . n A 1 154 ARG 154 149 149 ARG ARG A . n A 1 155 GLN 155 150 150 GLN GLN A . n A 1 156 GLY 156 151 151 GLY GLY A . n A 1 157 TYR 157 152 152 TYR TYR A . n A 1 158 GLU 158 153 153 GLU GLU A . n A 1 159 VAL 159 154 154 VAL VAL A . n A 1 160 PRO 160 155 155 PRO PRO A . n A 1 161 GLY 161 156 156 GLY GLY A . n A 1 162 THR 162 157 157 THR THR A . n A 1 163 MSE 163 158 158 MSE MSE A . n A 1 164 THR 164 159 159 THR THR A . n A 1 165 ALA 165 160 160 ALA ALA A . n A 1 166 LYS 166 161 161 LYS LYS A . n A 1 167 LYS 167 162 162 LYS LYS A . n A 1 168 TYR 168 163 163 TYR TYR A . n A 1 169 LEU 169 164 164 LEU LEU A . n A 1 170 GLU 170 165 165 GLU GLU A . n A 1 171 VAL 171 166 166 VAL VAL A . n A 1 172 GLU 172 167 167 GLU GLU A . n A 1 173 LYS 173 168 168 LYS LYS A . n A 1 174 ILE 174 169 169 ILE ILE A . n A 1 175 LEU 175 170 170 LEU LEU A . n A 1 176 MSE 176 171 171 MSE MSE A . n A 1 177 GLU 177 172 172 GLU GLU A . n A 1 178 ILE 178 173 173 ILE ILE A . n A 1 179 SER 179 174 174 SER SER A . n A 1 180 GLU 180 175 175 GLU GLU A . n A 1 181 GLU 181 176 176 GLU GLU A . n A 1 182 ARG 182 177 177 ARG ARG A . n A 1 183 GLY 183 178 178 GLY GLY A . n A 1 184 GLU 184 179 179 GLU GLU A . n A 1 185 SER 185 180 180 SER SER A . n A 1 186 LEU 186 181 181 LEU LEU A . n A 1 187 ALA 187 182 182 ALA ALA A . n A 1 188 GLU 188 183 183 GLU GLU A . n A 1 189 MSE 189 184 184 MSE MSE A . n A 1 190 ASP 190 185 185 ASP ASP A . n A 1 191 LEU 191 186 186 LEU LEU A . n A 1 192 ARG 192 187 187 ARG ARG A . n A 1 193 ILE 193 188 188 ILE ILE A . n A 1 194 TRP 194 189 189 TRP TRP A . n A 1 195 ALA 195 190 190 ALA ALA A . n A 1 196 GLU 196 191 191 GLU GLU A . n A 1 197 MSE 197 192 192 MSE MSE A . n A 1 198 THR 198 193 193 THR THR A . n A 1 199 GLY 199 194 194 GLY GLY A . n A 1 200 LYS 200 195 195 LYS LYS A . n A 1 201 VAL 201 196 196 VAL VAL A . n A 1 202 LEU 202 197 197 LEU LEU A . n A 1 203 LYS 203 198 198 LYS LYS A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 201 40 HOH HOH A . B 2 HOH 2 202 43 HOH HOH A . B 2 HOH 3 203 24 HOH HOH A . B 2 HOH 4 204 20 HOH HOH A . B 2 HOH 5 205 51 HOH HOH A . B 2 HOH 6 206 28 HOH HOH A . B 2 HOH 7 207 19 HOH HOH A . B 2 HOH 8 208 12 HOH HOH A . B 2 HOH 9 209 53 HOH HOH A . B 2 HOH 10 210 47 HOH HOH A . B 2 HOH 11 211 44 HOH HOH A . B 2 HOH 12 212 16 HOH HOH A . B 2 HOH 13 213 32 HOH HOH A . B 2 HOH 14 214 36 HOH HOH A . B 2 HOH 15 215 7 HOH HOH A . B 2 HOH 16 216 9 HOH HOH A . B 2 HOH 17 217 54 HOH HOH A . B 2 HOH 18 218 22 HOH HOH A . B 2 HOH 19 219 13 HOH HOH A . B 2 HOH 20 220 60 HOH HOH A . B 2 HOH 21 221 35 HOH HOH A . B 2 HOH 22 222 31 HOH HOH A . B 2 HOH 23 223 2 HOH HOH A . B 2 HOH 24 224 14 HOH HOH A . B 2 HOH 25 225 52 HOH HOH A . B 2 HOH 26 226 45 HOH HOH A . B 2 HOH 27 227 58 HOH HOH A . B 2 HOH 28 228 57 HOH HOH A . B 2 HOH 29 229 59 HOH HOH A . B 2 HOH 30 230 17 HOH HOH A . B 2 HOH 31 231 25 HOH HOH A . B 2 HOH 32 232 42 HOH HOH A . B 2 HOH 33 233 37 HOH HOH A . B 2 HOH 34 234 56 HOH HOH A . B 2 HOH 35 235 21 HOH HOH A . B 2 HOH 36 236 11 HOH HOH A . B 2 HOH 37 237 10 HOH HOH A . B 2 HOH 38 238 5 HOH HOH A . B 2 HOH 39 239 3 HOH HOH A . B 2 HOH 40 240 62 HOH HOH A . B 2 HOH 41 241 63 HOH HOH A . B 2 HOH 42 242 15 HOH HOH A . B 2 HOH 43 243 30 HOH HOH A . B 2 HOH 44 244 55 HOH