data_9O9K # _entry.id 9O9K # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.414 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9O9K pdb_00009o9k 10.2210/pdb9o9k/pdb WWPDB D_1000295110 ? ? EMDB EMD-70253 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2026-05-20 ? 2 'EM metadata' 1 0 2026-05-20 ? 3 FSC 1 0 2026-05-20 ? 4 'Half map' 1 0 2026-05-20 1 5 'Half map' 1 0 2026-05-20 2 6 Image 1 0 2026-05-20 ? 7 Mask 1 0 2026-05-20 1 8 'Primary map' 1 0 2026-05-20 ? # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 2 'EM metadata' repository 'Initial release' ? ? 3 3 FSC repository 'Initial release' ? ? 4 4 'Half map' repository 'Initial release' ? ? 5 5 'Half map' repository 'Initial release' ? ? 6 6 Image repository 'Initial release' ? ? 7 7 Mask repository 'Initial release' ? ? 8 8 'Primary map' repository 'Initial release' ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9O9K _pdbx_database_status.recvd_initial_deposition_date 2025-04-18 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name EMDB _pdbx_database_related.details ;Cryo-EM structure of alpha-synuclein filaments from Parkinson's disease with H50Q variant in SNCA ; _pdbx_database_related.db_id EMD-70253 _pdbx_database_related.content_type 'associated EM volume' # loop_ _pdbx_contact_author.id _pdbx_contact_author.email _pdbx_contact_author.name_first _pdbx_contact_author.name_last _pdbx_contact_author.name_mi _pdbx_contact_author.role _pdbx_contact_author.identifier_ORCID 2 scheres@mrc-lmb.cam.ac.uk Sjors Scheres H.W. 'principal investigator/group leader' 0000-0002-0462-6540 3 mg@mrc-lmb.cam.ac.uk Michel Goedert ? 'principal investigator/group leader' 0000-0002-5214-7886 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Yang, Y.' 1 0000-0003-2238-6437 'Murzin, G.A.' 2 0000-0002-1809-9518 'Scheres, H.W.S.' 3 0000-0002-0462-6540 'Goedert, M.' 4 0000-0002-5214-7886 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title ;Cryo-EM structure of alpha-synuclein filaments from Parkinson's disease with H50Q variant in SNCA ; _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Yang, Y.' 1 0000-0003-2238-6437 primary 'Murzin, G.A.' 2 0000-0002-1809-9518 primary 'Scheres, H.W.S.' 3 0000-0002-0462-6540 primary 'Goedert, M.' 4 0000-0002-5214-7886 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer nat Alpha-synuclein 14466.091 1 ? ? ? ? 2 polymer nat 'unassigned chain' 720.986 2 ? ? ? ? 3 water nat water 18.015 10 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Non-A beta component of AD amyloid,Non-A4 component of amyloid precursor,NACP' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVQGVATVAEKTKEQVTNVGGAVVTGVTAVAQK TVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA ; ;MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVQGVATVAEKTKEQVTNVGGAVVTGVTAVAQK TVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA ; A ? 2 polyribonucleotide no no '(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)' XXXXXXXXX B,C ? # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASP n 1 3 VAL n 1 4 PHE n 1 5 MET n 1 6 LYS n 1 7 GLY n 1 8 LEU n 1 9 SER n 1 10 LYS n 1 11 ALA n 1 12 LYS n 1 13 GLU n 1 14 GLY n 1 15 VAL n 1 16 VAL n 1 17 ALA n 1 18 ALA n 1 19 ALA n 1 20 GLU n 1 21 LYS n 1 22 THR n 1 23 LYS n 1 24 GLN n 1 25 GLY n 1 26 VAL n 1 27 ALA n 1 28 GLU n 1 29 ALA n 1 30 ALA n 1 31 GLY n 1 32 LYS n 1 33 THR n 1 34 LYS n 1 35 GLU n 1 36 GLY n 1 37 VAL n 1 38 LEU n 1 39 TYR n 1 40 VAL n 1 41 GLY n 1 42 SER n 1 43 LYS n 1 44 THR n 1 45 LYS n 1 46 GLU n 1 47 GLY n 1 48 VAL n 1 49 VAL n 1 50 GLN n 1 51 GLY n 1 52 VAL n 1 53 ALA n 1 54 THR n 1 55 VAL n 1 56 ALA n 1 57 GLU n 1 58 LYS n 1 59 THR n 1 60 LYS n 1 61 GLU n 1 62 GLN n 1 63 VAL n 1 64 THR n 1 65 ASN n 1 66 VAL n 1 67 GLY n 1 68 GLY n 1 69 ALA n 1 70 VAL n 1 71 VAL n 1 72 THR n 1 73 GLY n 1 74 VAL n 1 75 THR n 1 76 ALA n 1 77 VAL n 1 78 ALA n 1 79 GLN n 1 80 LYS n 1 81 THR n 1 82 VAL n 1 83 GLU n 1 84 GLY n 1 85 ALA n 1 86 GLY n 1 87 SER n 1 88 ILE n 1 89 ALA n 1 90 ALA n 1 91 ALA n 1 92 THR n 1 93 GLY n 1 94 PHE n 1 95 VAL n 1 96 LYS n 1 97 LYS n 1 98 ASP n 1 99 GLN n 1 100 LEU n 1 101 GLY n 1 102 LYS n 1 103 ASN n 1 104 GLU n 1 105 GLU n 1 106 GLY n 1 107 ALA n 1 108 PRO n 1 109 GLN n 1 110 GLU n 1 111 GLY n 1 112 ILE n 1 113 LEU n 1 114 GLU n 1 115 ASP n 1 116 MET n 1 117 PRO n 1 118 VAL n 1 119 ASP n 1 120 PRO n 1 121 ASP n 1 122 ASN n 1 123 GLU n 1 124 ALA n 1 125 TYR n 1 126 GLU n 1 127 MET n 1 128 PRO n 1 129 SER n 1 130 GLU n 1 131 GLU n 1 132 GLY n 1 133 TYR n 1 134 GLN n 1 135 ASP n 1 136 TYR n 1 137 GLU n 1 138 PRO n 1 139 GLU n 1 140 ALA n 2 1 UNK n 2 2 UNK n 2 3 UNK n 2 4 UNK n 2 5 UNK n 2 6 UNK n 2 7 UNK n 2 8 UNK n 2 9 UNK n # loop_ _entity_src_nat.entity_id _entity_src_nat.pdbx_src_id _entity_src_nat.pdbx_alt_source_flag _entity_src_nat.pdbx_beg_seq_num _entity_src_nat.pdbx_end_seq_num _entity_src_nat.common_name _entity_src_nat.pdbx_organism_scientific _entity_src_nat.pdbx_ncbi_taxonomy_id _entity_src_nat.genus _entity_src_nat.species _entity_src_nat.strain _entity_src_nat.tissue _entity_src_nat.tissue_fraction _entity_src_nat.pdbx_secretion _entity_src_nat.pdbx_fragment _entity_src_nat.pdbx_variant _entity_src_nat.pdbx_cell_line _entity_src_nat.pdbx_atcc _entity_src_nat.pdbx_cellular_location _entity_src_nat.pdbx_organ _entity_src_nat.pdbx_organelle _entity_src_nat.pdbx_cell _entity_src_nat.pdbx_plasmid_name _entity_src_nat.pdbx_plasmid_details _entity_src_nat.details 1 1 sample 1 140 human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 sample 1 9 human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 UNK 'L-peptide linking' . UNKNOWN ? 'C4 H9 N O2' 103.120 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ASP 2 2 ? ? ? A . n A 1 3 VAL 3 3 ? ? ? A . n A 1 4 PHE 4 4 ? ? ? A . n A 1 5 MET 5 5 ? ? ? A . n A 1 6 LYS 6 6 ? ? ? A . n A 1 7 GLY 7 7 ? ? ? A . n A 1 8 LEU 8 8 ? ? ? A . n A 1 9 SER 9 9 ? ? ? A . n A 1 10 LYS 10 10 ? ? ? A . n A 1 11 ALA 11 11 ? ? ? A . n A 1 12 LYS 12 12 ? ? ? A . n A 1 13 GLU 13 13 ? ? ? A . n A 1 14 GLY 14 14 ? ? ? A . n A 1 15 VAL 15 15 ? ? ? A . n A 1 16 VAL 16 16 ? ? ? A . n A 1 17 ALA 17 17 ? ? ? A . n A 1 18 ALA 18 18 ? ? ? A . n A 1 19 ALA 19 19 ? ? ? A . n A 1 20 GLU 20 20 ? ? ? A . n A 1 21 LYS 21 21 ? ? ? A . n A 1 22 THR 22 22 ? ? ? A . n A 1 23 LYS 23 23 ? ? ? A . n A 1 24 GLN 24 24 ? ? ? A . n A 1 25 GLY 25 25 ? ? ? A . n A 1 26 VAL 26 26 ? ? ? A . n A 1 27 ALA 27 27 ? ? ? A . n A 1 28 GLU 28 28 ? ? ? A . n A 1 29 ALA 29 29 ? ? ? A . n A 1 30 ALA 30 30 ? ? ? A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 TYR 39 39 39 TYR TYR A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 SER 42 42 42 SER SER A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 THR 54 54 54 THR THR A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 GLN 62 62 62 GLN GLN A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 THR 64 64 64 THR THR A . n A 1 65 ASN 65 65 65 ASN ASN A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 THR 72 72 72 THR THR A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 THR 75 75 75 THR THR A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 GLN 79 79 79 GLN GLN A . n A 1 80 LYS 80 80 80 LYS LYS A . n A 1 81 THR 81 81 81 THR THR A . n A 1 82 VAL 82 82 82 VAL VAL A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 ALA 85 85 85 ALA ALA A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 SER 87 87 87 SER SER A . n A 1 88 ILE 88 88 88 ILE ILE A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 ALA 91 91 91 ALA ALA A . n A 1 92 THR 92 92 92 THR THR A . n A 1 93 GLY 93 93 93 GLY GLY A . n A 1 94 PHE 94 94 94 PHE PHE A . n A 1 95 VAL 95 95 95 VAL VAL A . n A 1 96 LYS 96 96 96 LYS LYS A . n A 1 97 LYS 97 97 97 LYS LYS A . n A 1 98 ASP 98 98 98 ASP ASP A . n A 1 99 GLN 99 99 99 GLN GLN A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 GLY 101 101 ? ? ? A . n A 1 102 LYS 102 102 ? ? ? A . n A 1 103 ASN 103 103 ? ? ? A . n A 1 104 GLU 104 104 ? ? ? A . n A 1 105 GLU 105 105 ? ? ? A . n A 1 106 GLY 106 106 ? ? ? A . n A 1 107 ALA 107 107 ? ? ? A . n A 1 108 PRO 108 108 ? ? ? A . n A 1 109 GLN 109 109 ? ? ? A . n A 1 110 GLU 110 110 ? ? ? A . n A 1 111 GLY 111 111 ? ? ? A . n A 1 112 ILE 112 112 ? ? ? A . n A 1 113 LEU 113 113 ? ? ? A . n A 1 114 GLU 114 114 ? ? ? A . n A 1 115 ASP 115 115 ? ? ? A . n A 1 116 MET 116 116 ? ? ? A . n A 1 117 PRO 117 117 ? ? ? A . n A 1 118 VAL 118 118 ? ? ? A . n A 1 119 ASP 119 119 ? ? ? A . n A 1 120 PRO 120 120 ? ? ? A . n A 1 121 ASP 121 121 ? ? ? A . n A 1 122 ASN 122 122 ? ? ? A . n A 1 123 GLU 123 123 ? ? ? A . n A 1 124 ALA 124 124 ? ? ? A . n A 1 125 TYR 125 125 ? ? ? A . n A 1 126 GLU 126 126 ? ? ? A . n A 1 127 MET 127 127 ? ? ? A . n A 1 128 PRO 128 128 ? ? ? A . n A 1 129 SER 129 129 ? ? ? A . n A 1 130 GLU 130 130 ? ? ? A . n A 1 131 GLU 131 131 ? ? ? A . n A 1 132 GLY 132 132 ? ? ? A . n A 1 133 TYR 133 133 ? ? ? A . n A 1 134 GLN 134 134 ? ? ? A . n A 1 135 ASP 135 135 ? ? ? A . n A 1 136 TYR 136 136 ? ? ? A . n A 1 137 GLU 137 137 ? ? ? A . n A 1 138 PRO 138 138 ? ? ? A . n A 1 139 GLU 139 139 ? ? ? A . n A 1 140 ALA 140 140 ? ? ? A . n B 2 1 UNK 1 4 4 UNK ALA B . n B 2 2 UNK 2 5 5 UNK ALA B . n B 2 3 UNK 3 6 6 UNK ALA B . n B 2 4 UNK 4 7 7 UNK ALA B . n B 2 5 UNK 5 8 8 UNK ALA B . n B 2 6 UNK 6 9 9 UNK ALA B . n B 2 7 UNK 7 10 10 UNK ALA B . n B 2 8 UNK 8 11 11 UNK ALA B . n B 2 9 UNK 9 12 12 UNK ALA B . n C 2 1 UNK 1 108 108 UNK ALA C . n C 2 2 UNK 2 109 109 UNK ALA C . n C 2 3 UNK 3 110 110 UNK ALA C . n C 2 4 UNK 4 111 111 UNK ALA C . n C 2 5 UNK 5 112 112 UNK ALA C . n C 2 6 UNK 6 113 113 UNK ALA C . n C 2 7 UNK 7 114 114 UNK ALA C . n C 2 8 UNK 8 115 ? ? ? C . n C 2 9 UNK 9 116 ? ? ? C . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code D 3 HOH 1 201 6 HOH HOH A . D 3 HOH 2 202 2 HOH HOH A . D 3 HOH 3 203 4 HOH HOH A . D 3 HOH 4 204 8 HOH HOH A . D 3 HOH 5 205 7 HOH HOH A . D 3 HOH 6 206 5 HOH HOH A . D 3 HOH 7 207 1 HOH HOH A . E 3 HOH 1 101 3 HOH HOH B . F 3 HOH 1 201 9 HOH HOH C . F 3 HOH 2 202 10 HOH HOH C . # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 9O9K _cell.details ? _cell.formula_units_Z ? _cell.length_a 1.00 _cell.length_a_esd ? _cell.length_b 1.00 _cell.length_b_esd ? _cell.length_c 1.00 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB ? _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9O9K _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9O9K _exptl.crystals_number ? _exptl.details ? _exptl.method 'ELECTRON MICROSCOPY' _exptl.method_details ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 58.006 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.785 _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details 'HYDROGENS HAVE BEEN USED IF PRESENT IN THE INPUT' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9O9K _refine.pdbx_refine_id 'ELECTRON MICROSCOPY' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.90 _refine.ls_d_res_low 96.34 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 28748 _refine.ls_number_reflns_R_free ? _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 100.00 _refine.ls_percent_reflns_R_free ? _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.40820 _refine.ls_R_factor_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.40820 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'PARAMETERS FOR MASK CACLULATION' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD WITH PHASES' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.175 _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id ? _refine.overall_SU_B 13.248 _refine.overall_SU_ML 0.243 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'ELECTRON MICROSCOPY' _refine_hist.cycle_id 1 _refine_hist.details ? _refine_hist.d_res_high . _refine_hist.d_res_low . _refine_hist.number_atoms_solvent ? _refine_hist.number_atoms_total 577 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein ? _refine_hist.pdbx_number_atoms_nucleic_acid ? _refine_hist.pdbx_number_atoms_ligand ? _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'ELECTRON MICROSCOPY' ? 0.007 0.012 566 ? r_bond_refined_d ? ? ? 'ELECTRON MICROSCOPY' ? 0.000 0.016 591 ? r_bond_other_d ? ? ? 'ELECTRON MICROSCOPY' ? 1.543 1.786 763 ? r_angle_refined_deg ? ? ? 'ELECTRON MICROSCOPY' ? 0.533 1.741 1352 ? r_angle_other_deg ? ? ? 'ELECTRON MICROSCOPY' ? 5.515 5.000 83 ? r_dihedral_angle_1_deg ? ? ? 'ELECTRON MICROSCOPY' ? ? ? ? ? r_dihedral_angle_2_deg ? ? ? 'ELECTRON MICROSCOPY' ? 9.169 10.000 89 ? r_dihedral_angle_3_deg ? ? ? 'ELECTRON MICROSCOPY' ? ? ? ? ? r_dihedral_angle_4_deg ? ? ? 'ELECTRON MICROSCOPY' ? 0.055 0.200 101 ? r_chiral_restr ? ? ? 'ELECTRON MICROSCOPY' ? 0.006 0.020 650 ? r_gen_planes_refined ? ? ? 'ELECTRON MICROSCOPY' ? 0.002 0.020 102 ? r_gen_planes_other ? ? ? 'ELECTRON MICROSCOPY' ? ? ? ? ? r_nbd_refined ? ? ? 'ELECTRON MICROSCOPY' ? ? ? ? ? r_nbd_other ? ? ? 'ELECTRON MICROSCOPY' ? ? ? ? ? r_nbtor_refined ? ? ? 'ELECTRON MICROSCOPY' ? ? ? ? ? r_nbtor_other ? ? ? 'ELECTRON MICROSCOPY' ? ? ? ? ? r_xyhbond_nbd_refined ? ? ? 'ELECTRON MICROSCOPY' ? ? ? ? ? r_xyhbond_nbd_other ? ? ? 'ELECTRON MICROSCOPY' ? ? ? ? ? r_metal_ion_refined ? ? ? 'ELECTRON MICROSCOPY' ? ? ? ? ? r_metal_ion_other ? ? ? 'ELECTRON MICROSCOPY' ? ? ? ? ? r_symmetry_vdw_refined ? ? ? 'ELECTRON MICROSCOPY' ? ? ? ? ? r_symmetry_vdw_other ? ? ? 'ELECTRON MICROSCOPY' ? ? ? ? ? r_symmetry_hbond_refined ? ? ? 'ELECTRON MICROSCOPY' ? ? ? ? ? r_symmetry_hbond_other ? ? ? 'ELECTRON MICROSCOPY' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? ? 'ELECTRON MICROSCOPY' ? ? ? ? ? r_symmetry_metal_ion_other ? ? ? 'ELECTRON MICROSCOPY' ? 6.169 5.024 341 ? r_mcbond_it ? ? ? 'ELECTRON MICROSCOPY' ? 6.168 5.022 341 ? r_mcbond_other ? ? ? 'ELECTRON MICROSCOPY' ? 9.335 8.960 421 ? r_mcangle_it ? ? ? 'ELECTRON MICROSCOPY' ? 9.333 8.973 422 ? r_mcangle_other ? ? ? 'ELECTRON MICROSCOPY' ? 9.827 6.381 225 ? r_scbond_it ? ? ? 'ELECTRON MICROSCOPY' ? 9.806 6.392 226 ? r_scbond_other ? ? ? 'ELECTRON MICROSCOPY' ? ? ? ? ? r_scangle_it ? ? ? 'ELECTRON MICROSCOPY' ? 16.039 10.930 343 ? r_scangle_other ? ? ? 'ELECTRON MICROSCOPY' ? 19.257 49.75 545 ? r_long_range_B_refined ? ? ? 'ELECTRON MICROSCOPY' ? 19.251 49.78 545 ? r_long_range_B_other ? ? ? 'ELECTRON MICROSCOPY' ? ? ? ? ? r_rigid_bond_restr ? ? ? 'ELECTRON MICROSCOPY' ? ? ? ? ? r_sphericity_free ? ? ? 