data_9OPF # _entry.id 9OPF # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.404 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9OPF pdb_00009opf 10.2210/pdb9opf/pdb WWPDB D_1000295952 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2025-06-11 ? 2 'Structure model' 1 1 2025-06-25 ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.pdbx_database_id_DOI' 6 2 'Structure model' '_citation.pdbx_database_id_PubMed' 7 2 'Structure model' '_citation.title' 8 2 'Structure model' '_citation.year' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9OPF _pdbx_database_status.recvd_initial_deposition_date 2025-05-19 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email kgardner@gc.cuny.edu _pdbx_contact_author.name_first Kevin _pdbx_contact_author.name_last Gardner _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-8671-2556 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Isiorho, E.A.' 1 0000-0002-6242-9297 'Xu, X.' 2 0000-0002-9609-4755 'Gardner, K.H.' 3 0000-0002-8671-2556 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Biorxiv _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2692-8205 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Context-Dependent Variability Of HIF Heterodimers Influences Interactions With Macromolecular And Small Molecule Partners.' _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1101/2025.05.29.656908 _citation.pdbx_database_id_PubMed 40502054 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Closson, J.D.' 1 0000-0002-4618-3119 primary 'Xu, X.' 2 0000-0002-9609-4755 primary 'Zhang, M.' 3 0000-0002-0670-6018 primary 'Tiyani, T.T.' 4 0000-0002-2806-4079 primary 'Marcelino, L.P.' 5 0000-0001-6067-0725 primary 'Isiorho, E.A.' 6 0000-0002-6242-9297 primary 'Nagati, J.S.' 7 0000-0002-4507-6581 primary 'Garcia, J.A.' 8 0000-0002-5621-7538 primary 'Gardner, K.H.' 9 0000-0002-8671-2556 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Transforming acidic coiled-coil-containing protein 3' 9354.629 2 ? ? ? ? 2 water nat water 18.015 6 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ERIC-1 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;TQEGQRYQALKAHAEEKLQLANEEIAQVRSKAQAEALALQASLRKEQMRIQSLEKTVEQKTKENEELTRICDDLISKMEK I ; _entity_poly.pdbx_seq_one_letter_code_can ;TQEGQRYQALKAHAEEKLQLANEEIAQVRSKAQAEALALQASLRKEQMRIQSLEKTVEQKTKENEELTRICDDLISKMEK I ; _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 THR n 1 2 GLN n 1 3 GLU n 1 4 GLY n 1 5 GLN n 1 6 ARG n 1 7 TYR n 1 8 GLN n 1 9 ALA n 1 10 LEU n 1 11 LYS n 1 12 ALA n 1 13 HIS n 1 14 ALA n 1 15 GLU n 1 16 GLU n 1 17 LYS n 1 18 LEU n 1 19 GLN n 1 20 LEU n 1 21 ALA n 1 22 ASN n 1 23 GLU n 1 24 GLU n 1 25 ILE n 1 26 ALA n 1 27 GLN n 1 28 VAL n 1 29 ARG n 1 30 SER n 1 31 LYS n 1 32 ALA n 1 33 GLN n 1 34 ALA n 1 35 GLU n 1 36 ALA n 1 37 LEU n 1 38 ALA n 1 39 LEU n 1 40 GLN n 1 41 ALA n 1 42 SER n 1 43 LEU n 1 44 ARG n 1 45 LYS n 1 46 GLU n 1 47 GLN n 1 48 MET n 1 49 ARG n 1 50 ILE n 1 51 GLN n 1 52 SER n 1 53 LEU n 1 54 GLU n 1 55 LYS n 1 56 THR n 1 57 VAL n 1 58 GLU n 1 59 GLN n 1 60 LYS n 1 61 THR n 1 62 LYS n 1 63 GLU n 1 64 ASN n 1 65 GLU n 1 66 GLU n 1 67 LEU n 1 68 THR n 1 69 ARG n 1 70 ILE n 1 71 CYS n 1 72 ASP n 1 73 ASP n 1 74 LEU n 1 75 ILE n 1 76 SER n 1 77 LYS n 1 78 MET n 1 79 GLU n 1 80 LYS n 1 81 ILE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 81 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'TACC3, ERIC1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 THR 1 758 ? ? ? A . n A 1 2 GLN 2 759 ? ? ? A . n A 1 3 GLU 3 760 ? ? ? A . n A 1 4 GLY 4 761 ? ? ? A . n A 1 5 GLN 5 762 ? ? ? A . n A 1 6 ARG 6 763 ? ? ? A . n A 1 7 TYR 7 764 ? ? ? A . n A 1 8 GLN 8 765 ? ? ? A . n A 1 9 ALA 9 766 ? ? ? A . n A 1 10 LEU 10 767 ? ? ? A . n A 1 11 LYS 11 768 ? ? ? A . n A 1 12 ALA 12 769 ? ? ? A . n A 1 13 HIS 13 770 ? ? ? A . n A 1 14 ALA 14 771 ? ? ? A . n A 1 15 GLU 15 772 ? ? ? A . n A 1 16 GLU 16 773 ? ? ? A . n A 1 17 LYS 17 774 ? ? ? A . n A 1 18 LEU 18 775 ? ? ? A . n A 1 19 GLN 19 776 ? ? ? A . n A 1 20 LEU 20 777 ? ? ? A . n A 1 21 ALA 21 778 ? ? ? A . n A 1 22 ASN 22 779 ? ? ? A . n A 1 23 GLU 23 780 ? ? ? A . n A 1 24 GLU 24 781 ? ? ? A . n A 1 25 ILE 25 782 782 ILE ILE A . n A 1 26 ALA 26 783 783 ALA ALA A . n A 1 27 GLN 27 784 784 GLN GLN A . n A 1 28 VAL 28 785 785 VAL VAL A . n A 1 29 ARG 29 786 786 ARG ARG A . n A 1 30 SER 30 787 787 SER SER A . n A 1 31 LYS 31 788 788 LYS LYS A . n A 1 32 ALA 32 789 789 ALA ALA A . n A 1 33 GLN 33 790 790 GLN GLN A . n A 1 34 ALA 34 791 791 ALA ALA A . n A 1 35 GLU 35 792 792 GLU GLU A . n A 1 36 ALA 36 793 793 ALA ALA A . n A 1 37 LEU 37 794 794 LEU LEU A . n A 1 38 ALA 38 795 795 ALA ALA A . n A 1 39 LEU 39 796 796 LEU LEU A . n A 1 40 GLN 40 797 797 GLN GLN A . n A 1 41 ALA 41 798 798 ALA ALA A . n A 1 42 SER 42 799 799 SER SER A . n A 1 43 LEU 43 800 800 LEU LEU A . n A 1 44 ARG 44 801 801 ARG ARG A . n A 1 45 LYS 45 802 802 LYS LYS A . n A 1 46 GLU 46 803 803 GLU GLU A . n A 1 47 GLN 47 804 804 GLN GLN A . n A 1 48 MET 48 805 805 MET MET A . n A 1 49 ARG 49 806 806 ARG ARG A . n A 1 50 ILE 50 807 807 ILE ILE A . n A 1 51 GLN 51 808 808 GLN GLN A . n A 1 52 SER 52 809 809 SER SER A . n A 1 53 LEU 53 810 810 LEU LEU A . n A 1 54 GLU 54 811 811 GLU GLU A . n A 1 55 LYS 55 812 812 LYS LYS A . n A 1 56 THR 56 813 813 THR THR A . n A 1 57 VAL 57 814 814 VAL VAL A . n A 1 58 GLU 58 815 815 GLU GLU A . n A 1 59 GLN 59 816 816 GLN GLN A . n A 1 60 LYS 60 817 817 LYS LYS A . n A 1 61 THR 61 818 818 THR THR A . n A 1 62 LYS 62 819 819 LYS LYS A . n A 1 63 GLU 63 820 820 GLU GLU A . n A 1 64 ASN 64 821 821 ASN ASN A . n A 1 65 GLU 65 822 822 GLU GLU A . n A 1 66 GLU 66 823 823 GLU GLU A . n A 1 67 LEU 67 824 824 LEU LEU A . n A 1 68 THR 68 825 825 THR THR A . n A 1 69 ARG 69 826 826 ARG ARG A . n A 1 70 ILE 70 827 827 ILE ILE A . n A 1 71 CYS 71 828 828 CYS CYS A . n A 1 72 ASP 72 829 829 ASP ASP A . n A 1 73 ASP 73 830 830 ASP ASP A . n A 1 74 LEU 74 831 831 LEU LEU A . n A 1 75 ILE 75 832 832 ILE ILE A . n A 1 76 SER 76 833 833 SER SER A . n A 1 77 LYS 77 834 834 LYS LYS A . n A 1 78 MET 78 835 835 MET MET A . n A 1 79 GLU 79 836 836 GLU GLU A . n A 1 80 LYS 80 837 ? ? ? A . n A 1 81 ILE 81 838 ? ? ? A . n B 1 1 THR 1 758 ? ? ? B . n B 1 2 GLN 2 759 ? ? ? B . n B 1 3 GLU 3 760 ? ? ? B . n B 1 4 GLY 4 761 ? ? ? B . n B 1 5 GLN 5 762 ? ? ? B . n B 1 6 ARG 6 763 ? ? ? B . n B 1 7 TYR 7 764 ? ? ? B . n B 1 8 GLN 8 765 ? ? ? B . n B 1 9 ALA 9 766 ? ? ? B . n B 1 10 LEU 10 767 ? ? ? B . n B 1 11 LYS 11 768 ? ? ? B . n B 1 12 ALA 12 769 ? ? ? B . n B 1 13 HIS 13 770 ? ? ? B . n B 1 14 ALA 14 771 ? ? ? B . n B 1 15 GLU 15 772 ? ? ? B . n B 1 16 GLU 16 773 ? ? ? B . n B 1 17 LYS 17 774 ? ? ? B . n B 1 18 LEU 18 775 ? ? ? B . n B 1 19 GLN 19 776 ? ? ? B . n B 1 20 LEU 20 777 ? ? ? B . n B 1 21 ALA 21 778 ? ? ? B . n B 1 22 ASN 22 779 ? ? ? B . n B 1 23 GLU 23 780 780 GLU GLU B . n B 1 24 GLU 24 781 781 GLU GLU B . n B 1 25 ILE 25 782 782 ILE ILE B . n B 1 26 ALA 26 783 783 ALA ALA B . n B 1 27 GLN 27 784 784 GLN GLN B . n B 1 28 VAL 28 785 785 VAL VAL B . n B 1 29 ARG 29 786 786 ARG ARG B . n B 1 30 SER 30 787 787 SER SER B . n B 1 31 LYS 31 788 788 LYS LYS B . n B 1 32 ALA 32 789 789 ALA ALA B . n B 1 33 GLN 33 790 790 GLN GLN B . n B 1 34 