HOH A . B 2 HOH 45 245 46 HOH HOH A . B 2 HOH 46 246 39 HOH HOH A . B 2 HOH 47 247 8 HOH HOH A . B 2 HOH 48 248 41 HOH HOH A . B 2 HOH 49 249 6 HOH HOH A . B 2 HOH 50 250 4 HOH HOH A . B 2 HOH 51 251 23 HOH HOH A . B 2 HOH 52 252 26 HOH HOH A . B 2 HOH 53 253 1 HOH HOH A . B 2 HOH 54 254 33 HOH HOH A . B 2 HOH 55 255 38 HOH HOH A . B 2 HOH 56 256 29 HOH HOH A . B 2 HOH 57 257 48 HOH HOH A . B 2 HOH 58 258 50 HOH HOH A . B 2 HOH 59 259 34 HOH HOH A . B 2 HOH 60 260 49 HOH HOH A . B 2 HOH 61 261 27 HOH HOH A . B 2 HOH 62 262 18 HOH HOH A . B 2 HOH 63 263 61 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 93 ? CG ? A LYS 98 CG 2 1 Y 1 A LYS 93 ? CD ? A LYS 98 CD 3 1 Y 1 A LYS 93 ? CE ? A LYS 98 CE 4 1 Y 1 A LYS 93 ? NZ ? A LYS 98 NZ 5 1 Y 1 A GLU 153 ? CG ? A GLU 158 CG 6 1 Y 1 A GLU 153 ? CD ? A GLU 158 CD 7 1 Y 1 A GLU 153 ? OE1 ? A GLU 158 OE1 8 1 Y 1 A GLU 153 ? OE2 ? A GLU 158 OE2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.20.1_4487: ???)' ? 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . ? 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? AutoSol ? ? ? . ? 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . ? 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 9O00 _cell.details ? _cell.formula_units_Z ? _cell.length_a 86.508 _cell.length_a_esd ? _cell.length_b 106.499 _cell.length_b_esd ? _cell.length_c 141.698 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 16 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9O00 _symmetry.cell_setting ? _symmetry.Int_Tables_number 22 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'F 2 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9O00 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.52 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 65.07 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '100 mM imidazole/malate, pH 5.0, 75% ammonium sulfate (saturated)' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 298 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2000-05-19 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.979 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRL BEAMLINE BL9-2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.979 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL9-2 _diffrn_source.pdbx_synchrotron_site SSRL # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 9O00 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.93 _reflns.d_resolution_low 42.57 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 21581 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 87.7 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 16.3 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.075 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.93 _reflns_shell.d_res_low 1.98 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 906 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.374 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9O00 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.93 _refine.ls_d_res_low 42.57 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 21565 _refine.ls_number_reflns_R_free 1999 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 86.59 _refine.ls_percent_reflns_R_free 9.23 