'ELECTRON MICROSCOPY' ? ? ? ? ? r_sphericity_bonded ? ? ? # _refine_ls_shell.pdbx_refine_id 'ELECTRON MICROSCOPY' _refine_ls_shell.d_res_high 2.901 _refine_ls_shell.d_res_low 2.976 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 0 _refine_ls_shell.number_reflns_R_work 2054 _refine_ls_shell.percent_reflns_obs 100.00 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.885 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.correlation_coeff_Fo_to_Fc ? _refine_ls_shell.correlation_coeff_Fo_to_Fc_free ? _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work ? _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? _refine_ls_shell.R_factor_R_free 0.000 # loop_ _struct_ncs_oper.id _struct_ncs_oper.code _struct_ncs_oper.details _struct_ncs_oper.matrix[1][1] _struct_ncs_oper.matrix[1][2] _struct_ncs_oper.matrix[1][3] _struct_ncs_oper.matrix[2][1] _struct_ncs_oper.matrix[2][2] _struct_ncs_oper.matrix[2][3] _struct_ncs_oper.matrix[3][1] _struct_ncs_oper.matrix[3][2] _struct_ncs_oper.matrix[3][3] _struct_ncs_oper.vector[1] _struct_ncs_oper.vector[2] _struct_ncs_oper.vector[3] 1 given ? 1.000000 0.000000 0.000000 0.000000 1.000000 0.000000 0.000000 0.000000 1.000000 0.00000 0.00000 0.00000 2 generate ? 0.999519 0.031001 0.000000 -0.031001 0.999519 0.000000 0.000000 0.000000 1.000000 -3.00720 3.10190 -9.45390 3 generate ? 0.999880 0.015502 0.000000 -0.015502 0.999880 0.000000 0.000000 0.000000 1.000000 -1.51560 1.53930 -4.72700 4 generate ? 0.999880 -0.015502 0.000000 0.015502 0.999880 0.000000 0.000000 0.000000 1.000000 1.53930 -1.51560 4.72700 5 generate ? 0.999519 -0.031001 0.000000 0.031001 0.999519 0.000000 0.000000 0.000000 1.000000 3.10190 -3.00720 9.45390 # _struct.entry_id 9O9K _struct.title ;Cryo-EM structure of alpha-synuclein filaments from Parkinson's disease with H50Q variant in SNCA ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9O9K _struct_keywords.text 'amyloid, filament, synuclein, human brain, cryo-EM, fibril, PD, H50Q, mutation, PROTEIN FIBRIL' _struct_keywords.pdbx_keywords 'PROTEIN FIBRIL' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 3 ? F N N 3 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP SYUA_HUMAN P37840 ? 1 ;MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQK TVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA ; 1 2 PDB 9O9K 9O9K ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 9O9K A 1 ? 140 ? P37840 1 ? 140 ? 1 140 2 2 9O9K B 1 ? 9 ? 9O9K 4 ? 12 ? 4 12 3 2 9O9K C 1 ? 9 ? 9O9K 108 ? 116 ? 108 116 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 9O9K _struct_ref_seq_dif.mon_id GLN _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 50 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P37840 _struct_ref_seq_dif.db_mon_id HIS _struct_ref_seq_dif.pdbx_seq_db_seq_num 50 _struct_ref_seq_dif.details variant _struct_ref_seq_dif.pdbx_auth_seq_num 50 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details 15-meric _pdbx_struct_assembly.oligomeric_count 15 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4,5 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'electron microscopy' _pdbx_struct_assembly_auth_evidence.details 'not applicable' # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'point symmetry operation' 1_555 x,y,z 0.999519 0.031001 0.000000 -3.00717 -0.031001 0.999519 0.000000 3.10189 0.000000 0.000000 1.000000 -9.45392 2 'point symmetry operation' ? ? 0.999880 0.015502 0.000000 -1.51561 -0.015502 0.999880 0.000000 1.53929 0.000000 0.000000 1.000000 -4.72696 3 'identity operation' 1_555 x,y,z 1.000000 0.000000 0.000000 0.00000 0.000000 1.000000 0.000000 0.00000 0.000000 0.000000 1.000000 0.00000 4 'point symmetry operation' ? ? 0.999880 -0.015502 0.000000 1.53929 0.015502 0.999880 0.000000 -1.51561 0.000000 0.000000 1.000000 4.72696 5 'point symmetry operation' ? ? 0.999519 -0.031001 0.000000 3.10189 0.031001 0.999519 0.000000 -3.00717 0.000000 0.000000 1.000000 9.45392 # _pdbx_entry_details.entry_id 9O9K _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification N # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ASP _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 98 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -150.77 _pdbx_validate_torsion.psi 68.26 # _em_3d_fitting.id 1 _em_3d_fitting.entry_id 9O9K _em_3d_fitting.method ? _em_3d_fitting.target_criteria ? _em_3d_fitting.details ? _em_3d_fitting.overall_b_value ? _em_3d_fitting.ref_space ? _em_3d_fitting.ref_protocol ? # _em_3d_reconstruction.entry_id 9O9K _em_3d_reconstruction.id 1 _em_3d_reconstruction.method ? _em_3d_reconstruction.algorithm ? _em_3d_reconstruction.citation_id ? _em_3d_reconstruction.details ? _em_3d_reconstruction.resolution 2.9 _em_3d_reconstruction.resolution_method 'FSC 0.143 CUT-OFF' _em_3d_reconstruction.magnification_calibration ? _em_3d_reconstruction.nominal_pixel_size ? _em_3d_reconstruction.actual_pixel_size ? _em_3d_reconstruction.num_particles 200126 _em_3d_reconstruction.euler_angles_details ? _em_3d_reconstruction.num_class_averages ? _em_3d_reconstruction.refinement_type ? _em_3d_reconstruction.image_processing_id 1 _em_3d_reconstruction.symmetry_type HELICAL # _em_buffer.id 1 _em_buffer.specimen_id 1 _em_buffer.name ? _em_buffer.details ? _em_buffer.pH 7.5 # _em_entity_assembly.id 1 _em_entity_assembly.parent_id 0 _em_entity_assembly.source NATURAL _em_entity_assembly.type COMPLEX _em_entity_assembly.name ;Alpha-synuclein filaments extracted from the human Parkinson's disease brain with H50Q variant in SNCA ; _em_entity_assembly.details ? _em_entity_assembly.synonym ? _em_entity_assembly.oligomeric_details ? _em_entity_assembly.entity_id_list 1,2 # _em_imaging.entry_id 9O9K _em_imaging.id 1 _em_imaging.astigmatism ? _em_imaging.electron_beam_tilt_params ? _em_imaging.residual_tilt ? _em_imaging.microscope_model 'TFS KRIOS' _em_imaging.specimen_holder_type ? _em_imaging.specimen_holder_model ? _em_imaging.details ? _em_imaging.date ? _em_imaging.accelerating_voltage 300 _em_imaging.illumination_mode 'FLOOD BEAM' _em_imaging.mode 'BRIGHT FIELD' _em_imaging.nominal_cs ? _em_imaging.nominal_defocus_min 1000 _em_imaging.nominal_defocus_max 2600 _em_imaging.calibrated_defocus_min ? _em_imaging.calibrated_defocus_max ? _em_imaging.tilt_angle_min ? _em_imaging.tilt_angle_max ? _em_imaging.nominal_magnification ? _em_imaging.calibrated_magnification ? _em_imaging.electron_source 'FIELD EMISSION GUN' _em_imaging.citation_id ? _em_imaging.temperature ? _em_imaging.detector_distance ? _em_imaging.recording_temperature_minimum ? _em_imaging.recording_temperature_maximum ? _em_imaging.alignment_procedure ? _em_imaging.c2_aperture_diameter ? _em_imaging.specimen_id 1 _em_imaging.cryogen ? _em_imaging.objective_aperture ? _em_imaging.microscope_serial_number ? _em_imaging.microscope_version ? # _em_vitrification.entry_id 9O9K _em_vitrification.id 1 _em_vitrification.specimen_id 1 _em_vitrification.cryogen_name ETHANE _em_vitrification.humidity ? _em_vitrification.temp ? _em_vitrification.chamber_temperature ? _em_vitrification.instrument ? _em_vitrification.method ? _em_vitrification.time_resolved_state ? _em_vitrification.citation_id ? _em_vitrification.details ? # _em_experiment.entry_id 9O9K _em_experiment.id 1 _em_experiment.reconstruction_method HELICAL _em_experiment.aggregation_state FILAMENT _em_experiment.entity_assembly_id 1 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ASP 2 ? A ASP 2 3 1 Y 1 A VAL 3 ? A VAL 3 4 1 Y 1 A PHE 4 ? A PHE 4 5 1 Y 1 A MET 5 ? A MET 5 6 1 Y 1 A LYS 6 ? A LYS 6 7 1 Y 1 A GLY 7 ? A GLY 7 8 1 Y 1 A LEU 8 ? A LEU 8 9 1 Y 1 A SER 9 ? A SER 9 10 1 Y 1 A LYS 10 ? A LYS 10 11 1 Y 1 A ALA 11 ? A ALA 11 12 1 Y 1 A LYS 12 ? A LYS 12 13 1 Y 1 A GLU 13 ? A GLU 13 14 1 Y 1 A GLY 14 ? A GLY 14 15 1 Y 1 A VAL 15 ? A VAL 15 16 1 Y 1 A VAL 16 ? A VAL 16 17 1 Y 1 A ALA 17 ? A ALA 17 18 1 Y 1 A ALA 18 ? A ALA 18 19 1 Y 1 A ALA 19 ? A ALA 19 20 1 Y 1 A GLU 20 ? A GLU 20 21 1 Y 1 A LYS 21 ? A LYS 21 22 1 Y 1 A THR 22 ? A THR 22 23 1 Y 1 A LYS 23 ? A LYS 23 24 1 Y 1 A GLN 24 ? A GLN 24 25 1 Y 1 A GLY 25 ? A GLY 25 26 1 Y 1 A VAL 26 ? A VAL 26 27 1 Y 1 A ALA 27 ? A ALA 27 28 1 Y 1 A GLU 28 ? A GLU 28 29 1 Y 1 A ALA 29 ? A ALA 29 30 1 Y 1 A ALA 30 ? A ALA 30 31 1 Y 1 A GLY 101 ? A GLY 101 32 1 Y 1 A LYS 102 ? A LYS 102 33 1 Y 1 A ASN 103 ? A ASN 103 34 1 Y 1 A GLU 104 ? A GLU 104 35 1 Y 1 A GLU 105 ? A GLU 105 36 1 Y 1 A GLY 106 ? A GLY 106 37 1 Y 1 A ALA 107 ? A ALA 107 38 1 Y 1 A PRO 108 ? A PRO 108 39 1 Y 1 A GLN 109 ? A GLN 109 40 1 Y 1 A GLU 110 ? A GLU 110 41 1 Y 1 A GLY 111 ? A GLY 111 42 1 Y 1 A ILE 112 ? A ILE 112 43 1 Y 1 A LEU 113 ? A LEU 113 44 1 Y 1 A GLU 114 ? A GLU 114 45 1 Y 1 A ASP 115 ? A ASP 115 46 1 Y 1 A MET 116 ? A MET 116 47 1 Y 1 A PRO 117 ? A PRO 117 48 1 Y 1 A VAL 118 ? A VAL 118 49 1 Y 1 A ASP 119 ? A ASP 119 50 1 Y 1 A PRO 120 ? A PRO 120 51 1 Y 1 A ASP 121 ? A ASP 121 52 1 Y 1 A ASN 122 ? A ASN 122 53 1 Y 1 A GLU 123 ? A GLU 123 54 1 Y 1 A ALA 124 ? A ALA 124 55 1 Y 1 A TYR 125 ? A TYR 125 56 1 Y 1 A GLU 126 ? A GLU 126 57 1 Y 1 A MET 127 ? A MET 127 58 1 Y 1 A PRO 128 ? A PRO 128 59 1 Y 1 A SER 129 ? A SER 129 60 1 Y 1 A GLU 130 ? A GLU 130 61 1 Y 1 A GLU 131 ? A GLU 131 62 1 Y 1 A GLY 132 ? A GLY 132 63 1 Y 1 A TYR 133 ? A TYR 133 64 1 Y 1 A GLN 134 ? A GLN 134 65 1 Y 1 A ASP 135 ? A ASP 135 66 1 Y 1 A TYR 136 ? A TYR 136 67 1 Y 1 A GLU 137 ? A GLU 137 68 1 Y 1 A PRO 138 ? A PRO 138 69 1 Y 1 A GLU 139 ? A GLU 139 70 1 Y 1 A ALA 140 ? A ALA 140 71 1 Y 1 C UNK 115 ? C UNK 8 72 1 Y 1 C UNK 116 ? C UNK 9 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 ASP N N N N 31 ASP CA C N S 32 ASP C C N N 33 ASP O O N N 34 ASP CB C N N 35 ASP CG C N N 36 ASP OD1 O N N 37 ASP OD2 O N N 38 ASP OXT O N