ALA 34 791 791 ALA ALA B . n B 1 35 GLU 35 792 792 GLU GLU B . n B 1 36 ALA 36 793 793 ALA ALA B . n B 1 37 LEU 37 794 794 LEU LEU B . n B 1 38 ALA 38 795 795 ALA ALA B . n B 1 39 LEU 39 796 796 LEU LEU B . n B 1 40 GLN 40 797 797 GLN GLN B . n B 1 41 ALA 41 798 798 ALA ALA B . n B 1 42 SER 42 799 799 SER SER B . n B 1 43 LEU 43 800 800 LEU LEU B . n B 1 44 ARG 44 801 801 ARG ARG B . n B 1 45 LYS 45 802 802 LYS LYS B . n B 1 46 GLU 46 803 803 GLU GLU B . n B 1 47 GLN 47 804 804 GLN GLN B . n B 1 48 MET 48 805 805 MET MET B . n B 1 49 ARG 49 806 806 ARG ARG B . n B 1 50 ILE 50 807 807 ILE ILE B . n B 1 51 GLN 51 808 808 GLN GLN B . n B 1 52 SER 52 809 809 SER SER B . n B 1 53 LEU 53 810 810 LEU LEU B . n B 1 54 GLU 54 811 811 GLU GLU B . n B 1 55 LYS 55 812 812 LYS LYS B . n B 1 56 THR 56 813 813 THR THR B . n B 1 57 VAL 57 814 814 VAL VAL B . n B 1 58 GLU 58 815 815 GLU GLU B . n B 1 59 GLN 59 816 816 GLN GLN B . n B 1 60 LYS 60 817 817 LYS LYS B . n B 1 61 THR 61 818 818 THR THR B . n B 1 62 LYS 62 819 819 LYS LYS B . n B 1 63 GLU 63 820 820 GLU GLU B . n B 1 64 ASN 64 821 821 ASN ASN B . n B 1 65 GLU 65 822 822 GLU GLU B . n B 1 66 GLU 66 823 823 GLU GLU B . n B 1 67 LEU 67 824 824 LEU LEU B . n B 1 68 THR 68 825 825 THR THR B . n B 1 69 ARG 69 826 826 ARG ARG B . n B 1 70 ILE 70 827 827 ILE ILE B . n B 1 71 CYS 71 828 828 CYS CYS B . n B 1 72 ASP 72 829 829 ASP ASP B . n B 1 73 ASP 73 830 830 ASP ASP B . n B 1 74 LEU 74 831 831 LEU LEU B . n B 1 75 ILE 75 832 832 ILE ILE B . n B 1 76 SER 76 833 833 SER SER B . n B 1 77 LYS 77 834 834 LYS LYS B . n B 1 78 MET 78 835 835 MET MET B . n B 1 79 GLU 79 836 836 GLU GLU B . n B 1 80 LYS 80 837 ? ? ? B . n B 1 81 ILE 81 838 ? ? ? B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 HOH 1 901 9 HOH HOH A . C 2 HOH 2 902 67 HOH HOH A . D 2 HOH 1 901 53 HOH HOH B . D 2 HOH 2 902 23 HOH HOH B . D 2 HOH 3 903 10 HOH HOH B . D 2 HOH 4 904 93 HOH HOH B . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.21.2_5419-000 ? 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . ? 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . ? 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . ? 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 91.818 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 9OPF _cell.details ? _cell.formula_units_Z ? _cell.length_a 263.114 _cell.length_a_esd ? _cell.length_b 23.826 _cell.length_b_esd ? _cell.length_c 31.851 _cell.length_c_esd ? _cell.volume 199571.953 _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9OPF _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall 'C 2y' _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9OPF _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.67 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 53.88 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M imidazole, 50% (+/-)-2-Methyl-2,4-pentanediol (MPD)' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 298 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2022-04-05 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9201 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'NSLS-II BEAMLINE 17-ID-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9201 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 17-ID-1 _diffrn_source.pdbx_synchrotron_site NSLS-II # _reflns.B_iso_Wilson_estimate 48.44 _reflns.entry_id 9OPF _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.28 _reflns.d_resolution_low 29.02 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 9247 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.37 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.3 