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2178 _refine.ls_R_factor_R_free 0.2426 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2152 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values MLHL _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.10 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 30.02 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.27 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.93 _refine_hist.d_res_low 42.57 _refine_hist.number_atoms_solvent 63 _refine_hist.number_atoms_total 1683 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1620 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.009 ? ? ? f_bond_d ? ? ? 'X-RAY DIFFRACTION' ? 1.235 ? ? ? f_angle_d ? ? ? 'X-RAY DIFFRACTION' ? 6.110 ? 226 ? f_dihedral_angle_d ? ? ? 'X-RAY DIFFRACTION' ? 0.049 ? 244 ? f_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.012 ? 282 ? f_plane_restr ? ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.93 1.96 . . 73 730 46.00 . . . . 0.4832 . . . . . . . . . . . . . . . 0.4407 'X-RAY DIFFRACTION' 1.96 1.98 . . 92 886 55.00 . . . . 0.4416 . . . . . . . . . . . . . . . 0.5708 'X-RAY DIFFRACTION' 1.98 2.01 . . 95 951 60.00 . . . . 0.3699 . . . . . . . . . . . . . . . 0.3457 'X-RAY DIFFRACTION' 2.01 2.04 . . 100 993 63.00 . . . . 0.3587 . . . . . . . . . . . . . . . 0.3434 'X-RAY DIFFRACTION' 2.04 2.07 . . 110 1079 66.00 . . . . 0.3506 . . . . . . . . . . . . . . . 0.3966 'X-RAY DIFFRACTION' 2.07 2.10 . . 114 1104 70.00 . . . . 0.3379 . . . . . . . . . . . . . . . 0.3465 'X-RAY DIFFRACTION' 2.10 2.13 . . 125 1212 77.00 . . . . 0.3098 . . . . . . . . . . . . . . . 0.3626 'X-RAY DIFFRACTION' 2.13 2.17 . . 128 1256 78.00 . . . . 0.2906 . . . . . . . . . . . . . . . 0.2859 'X-RAY DIFFRACTION' 2.17 2.21 . . 143 1429 89.00 . . . . 0.2814 . . . . . . . . . . . . . . . 0.3280 'X-RAY DIFFRACTION' 2.21 2.25 . . 151 1480 95.00 . . . . 0.2656 . . . . . . . . . . . . . . . 0.2814 'X-RAY DIFFRACTION' 2.25 2.30 . . 163 1567 98.00 . . . . 0.2608 . . . . . . . . . . . . . . . 0.2633 'X-RAY DIFFRACTION' 2.30 2.35 . . 158 1554 98.00 . . . . 0.2556 . . . . . . . . . . . . . . . 0.2967 'X-RAY DIFFRACTION' 2.35 2.40 . . 162 1562 98.00 . . . . 0.2488 . . . . . . . . . . . . . . . 0.3092 'X-RAY DIFFRACTION' 2.40 2.46 . . 161 1595 98.00 . . . . 0.2369 . . . . . . . . . . . . . . . 0.2269 'X-RAY DIFFRACTION' 2.46 2.53 . . 165 1578 98.00 . . . . 0.2349 . . . . . . . . . . . . . . . 0.2700 'X-RAY DIFFRACTION' 2.53 2.60 . . 153 1513 97.00 . . . . 0.2439 . . . . . . . . . . . . . . . 0.2728 'X-RAY DIFFRACTION' 2.60 2.69 . . 159 1576 98.00 . . . . 0.2292 . . . . . . . . . . . . . . . 0.2572 'X-RAY DIFFRACTION' 2.69 2.78 . . 156 1537 97.00 . . . . 0.2269 . . . . . . . . . . . . . . . 0.2286 'X-RAY DIFFRACTION' 2.79 2.90 . . 159 1550 97.00 . . . . 0.2524 . . . . . . . . . . . . . . . 0.2535 'X-RAY DIFFRACTION' 2.90 3.03 . . 157 1553 97.00 . . . . 0.2364 . . . . . . . . . . . . . . . 0.2857 'X-RAY DIFFRACTION' 3.03 3.19 . . 154 1550 96.00 . . . . 0.2289 . . . . . . . . . . . . . . . 0.2772 'X-RAY DIFFRACTION' 3.19 3.39 . . 155 1533 97.00 . . . . 0.2106 . . . . . . . . . . . . . . . 0.2345 'X-RAY DIFFRACTION' 3.39 3.65 . . 162 1542 96.00 . . . . 0.1934 . . . . . . . . . . . . . . . 