N 39 ASP H H N N 40 ASP H2 H N N 41 ASP HA H N N 42 ASP HB2 H N N 43 ASP HB3 H N N 44 ASP HD2 H N N 45 ASP HXT H N N 46 GLN N N N N 47 GLN CA C N S 48 GLN C C N N 49 GLN O O N N 50 GLN CB C N N 51 GLN CG C N N 52 GLN CD C N N 53 GLN OE1 O N N 54 GLN NE2 N N N 55 GLN OXT O N N 56 GLN H H N N 57 GLN H2 H N N 58 GLN HA H N N 59 GLN HB2 H N N 60 GLN HB3 H N N 61 GLN HG2 H N N 62 GLN HG3 H N N 63 GLN HE21 H N N 64 GLN HE22 H N N 65 GLN HXT H N N 66 GLU N N N N 67 GLU CA C N S 68 GLU C C N N 69 GLU O O N N 70 GLU CB C N N 71 GLU CG C N N 72 GLU CD C N N 73 GLU OE1 O N N 74 GLU OE2 O N N 75 GLU OXT O N N 76 GLU H H N N 77 GLU H2 H N N 78 GLU HA H N N 79 GLU HB2 H N N 80 GLU HB3 H N N 81 GLU HG2 H N N 82 GLU HG3 H N N 83 GLU HE2 H N N 84 GLU HXT H N N 85 GLY N N N N 86 GLY CA C N N 87 GLY C C N N 88 GLY O O N N 89 GLY OXT O N N 90 GLY H H N N 91 GLY H2 H N N 92 GLY HA2 H N N 93 GLY HA3 H N N 94 GLY HXT H N N 95 HIS N N N N 96 HIS CA C N S 97 HIS C C N N 98 HIS O O N N 99 HIS CB C N N 100 HIS CG C Y N 101 HIS ND1 N Y N 102 HIS CD2 C Y N 103 HIS CE1 C Y N 104 HIS NE2 N Y N 105 HIS OXT O N N 106 HIS H H N N 107 HIS H2 H N N 108 HIS HA H N N 109 HIS HB2 H N N 110 HIS HB3 H N N 111 HIS HD1 H N N 112 HIS HD2 H N N 113 HIS HE1 H N N 114 HIS HE2 H N N 115 HIS HXT H N N 116 HOH O O N N 117 HOH H1 H N N 118 HOH H2 H N N 119 ILE N N N N 120 ILE CA C N S 121 ILE C C N N 122 ILE O O N N 123 ILE CB C N S 124 ILE CG1 C N N 125 ILE CG2 C N N 126 ILE CD1 C N N 127 ILE OXT O N N 128 ILE H H N N 129 ILE H2 H N N 130 ILE HA H N N 131 ILE HB H N N 132 ILE HG12 H N N 133 ILE HG13 H N N 134 ILE HG21 H N N 135 ILE HG22 H N N 136 ILE HG23 H N N 137 ILE HD11 H N N 138 ILE HD12 H N N 139 ILE HD13 H N N 140 ILE HXT H N N 141 LEU N N N N 142 LEU CA C N S 143 LEU C C N N 144 LEU O O N N 145 LEU CB C N N 146 LEU CG C N N 147 LEU CD1 C N N 148 LEU CD2 C N N 149 LEU OXT O N N 150 LEU H H N N 151 LEU H2 H N N 152 LEU HA H N N 153 LEU HB2 H N N 154 LEU HB3 H N N 155 LEU HG H N N 156 LEU HD11 H N N 157 LEU HD12 H N N 158 LEU HD13 H N N 159 LEU HD21 H N N 160 LEU HD22 H N N 161 LEU HD23 H N N 162 LEU HXT H N N 163 LYS N N N N 164 LYS CA C N S 165 LYS C C N N 166 LYS O O N N 167 LYS CB C N N 168 LYS CG C N N 169 LYS CD C N N 170 LYS CE C N N 171 LYS NZ N N N 172 LYS OXT O N N 173 LYS H H N N 174 LYS H2 H N N 175 LYS HA H N N 176 LYS HB2 H N N 177 LYS HB3 H N N 178 LYS HG2 H N N 179 LYS HG3 H N N 180 LYS HD2 H N N 181 LYS HD3 H N N 182 LYS HE2 H N N 183 LYS HE3 H N N 184 LYS HZ1 H N N 185 LYS HZ2 H N N 186 LYS HZ3 H N N 187 LYS HXT H N N 188 MET N N N N 189 MET CA C N S 190 MET C C N N 191 MET O O N N 192 MET CB C N N 193 MET CG C N N 194 MET SD S N N 195 MET CE C N N 196 MET OXT O N N 197 MET H H N N 198 MET H2 H N N 199 MET HA H N N 200 MET HB2 H N N 201 MET HB3 H N N 202 MET HG2 H N N 203 MET HG3 H N N 204 MET HE1 H N N 205 MET HE2 H N N 206 MET HE3 H N N 207 MET HXT H N N 208 PHE N N N N 209 PHE CA C N S 210 PHE C C N N 211 PHE O O N N 212 PHE CB C N N 213 PHE CG C Y N 214 PHE CD1 C Y N 215 PHE CD2 C Y N 216 PHE CE1 C Y N 217 PHE CE2 C Y N 218 PHE CZ C Y N 219 PHE OXT O N N 220 PHE H H N N 221 PHE H2 H N N 222 PHE HA H N N 223 PHE HB2 H N N 224 PHE HB3 H N N 225 PHE HD1 H N N 226 PHE HD2 H N N 227 PHE HE1 H N N 228 PHE HE2 H N N 229 PHE HZ H N N 230 PHE HXT H N N 231 PRO N N N N 232 PRO CA C N S 233 PRO C C N N 234 PRO O O N N 235 PRO CB C N N 236 PRO CG C N N 237 PRO CD C N N 238 PRO OXT O N N 239 PRO H H N N 240 PRO HA H N N 241 PRO HB2 H N N 242 PRO HB3 H N N 243 PRO HG2 H N N 244 PRO HG3 H N N 245 PRO HD2 H N N 246 PRO HD3 H N N 247 PRO HXT H N N 248 SER N N N N 249 SER CA C N S 250 SER C C N N 251 SER O O N N 252 SER CB C N N 253 SER OG O N N 254 SER OXT O N N 255 SER H H N N 256 SER H2 H N N 257 SER HA H N N 258 SER HB2 H N N 259 SER HB3 H N N 260 SER HG H N N 261 SER HXT H N N 262 THR N N N N 263 THR CA C N S 264 THR C C N N 265 THR O O N N 266 THR CB C N R 267 THR OG1 O N N 268 THR CG2 C N N 269 THR OXT O N N 270 THR H H N N 271 THR H2 H N N 272 THR HA H N N 273 THR HB H N N 274 THR HG1 H N N 275 THR HG21 H N N 276 THR HG22 H N N 277 THR HG23 H N N 278 THR HXT H N N 279 TYR N N N N 280 TYR CA C N S 281 TYR C C N N 282 TYR O O N N 283 TYR CB C N N 284 TYR CG C Y N 285 TYR CD1 C Y N 286 TYR CD2 C Y N 287 TYR CE1 C Y N 288 TYR CE2 C Y N 289 TYR CZ C Y N 290 TYR OH O N N 291 TYR OXT O N N 292 TYR H H N N 293 TYR H2 H N N 294 TYR HA H N N 295 TYR HB2 H N N 296 TYR HB3 H N N 297 TYR HD1 H N N 298 TYR HD2 H N N 299 TYR HE1 H N N 300 TYR HE2 H N N 301 TYR HH H N N 302 TYR HXT H N N 303 VAL N N N N 304 VAL CA C N S 305 VAL C C N N 306 VAL O O N N 307 VAL CB C N N 308 VAL CG1 C N N 309 VAL CG2 C N N 310 VAL OXT O N N 311 VAL H H N N 312 VAL H2 H N N 313 VAL HA H N N 314 VAL HB H N N 315 VAL HG11 H N N 316 VAL HG12 H N N 317 VAL HG13 H N N 318 VAL HG21 H N N 