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 7.00 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.992 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.085 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.28 _reflns_shell.d_res_low 2.4 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1264 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.58 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.63 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 78.65 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9OPF _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.28 _refine.ls_d_res_low 29.02 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 9247 _refine.ls_number_reflns_R_free 934 _refine.ls_number_reflns_R_work 8313 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.37 _refine.ls_percent_reflns_R_free 10.10 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2693 _refine.ls_R_factor_R_free 0.2951 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2662 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.37 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 29.7272 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2818 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.28 _refine_hist.d_res_low 29.02 _refine_hist.number_atoms_solvent 6 _refine_hist.number_atoms_total 904 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 898 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0146 ? 896 ? f_bond_d ? ? ? 'X-RAY DIFFRACTION' ? 1.6543 ? 1192 ? f_angle_d ? ? ? 'X-RAY DIFFRACTION' ? 0.0637 ? 142 ? f_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.0161 ? 156 ? f_plane_restr ? ? ? 'X-RAY DIFFRACTION' ? 17.9146 ? 374 ? f_dihedral_angle_d ? ? ? # _refine_ls_restr_ncs.pdbx_ordinal 1 _refine_ls_restr_ncs.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_restr_ncs.dom_id d_2 _refine_ls_restr_ncs.pdbx_ens_id ens_1 _refine_ls_restr_ncs.rms_dev_position 2.32470545557 _refine_ls_restr_ncs.weight_position ? _refine_ls_restr_ncs.rms_dev_B_iso ? _refine_ls_restr_ncs.weight_B_iso ? _refine_ls_restr_ncs.pdbx_type 'Torsion NCS' _refine_ls_restr_ncs.pdbx_asym_id A _refine_ls_restr_ncs.pdbx_auth_asym_id A _refine_ls_restr_ncs.pdbx_number ? _refine_ls_restr_ncs.pdbx_rms ? _refine_ls_restr_ncs.pdbx_weight ? _refine_ls_restr_ncs.ncs_model_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.28 2.40 . . 128 1136 96.05 . . . . 0.2774 . . . . . . . . . . . . . . . 0.3200 'X-RAY DIFFRACTION' 2.40 2.55 . . 129 1153 100.00 . . . . 0.2786 . . . . . . . . . . . . . . . 0.3344 'X-RAY DIFFRACTION' 2.55 2.75 . . 131 1204 99.48 . . . . 0.2502 . . . . . . . . . . . . . . . 0.3148 'X-RAY DIFFRACTION' 2.75 3.03 . . 130 1196 99.10 . . . . 0.2548 . . . . . . . . . . . . . . . 0.2560 'X-RAY DIFFRACTION' 3.03 3.46 . . 133 1195 99.10 . . . . 0.2696 . . . . . . . . . . . . . . . 0.3138 'X-RAY DIFFRACTION' 3.47 4.36 . . 134 1203 98.53 . . . . 0.2297 . . . . . . . . . . . . . . . 0.2589 'X-RAY DIFFRACTION' 4.36 29.02 . . 149 1226 96.49 . . . . 0.2991 . . . . . . . . . . . . . . . 0.3120 # _struct_ncs_oper.id 1 _struct_ncs_oper.code given _struct_ncs_oper.matrix[1][1] 0.993825368803 _struct_ncs_oper.matrix[1][2] 0.106985973238 _struct_ncs_oper.matrix[1][3] 0.0294132258172 _struct_ncs_oper.matrix[2][1] 0.105891882085 _struct_ncs_oper.matrix[2][2] -0.993706269183 _struct_ncs_oper.matrix[2][3] 0.0365343659428 _struct_ncs_oper.matrix[3][1] 0.0331367715884 _struct_ncs_oper.matrix[3][2] -0.0331941578672 _struct_ncs_oper.matrix[3][3] -0.998899445516 _struct_ncs_oper.vector[1] -1.25589918939 _struct_ncs_oper.vector[2] 13.4150367726 _struct_ncs_oper.vector[3] 14.7177435741 _struct_ncs_oper.details ? # loop_ _struct_ncs_dom.pdbx_ens_id _struct_ncs_dom.id _struct_ncs_dom.details ens_1 d_1 ;(chain "A" and ((resid 782 and (name N or name CA or name C or name O or name CB or name CG1 or name CG2 or name CD1)) or (resid 783 and (name N or name CA or name C or name O or name CB )) or (resid 784 and (name N or name CA or name C or name O or name CB or name CG or name CD or name OE1 or name NE2)) or (resid 785 and (name N or name CA or name C or name O or name CB or name CG1 or name CG2)) or (resid 786 and (name N or name CA or name C or name O or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or (resid 787 and (name N or name CA or name C or name O or name CB or name OG )) or (resid 788 and (name N or name CA or name C or name O or name CB or name CG or name CD or name CE or name NZ )) or (resid 789 and (name N or name CA or name C or name O or name CB )) or (resid 790 and (name N or name CA or name C or name O or name CB or name CG or name CD or name OE1 or name NE2)) or (resid 791 and (name N or name CA or name C or name O or name CB )) or (resid 792 and (name N or name CA or name C or name O or name CB or name CG or name CD or name OE1 or name OE2)) or (resid 793 and (name N or name CA or name C or name O or name CB )) or (resid 794 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CD2)) or (resid 795 and (name N or name CA or name C or name O or name CB )) or (resid 796 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CD2)) or (resid 797 and (name N or name CA or name C or name O or name CB or name CG or name CD or name OE1 or name NE2)) or (resid 798 and (name N or name CA or name C or name O or name CB )) or (resid 799 and (name N or name CA or name C or name O or name CB or name OG )) or (resid 800 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CD2)) or (resid 801 and (name N or name CA or name C or name O or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or (resid 802 and (name N or name CA or name C or name O or name CB or name CG or name CD or name CE or name NZ )) or (resid 803 and (name N or name CA or name C or name O or name CB or name CG or name CD or name OE1 or name OE2)) or (resid 804 and (name N or name CA or name C or name O or name CB or name CG or name CD or name OE1 or name NE2)) or (resid 805 and (name N or name CA or name C or name O or name CB or name CG or name SD or name CE )) or (resid 806 and (name N or name CA or name C or name O or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or (resid 807 and (name N or name CA or name C or name O or name CB or name CG1 or name CG2 or name CD1)) or (resid 808 and (name N or name CA or name C or name O or name CB or name CG or name CD or name OE1 or name NE2)) or (resid 809 and (name N or name CA or name C or name O or name CB or name OG )) or (resid 810 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CD2)) or (resid 811 and (name N or name CA or name C or name O or name CB or name CG or name CD or name OE1 or name OE2)) or (resid 812 and (name N or name CA or name C or name O or name CB or name CG or name CD or name CE or name NZ )) or (resid 813 and (name N or name CA or name C or name O or name CB or name OG1 or name CG2)) or (resid 814 and (name N or name CA or name C or name O or name CB or name CG1 or name CG2)) or (resid 815 and (name N or name CA or name C or name O or name CB or name CG or name CD or name OE1 or name OE2)) or (resid 816 and (name N or name CA or name C or name O or name CB or name CG or name CD or name OE1 or name NE2)) or (resid 817 and (name N or name CA or name C or