0.1821 'X-RAY DIFFRACTION' 3.65 4.02 . . 153 1519 95.00 . . . . 0.1675 . . . . . . . . . . . . . . . 0.2028 'X-RAY DIFFRACTION' 4.02 4.59 . . 146 1519 94.00 . . . . 0.1573 . . . . . . . . . . . . . . . 0.1859 'X-RAY DIFFRACTION' 4.60 5.79 . . 152 1484 93.00 . . . . 0.1829 . . . . . . . . . . . . . . . 0.2096 'X-RAY DIFFRACTION' 5.80 42.57 . . 148 1474 91.00 . . . . 0.1837 . . . . . . . . . . . . . . . 0.2254 # _struct.entry_id 9O00 _struct.title 'Crystal structure of AfOgg1 in a DNA-free state' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9O00 _struct_keywords.text 'DNA-glycosylase, AP-lyase, HYDROLASE, LYASE' _struct_keywords.pdbx_keywords 'HYDROLASE, LYASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code OGG1_ARCFU _struct_ref.pdbx_db_accession O29876 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;IEKAISRRIKEFRQLGEKGEVEFDFRPFLDFSVKATIRTELAFCISTANSSATAGLKFQRLLGQGVGVKEALTLAGVRFH NRKAEYIREAFKSFKLVEKALEAESSKAREILLKIKGLGMKEASHFLRNVGREDVAIIDRHILRWLERQGYEVPGTMTAK KYLEVEKILMEISEERGESLAEMDLRIWAEMTGKVLK ; _struct_ref.pdbx_align_begin 2 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9O00 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 7 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 203 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O29876 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 198 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 198 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9O00 ILE A 1 ? UNP O29876 ? ? 'expression tag' -4 1 1 9O00 SER A 2 ? UNP O29876 ? ? 'expression tag' -3 2 1 9O00 GLU A 3 ? UNP O29876 ? ? 'expression tag' -2 3 1 9O00 PHE A 4 ? UNP O29876 ? ? 'expression tag' -1 4 1 9O00 GLY A 5 ? UNP O29876 ? ? 'expression tag' 0 5 1 9O00 SER A 6 ? UNP O29876 ? ? 'expression tag' 1 6 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 10390 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 2 ? GLY A 25 ? SER A -3 GLY A 20 1 ? 24 HELX_P HELX_P2 AA2 ILE A 43 ? THR A 53 ? ILE A 38 THR A 48 1 ? 11 HELX_P HELX_P3 AA3 SER A 57 ? GLY A 69 ? SER A 52 GLY A 64 1 ? 13 HELX_P HELX_P4 AA4 GLY A 73 ? ALA A 81 ? GLY A 68 ALA A 76 1 ? 9 HELX_P HELX_P5 AA5 PHE A 85 ? SER A 99 ? PHE A 80 SER A 94 1 ? 15 HELX_P HELX_P6 AA6 SER A 99 ? GLU A 108 ? SER A 94 GLU A 103 1 ? 10 HELX_P HELX_P7 AA7 GLU A 110 ? LEU A 119 ? GLU A 105 LEU A 114 1 ? 10 HELX_P HELX_P8 AA8 GLY A 125 ? VAL A 136 ? GLY A 120 VAL A 131 1 ? 12 HELX_P HELX_P9 AA9 ASP A 145 ? GLN A 155 ? ASP A 140 GLN A 150 1 ? 11 HELX_P HELX_P10 AB1 THR A 164 ? GLY A 183 ? THR A 159 GLY A 178 1 ? 20 HELX_P HELX_P11 AB2 SER A 185 ? GLY A 199 ? SER A 180 GLY A 194 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A GLY 125 C ? ? ? 1_555 A MSE 126 N ? ? A GLY 120 A MSE 121 1_555 ? ? ? ? ? ? ? 1.332 ? ? covale2 covale both ? A MSE 126 C ? ? ? 1_555 A LYS 127 N ? ? A MSE 121 A LYS 122 1_555 ? ? ? ? ? ? ? 1.335 ? ? covale3 covale both ? A THR 162 C ? ? ? 1_555 A MSE 163 N ? ? A THR 157 A MSE 158 1_555 ? ? ? ? ? ? ? 1.324 ? ? covale4 covale both ? A MSE 163 C ? ? ? 1_555 A THR 164 N ? ? A MSE 158 A THR 159 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale5 covale both ? A LEU 175 C ? ? ? 1_555 A MSE 176 N ? ? A LEU 170 A MSE 171 1_555 ? ? ? ? ? ? ? 