319 VAL HG22 H N N 320 VAL HG23 H N N 321 VAL HXT H N N 322 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 ASP N CA sing N N 29 ASP N H sing N N 30 ASP N H2 sing N N 31 ASP CA C sing N N 32 ASP CA CB sing N N 33 ASP CA HA sing N N 34 ASP C O doub N N 35 ASP C OXT sing N N 36 ASP CB CG sing N N 37 ASP CB HB2 sing N N 38 ASP CB HB3 sing N N 39 ASP CG OD1 doub N N 40 ASP CG OD2 sing N N 41 ASP OD2 HD2 sing N N 42 ASP OXT HXT sing N N 43 GLN N CA sing N N 44 GLN N H sing N N 45 GLN N H2 sing N N 46 GLN CA C sing N N 47 GLN CA CB sing N N 48 GLN CA HA sing N N 49 GLN C O doub N N 50 GLN C OXT sing N N 51 GLN CB CG sing N N 52 GLN CB HB2 sing N N 53 GLN CB HB3 sing N N 54 GLN CG CD sing N N 55 GLN CG HG2 sing N N 56 GLN CG HG3 sing N N 57 GLN CD OE1 doub N N 58 GLN CD NE2 sing N N 59 GLN NE2 HE21 sing N N 60 GLN NE2 HE22 sing N N 61 GLN OXT HXT sing N N 62 GLU N CA sing N N 63 GLU N H sing N N 64 GLU N H2 sing N N 65 GLU CA C sing N N 66 GLU CA CB sing N N 67 GLU CA HA sing N N 68 GLU C O doub N N 69 GLU C OXT sing N N 70 GLU CB CG sing N N 71 GLU CB HB2 sing N N 72 GLU CB HB3 sing N N 73 GLU CG CD sing N N 74 GLU CG HG2 sing N N 75 GLU CG HG3 sing N N 76 GLU CD OE1 doub N N 77 GLU CD OE2 sing N N 78 GLU OE2 HE2 sing N N 79 GLU OXT HXT sing N N 80 GLY N CA sing N N 81 GLY N H sing N N 82 GLY N H2 sing N N 83 GLY CA C sing N N 84 GLY CA HA2 sing N N 85 GLY CA HA3 sing N N 86 GLY C O doub N N 87 GLY C OXT sing N N 88 GLY OXT HXT sing N N 89 HIS N CA sing N N 90 HIS N H sing N N 91 HIS N H2 sing N N 92 HIS CA C sing N N 93 HIS CA CB sing N N 94 HIS CA HA sing N N 95 HIS C O doub N N 96 HIS C OXT sing N N 97 HIS CB CG sing N N 98 HIS CB HB2 sing N N 99 HIS CB HB3 sing N N 100 HIS CG ND1 sing Y N 101 HIS CG CD2 doub Y N 102 HIS ND1 CE1 doub Y N 103 HIS ND1 HD1 sing N N 104 HIS CD2 NE2 sing Y N 105 HIS CD2 HD2 sing N N 106 HIS CE1 NE2 sing Y N 107 HIS CE1 HE1 sing N N 108 HIS NE2 HE2 sing N N 109 HIS OXT HXT sing N N 110 HOH O H1 sing N N 111 HOH O H2 sing N N 112 ILE N CA sing N N 113 ILE N H sing N N 114 ILE N H2 sing N N 115 ILE CA C sing N N 116 ILE CA CB sing N N 117 ILE CA HA sing N N 118 ILE C O doub N N 119 ILE C OXT sing N N 120 ILE CB CG1 sing N N 121 ILE CB CG2 sing N N 122 ILE CB HB sing N N 123 ILE CG1 CD1 sing N N 124 ILE CG1 HG12 sing N N 125 ILE CG1 HG13 sing N N 126 ILE CG2 HG21 sing N N 127 ILE CG2 HG22 sing N N 128 ILE CG2 HG23 sing N N 129 ILE CD1 HD11 sing N N 130 ILE CD1 HD12 sing N N 131 ILE CD1 HD13 sing N N 132 ILE OXT HXT sing N N 133 LEU N CA sing N N 134 LEU N H sing N N 135 LEU N H2 sing N N 136 LEU CA C sing N N 137 LEU CA CB sing N N 138 LEU CA HA sing N N 139 LEU C O doub N N 140 LEU C OXT sing N N 141 LEU CB CG sing N N 142 LEU CB HB2 sing N N 143 LEU CB HB3 sing N N 144 LEU CG CD1 sing N N 145 LEU CG CD2 sing N N 146 LEU CG HG sing N N 147 LEU CD1 HD11 sing N N 148 LEU CD1 HD12 sing N N 149 LEU CD1 HD13 sing N N 150 LEU CD2 HD21 sing N N 151 LEU CD2 HD22 sing N N 152 LEU CD2 HD23 sing N N 153 LEU OXT HXT sing N N 154 LYS N CA sing N N 155 LYS N H sing N N 156 LYS N H2 sing N N 157 LYS CA C sing N N 158 LYS CA CB sing N N 159 LYS CA HA sing N N 160 LYS C O doub N N 161 LYS C OXT sing N N 162 LYS CB CG sing N N 163 LYS CB HB2 sing N N 164 LYS CB HB3 sing N N 165 LYS CG CD sing N N 166 LYS CG HG2 sing N N 167 LYS CG HG3 sing N N 168 LYS CD CE sing N N 169 LYS CD HD2 sing N N 170 LYS CD HD3 sing N N 171 LYS CE NZ sing N N 172 LYS CE HE2 sing N N 173 LYS CE HE3 sing N N 174 LYS NZ HZ1 sing N N 175 LYS NZ HZ2 sing N N 176 LYS NZ HZ3 sing N N 177 LYS OXT HXT sing N N 178 MET N CA sing N N 179 MET N H sing N N 180 MET N H2 sing N N 181 MET CA C sing N N 182 MET CA CB sing N N 183 MET CA HA sing N N 184 MET C O doub N N 185 MET C OXT sing N N 186 MET CB CG sing N N 187 MET CB HB2 sing N N 188 MET CB HB3 sing N N 189 MET CG SD sing N N 190 MET CG HG2 sing N N 191 MET CG HG3 sing N N 192 MET SD CE sing N N 193 MET CE HE1 sing N N 194 MET CE HE2 sing N N 195 MET CE HE3 sing N N 196 MET OXT HXT sing N N 197 PHE N CA sing N N 198 PHE N H sing N N 199 PHE N H2 sing N N 200 PHE CA C sing N N 201 PHE CA CB sing N N 202 PHE CA HA sing N N 203 PHE C O doub N N 204 PHE C OXT sing N N 205 PHE CB CG sing N N 206 PHE CB HB2 sing N N 207 PHE CB HB3 sing N N 208 PHE CG CD1 doub Y N 209 PHE CG CD2 sing Y N 210 PHE CD1 CE1 sing Y N 211 PHE CD1 HD1 sing N N 212 PHE CD2 CE2 doub Y N 213 PHE CD2 HD2 sing N N 214 PHE CE1 CZ doub Y N 215 PHE CE1 HE1 sing N N 216 PHE CE2 CZ sing Y N 217 PHE CE2 HE2 sing N N 218 PHE CZ HZ sing N N 219 PHE OXT HXT sing N N 220 PRO N CA sing N N 221 PRO N CD sing N N 222 PRO N H sing N N 223 PRO CA C sing N N 224 PRO CA CB sing N N 225 PRO CA HA sing N N 226 PRO C O doub N N 227 PRO C OXT sing N N 228 PRO CB CG sing N N 229 PRO CB HB2 sing N N 230 PRO CB HB3 sing N N 231 PRO CG CD sing