name O or name CB or name CG or name CD or name CE or name NZ )) or (resid 818 and (name N or name CA or name C or name O or name CB or name OG1 or name CG2)) or (resid 819 and (name N or name CA or name C or name O or name CB or name CG or name CD or name CE or name NZ )) or (resid 820 and (name N or name CA or name C or name O or name CB or name CG or name CD or name OE1 or name OE2)) or (resid 821 and (name N or name CA or name C or name O or name CB or name CG or name OD1 or name ND2)) or (resid 822 through 823 and (name N or name CA or name C or name O or name CB or name CG or name CD or name OE1 or name OE2)) or (resid 824 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CD2)) or (resid 825 and (name N or name CA or name C or name O or name CB or name OG1 or name CG2)) or (resid 826 and (name N or name CA or name C or name O or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or (resid 827 and (name N or name CA or name C or name O or name CB or name CG1 or name CG2 or name CD1)) or (resid 828 and (name N or name CA or name C or name O or name CB or name SG )) or (resid 829 through 830 and (name N or name CA or name C or name O or name CB or name CG or name OD1 or name OD2)) or (resid 831 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CD2)) or (resid 832 and (name N or name CA or name C or name O or name CB or name CG1 or name CG2 or name CD1)) or (resid 833 and (name N or name CA or name C or name O or name CB or name OG )) or (resid 834 and (name N or name CA or name C or name O or name CB or name CG or name CD or name CE or name NZ )) or (resid 835 and (name N or name CA or name C or name O or name CB or name CG or name SD or name CE )) or (resid 836 and (name N or name CA or name C or name O or name CB or name CG or name CD or name OE1 or name OE2 or name OXT)))) ; ens_1 d_2 ;(chain "B" and ((resid 782 and (name N or name CA or name C or name O or name CB or name CG1 or name CG2 or name CD1)) or (resid 783 and (name N or name CA or name C or name O or name CB )) or (resid 784 and (name N or name CA or name C or name O or name CB or name CG or name CD or name OE1 or name NE2)) or (resid 785 and (name N or name CA or name C or name O or name CB or name CG1 or name CG2)) or (resid 786 and (name N or name CA or name C or name O or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or (resid 787 and (name N or name CA or name C or name O or name CB or name OG )) or (resid 788 and (name N or name CA or name C or name O or name CB or name CG or name CD or name CE or name NZ )) or (resid 789 and (name N or name CA or name C or name O or name CB )) or (resid 790 and (name N or name CA or name C or name O or name CB or name CG or name CD or name OE1 or name NE2)) or (resid 791 and (name N or name CA or name C or name O or name CB )) or (resid 792 and (name N or name CA or name C or name O or name CB or name CG or name CD or name OE1 or name OE2)) or (resid 793 and (name N or name CA or name C or name O or name CB )) or (resid 794 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CD2)) or (resid 795 and (name N or name CA or name C or name O or name CB )) or (resid 796 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CD2)) or (resid 797 and (name N or name CA or name C or name O or name CB or name CG or name CD or name OE1 or name NE2)) or (resid 798 and (name N or name CA or name C or name O or name CB )) or (resid 799 and (name N or name CA or name C or name O or name CB or name OG )) or (resid 800 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CD2)) or (resid 801 and (name N or name CA or name C or name O