1.326 ? ? covale6 covale both ? A MSE 176 C ? ? ? 1_555 A GLU 177 N ? ? A MSE 171 A GLU 172 1_555 ? ? ? ? ? ? ? 1.335 ? ? covale7 covale both ? A GLU 188 C ? ? ? 1_555 A MSE 189 N ? ? A GLU 183 A MSE 184 1_555 ? ? ? ? ? ? ? 1.322 ? ? covale8 covale both ? A MSE 189 C ? ? ? 1_555 A ASP 190 N ? ? A MSE 184 A ASP 185 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale9 covale both ? A GLU 196 C ? ? ? 1_555 A MSE 197 N ? ? A GLU 191 A MSE 192 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale10 covale both ? A MSE 197 C ? ? ? 1_555 A THR 198 N ? ? A MSE 192 A THR 193 1_555 ? ? ? ? ? ? ? 1.339 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 MSE A 126 ? . . . . MSE A 121 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 2 MSE A 163 ? . . . . MSE A 158 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 3 MSE A 176 ? . . . . MSE A 171 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 4 MSE A 189 ? . . . . MSE A 184 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 5 MSE A 197 ? . . . . MSE A 192 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ARG _struct_mon_prot_cis.label_seq_id 32 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ARG _struct_mon_prot_cis.auth_seq_id 27 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 33 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 28 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 0.14 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLU A 26 ? ASP A 30 ? GLU A 21 ASP A 25 AA1 2 SER A 38 ? THR A 42 ? SER A 33 THR A 37 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id PHE _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 29 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id PHE _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 24 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id VAL _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 39 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id VAL _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 34 # _pdbx_entry_details.entry_id 9O00 _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A GLU 105 ? ? H A ALA 109 ? ? 1.54 2 1 H A ILE 138 ? ? O A HOH 207 ? ? 1.59 3 1 OE1 A GLU 23 ? ? O A HOH 201 ? ? 1.86 4 1 ND1 A HIS 81 ? ? O A HOH 202 ? ? 2.03 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 OE2 _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 GLU _pdbx_validate_symm_contact.auth_seq_id_1 99 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 OE2 _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 GLU _pdbx_validate_symm_contact.auth_seq_id_2 99 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 2_665 _pdbx_validate_symm_contact.dist 1.98 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CG A GLU 99 ? ? CD A GLU 99 ? ? 1.389 1.515 -0.126 0.015 N 2 1 CD A GLU 175 ? ? OE2 A GLU 175 ? ? 1.147 1.252 -0.105 0.011 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CA A GLU 175 ? ? CB A GLU 175 ? ? CG A GLU 175 ? ? 99.88 113.40 -13.52 2.20 N 2 1 OE1 A GLU 175 ? ? CD A GLU 175 ? ? OE2 A GLU 175 ? ? 