N N 232 PRO CG HG2 sing N N 233 PRO CG HG3 sing N N 234 PRO CD HD2 sing N N 235 PRO CD HD3 sing N N 236 PRO OXT HXT sing N N 237 SER N CA sing N N 238 SER N H sing N N 239 SER N H2 sing N N 240 SER CA C sing N N 241 SER CA CB sing N N 242 SER CA HA sing N N 243 SER C O doub N N 244 SER C OXT sing N N 245 SER CB OG sing N N 246 SER CB HB2 sing N N 247 SER CB HB3 sing N N 248 SER OG HG sing N N 249 SER OXT HXT sing N N 250 THR N CA sing N N 251 THR N H sing N N 252 THR N H2 sing N N 253 THR CA C sing N N 254 THR CA CB sing N N 255 THR CA HA sing N N 256 THR C O doub N N 257 THR C OXT sing N N 258 THR CB OG1 sing N N 259 THR CB CG2 sing N N 260 THR CB HB sing N N 261 THR OG1 HG1 sing N N 262 THR CG2 HG21 sing N N 263 THR CG2 HG22 sing N N 264 THR CG2 HG23 sing N N 265 THR OXT HXT sing N N 266 TYR N CA sing N N 267 TYR N H sing N N 268 TYR N H2 sing N N 269 TYR CA C sing N N 270 TYR CA CB sing N N 271 TYR CA HA sing N N 272 TYR C O doub N N 273 TYR C OXT sing N N 274 TYR CB CG sing N N 275 TYR CB HB2 sing N N 276 TYR CB HB3 sing N N 277 TYR CG CD1 doub Y N 278 TYR CG CD2 sing Y N 279 TYR CD1 CE1 sing Y N 280 TYR CD1 HD1 sing N N 281 TYR CD2 CE2 doub Y N 282 TYR CD2 HD2 sing N N 283 TYR CE1 CZ doub Y N 284 TYR CE1 HE1 sing N N 285 TYR CE2 CZ sing Y N 286 TYR CE2 HE2 sing N N 287 TYR CZ OH sing N N 288 TYR OH HH sing N N 289 TYR OXT HXT sing N N 290 VAL N CA sing N N 291 VAL N H sing N N 292 VAL N H2 sing N N 293 VAL CA C sing N N 294 VAL CA CB sing N N 295 VAL CA HA sing N N 296 VAL C O doub N N 297 VAL C OXT sing N N 298 VAL CB CG1 sing N N 299 VAL CB CG2 sing N N 300 VAL CB HB sing N N 301 VAL CG1 HG11 sing N N 302 VAL CG1 HG12 sing N N 303 VAL CG1 HG13 sing N N 304 VAL CG2 HG21 sing N N 305 VAL CG2 HG22 sing N N 306 VAL CG2 HG23 sing N N 307 VAL OXT HXT sing N N 308 # _em_admin.current_status REL _em_admin.deposition_date 2025-04-18 _em_admin.deposition_site RCSB _em_admin.entry_id 9O9K _em_admin.last_update 2026-05-20 _em_admin.map_release_date 2026-05-20 _em_admin.title ;Cryo-EM structure of alpha-synuclein filaments from Parkinson's disease with H50Q variant in SNCA ; # _em_ctf_correction.details ? _em_ctf_correction.em_image_processing_id 1 _em_ctf_correction.id 1 _em_ctf_correction.type 'PHASE FLIPPING AND AMPLITUDE CORRECTION' # _em_entity_assembly_naturalsource.cell ? _em_entity_assembly_naturalsource.cellular_location ? _em_entity_assembly_naturalsource.entity_assembly_id 1 _em_entity_assembly_naturalsource.id 2 _em_entity_assembly_naturalsource.ncbi_tax_id 9606 _em_entity_assembly_naturalsource.organism 'Homo sapiens' _em_entity_assembly_naturalsource.organelle ? _em_entity_assembly_naturalsource.organ ? _em_entity_assembly_naturalsource.strain ? _em_entity_assembly_naturalsource.tissue ? _em_entity_assembly_naturalsource.details ? # _em_helical_entity.id 1 _em_helical_entity.image_processing_id 1 _em_helical_entity.details ? _em_helical_entity.axial_symmetry C1 _em_helical_entity.angular_rotation_per_subunit 0.89 _em_helical_entity.axial_rise_per_subunit 4.73 # _em_image_processing.details ? _em_image_processing.id 1 _em_image_processing.image_recording_id 1 # _em_image_recording.average_exposure_time ? _em_image_recording.avg_electron_dose_per_subtomogram ? _em_image_recording.avg_electron_dose_per_image 40 _em_image_recording.details ? _em_image_recording.detector_mode ? _em_image_recording.film_or_detector_model 'FEI FALCON IV (4k x 4k)' _em_image_recording.id 1 _em_image_recording.imaging_id 1 _em_image_recording.num_diffraction_images ? _em_image_recording.num_grids_imaged ? _em_image_recording.num_real_images ? # loop_ _em_software.category _em_software.details _em_software.id _em_software.image_processing_id _em_software.fitting_id _em_software.imaging_id _em_software.name _em_software.version _em_software.reference_DOI 'PARTICLE SELECTION' ? 1 1 ? ? ? ? ? 'IMAGE ACQUISITION' ? 2 ? ? 1 ? ? ? MASKING ? 3 ? ? ? ? ? ? 'CTF CORRECTION' ? 4 1 ? ? ? ? ? 'LAYERLINE INDEXING' ? 5 ? ? ? ? ? ? 'DIFFRACTION INDEXING' ? 6 ? ? ? ? ? ? 'MODEL FITTING' ? 7 ? ? ? ? ? ? 'MODEL REFINEMENT' ? 8 ? ? ? ? ? ? OTHER ? 9 ? ? ? ? ? ? 'INITIAL EULER ASSIGNMENT' ? 10 1 ? ? ? ? ? 'FINAL EULER ASSIGNMENT' ? 11 1 ? ? ? ? ? CLASSIFICATION ? 12 1 ? ? ? ? ? RECONSTRUCTION ? 13 1 ? ? ? ? ? # _em_specimen.concentration ? _em_specimen.details ? _em_specimen.embedding_applied NO _em_specimen.experiment_id 1 _em_specimen.id 1 _em_specimen.shadowing_applied NO _em_specimen.staining_applied NO _em_specimen.vitrification_applied YES # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Medical Research Council (MRC, United Kingdom)' 'United Kingdom' MC_U105184291 1 'Medical Research Council (MRC, United Kingdom)' 'United Kingdom' MC_UP_A025_1013 2 # _atom_sites.entry_id 9O9K _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O # loop_ #