104.49 123.30 -18.81 1.20 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 31 ? ? -91.83 58.29 2 1 SER A 51 ? ? -177.35 145.33 3 1 SER A 94 ? ? -86.98 39.70 4 1 LEU A 197 ? ? -102.74 -119.95 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 1 _pdbx_validate_planes.auth_comp_id GLU _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 175 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.118 _pdbx_validate_planes.type 'SIDE CHAIN' # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 126 A MSE 121 ? MET 'modified residue' 2 A MSE 163 A MSE 158 ? MET 'modified residue' 3 A MSE 176 A MSE 171 ? MET 'modified residue' 4 A MSE 189 A MSE 184 ? MET 'modified residue' 5 A MSE 197 A MSE 192 ? MET 'modified residue' # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 226 ? B HOH . 2 1 A HOH 257 ? B HOH . # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MSE N N N N 230 MSE CA C N S 231 MSE C C N N 232 MSE O O N N 233 MSE OXT O N N 234 MSE CB C N N 235 MSE CG C N N 236 MSE SE SE N N 237 MSE CE C N N 238 MSE H H N N 239 MSE H2 H N N 240 MSE HA H N N 241 MSE HXT H N N 242 MSE HB2 H N N 243 MSE HB3 H N N 244 MSE HG2 H N N 245 MSE HG3 H N N 246 MSE HE1 H N N 247 MSE HE2 H N N 248 MSE HE3 H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TRP N N N N 321 TRP CA C N S 322 TRP C C N N 323 TRP O O N N 324 TRP CB C N N 325 TRP CG C Y N 326 TRP CD1 C Y N 327 TRP CD2 C Y N 328 TRP NE1 N Y N 329 TRP CE2 C Y N 330 TRP CE3 C Y N 331 TRP CZ2 C Y N 332 TRP CZ3 C Y N 333 TRP CH2 C Y N 334 TRP OXT O N N 335 TRP H H N N 336 TRP H2 H N N 337 TRP HA H N N 338 TRP HB2 H N N 339 TRP HB3 H N N 340 TRP HD1 H N N 341 TRP HE1 H N N 342 TRP HE3 H N N 343 TRP HZ2 H N N 344 TRP HZ3 H N N 345 TRP HH2 H N N 346 TRP HXT H N N 347 TYR N N N N 348 TYR CA C N S 349 TYR C C N N 350 TYR O O N N 351 TYR CB C N N 352 TYR CG C Y N 353 TYR CD1 C Y N 354 TYR CD2 C Y N 355 TYR CE1 C Y N 356 TYR CE2 C Y N 357 TYR CZ C Y N 358 TYR OH O N N 359 TYR OXT O N N 360 TYR H H N N 361 TYR H2 H N N 362 TYR HA H N N 363 TYR HB2 H N N 364 TYR HB3 H N N 365 TYR HD1 H N N 366 TYR HD2 H N N 367 TYR HE1 H N N 368 TYR HE2 H N N 369 TYR HH H N N 370 TYR HXT H N N 371 VAL N N N N 372 VAL CA C N S 373 VAL C C N N 374 VAL O O N N 375 VAL CB C N N 376 VAL CG1 C N N 377 VAL CG2 C N N 378 VAL OXT O N N 379 VAL H H N N 380 VAL H2 H N N 381 VAL HA H N N 382 VAL HB H N N 383 VAL HG11 H N N 384 VAL HG12 H N N 385 VAL HG13 H N N 386 VAL HG21 H N N 387 VAL HG22 H N N 388 VAL HG23 H N N 389 VAL HXT H N N 390 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MSE N CA sing N N 218 MSE N H sing N N 219 MSE N H2 sing N N 220 MSE CA C sing N N 221 MSE CA CB sing N N 222 MSE CA HA sing N N 223 MSE C O doub N N 224 MSE C OXT sing N N 225 MSE OXT HXT sing N N 226 MSE CB CG sing N N 227 MSE CB HB2 sing N N 228 MSE CB HB3 sing N N 229 MSE CG SE sing N N 230 MSE CG HG2 sing N N 231 MSE CG HG3 sing N N 232 MSE SE CE sing N N 233 MSE CE HE1 sing N N 234 MSE CE HE2 sing N N 235 MSE CE HE3 sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Cancer Institute (NIH/NCI)' 'United States' 'P01 CA092584' 1 'National Institutes of Health/National Cancer Institute (NIH/NCI)' 'United States' 'R35 CA220430' 2 # _atom_sites.entry_id 9O00 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.011560 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009390 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007057 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S SE # loop_ #