or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or (resid 802 and (name N or name CA or name C or name O or name CB or name CG or name CD or name CE or name NZ )) or (resid 803 and (name N or name CA or name C or name O or name CB or name CG or name CD or name OE1 or name OE2)) or (resid 804 and (name N or name CA or name C or name O or name CB or name CG or name CD or name OE1 or name NE2)) or (resid 805 and (name N or name CA or name C or name O or name CB or name CG or name SD or name CE )) or (resid 806 and (name N or name CA or name C or name O or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or (resid 807 and (name N or name CA or name C or name O or name CB or name CG1 or name CG2 or name CD1)) or (resid 808 and (name N or name CA or name C or name O or name CB or name CG or name CD or name OE1 or name NE2)) or (resid 809 and (name N or name CA or name C or name O or name CB or name OG )) or (resid 810 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CD2)) or (resid 811 and (name N or name CA or name C or name O or name CB or name CG or name CD or name OE1 or name OE2)) or (resid 812 and (name N or name CA or name C or name O or name CB or name CG or name CD or name CE or name NZ )) or (resid 813 and (name N or name CA or name C or name O or name CB or name OG1 or name CG2)) or (resid 814 and (name N or name CA or name C or name O or name CB or name CG1 or name CG2)) or (resid 815 and (name N or name CA or name C or name O or name CB or name CG or name CD or name OE1 or name OE2)) or (resid 816 and (name N or name CA or name C or name O or name CB or name CG or name CD or name OE1 or name NE2)) or (resid 817 and (name N or name CA or name C or name O or name CB or name CG or name CD or name CE or name NZ )) or (resid 818 and (name N or name CA or name C or name O or name CB or name OG1 or name CG2)) or (resid 819 and (name N or name CA or name C or name O or name CB or name CG or name CD or name CE or name NZ )) or (resid 820 and (name N or name CA or name C or name O or name CB or name CG or name CD or name OE1 or name OE2)) or (resid 821 and (name N or name CA or name C or name O or name CB or name CG or name OD1 or name ND2)) or (resid 822 through 823 and (name N or name CA or name C or name O or name CB or name CG or name CD or name OE1 or name OE2)) or (resid 824 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CD2)) or (resid 825 and (name N or name CA or name C or name O or name CB or name OG1 or name CG2)) or (resid 826 and (name N or name CA or name C or name O or name CB or name CG or name CD or name NE or name CZ or name NH1 or name NH2)) or (resid 827 and (name N or name CA or name C or name O or name CB or name CG1 or name CG2 or name CD1)) or (resid 828 and (name N or name CA or name C or name O or name CB or name SG )) or (resid 829 through 830 and (name N or name CA or name C or name O or name CB or name CG or name OD1 or name OD2)) or (resid 831 and (name N or name CA or name C or name O or name CB or name CG or name CD1 or name CD2)) or (resid 832 and (name N or name CA or name C or name O or name CB or name CG1 or name CG2 or name CD1)) or (resid 833 and (name N or name CA or name C or name O or name CB or name OG )) or (resid 834 and (name N or name CA or name C or name O or name CB or name CG or name CD or name CE or name NZ )) or (resid 835 and (name N or name CA or name C or name O or name CB or name CG or name SD or name CE )) or (resid 836 and (name N or name CA or name C or name O or name CB or name CG or name CD or name OE1 or name OE2 or name OXT)))) ; # loop_ _struct_ncs_dom_lim.pdbx_ens_id _struct_ncs_dom_lim.dom_id _struct_ncs_dom_lim.pdbx_component_id _struct_ncs_dom_lim.beg_label_asym_id _struct_ncs_dom_lim.beg_label_comp_id _struct_ncs_dom_lim.beg_label_seq_id _struct_ncs_dom_lim.beg_label_alt_id _struct_ncs_dom_lim.end_label_asym_id _struct_ncs_dom_lim.end_label_comp_id _struct_ncs_dom_lim.end_label_seq_id _struct_ncs_dom_lim.end_label_alt_id _struct_ncs_dom_lim.beg_auth_asym_id _struct_ncs_dom_lim.beg_auth_comp_id _struct_ncs_dom_lim.beg_auth_seq_id _struct_ncs_dom_lim.end_auth_asym_id _struct_ncs_dom_lim.end_auth_comp_id _struct_ncs_dom_lim.end_auth_seq_id _struct_ncs_dom_lim.pdbx_refine_code _struct_ncs_dom_lim.selection_details ens_1 d_1 1 A ILE 25 . A GLU 79 . A ILE 782 A GLU 836 ? ? ens_1 d_2 1 B ILE 25 . B GLU 79 . B ILE 782 B GLU 836 ? ? # _struct_ncs_ens.id ens_1 _struct_ncs_ens.details ? # _struct_ncs_ens_gen.ens_id ens_1 _struct_ncs_ens_gen.dom_id_1 d_2 _struct_ncs_ens_gen.dom_id_2 d_1 _struct_ncs_ens_gen.oper_id 1 # _struct.entry_id 9OPF _struct.title 'Context-Dependent Variability Of HIF Heterodimers Influences Interactions With Macromolecular And Small Molecule Partners' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9OPF _struct_keywords.text 'coiled-coiled, coactivator, PROTEIN BINDING' _struct_keywords.pdbx_keywords 'PROTEIN BINDING' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TACC3_HUMAN _struct_ref.pdbx_db_accession Q9Y6A5 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;TQEGQRYQALKAHAEEKLQLANEEIAQVRSKAQAEALALQASLRKEQMRIQSLEKTVEQKTKENEELTRICDDLISKMEK I ; _struct_ref.pdbx_align_begin 758 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 9OPF A 1 ? 81 ? Q9Y6A5 758 ? 838 ? 758 838 2 1 9OPF B 1 ? 81 ? Q9Y6A5 758 ? 838 ? 758 838 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2470 ? 1 MORE -27 ? 1 'SSA (A^2)' 8680 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'NMR relaxation study' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLN A 27 ? LYS A 77 ? GLN A 784 LYS A 834 1 ? 51 HELX_P HELX_P2 AA2 GLU B 24 ? LYS B 77 ? GLU B 781 LYS B 834 1 ? 54 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id MET _struct_mon_prot_cis.label_seq_id 78 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id MET _struct_mon_prot_cis.auth_seq_id 835 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 GLU _struct_mon_prot_cis.pdbx_label_seq_id_2 79 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 GLU _struct_mon_prot_cis.pdbx_auth_seq_id_2 836 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 2.26 # _pdbx_entry_details.entry_id 9OPF _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 783 ? ? 61.12 103.73 2 1 VAL A 785 ? ? -27.74 -40.37 3 1 ILE B 782 ? ? -55.19 -72.03 4 1 MET B 835 ? ? -148.43 11.50 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id B _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 902 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id D _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -x,y,-z 3 x+1/2,y+1/2,z 4 -x+1/2,y+1/2,-z # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A THR 758 ? A THR 1 2 1 Y 1 A GLN 759 ? A GLN 2 3 1 Y 1 A GLU 760 ? A GLU 3 4 1 Y 1 A GLY 761 ? A GLY 4 5 1 Y 1 A GLN 762 ? A GLN 5 6 1 Y 1 A ARG 763 ? A ARG 6 7 1 Y 1 A TYR 764 ? A TYR 7 8 1 Y 1 A GLN 765 ? A GLN 8 9 1 Y 1 A ALA 766 ? A ALA 9 10 1 Y 1 A LEU 767 ? A LEU 10 11 1 Y 1 A LYS 768 ? A LYS 11 12 1 Y 1 A ALA 769 ? A ALA 12 13 1 Y 1 A HIS 770 ? A HIS 13 14 1 Y 1 A ALA 771 ? A ALA 14 15 1 Y 1 A GLU 772 ? A GLU 15 16 1 Y 1 A GLU 773 ? A GLU 16 17 1 Y 1 A LYS 774 ? A LYS 17 18 1 Y 1 A LEU 775 ? A LEU 18 19 1 Y 1 A GLN 776 ? A GLN 19 20 1 Y 1 A LEU 777 ? A LEU 20 21 1 Y 1 A ALA 778 ? A ALA 21 22 1 Y 1 A ASN 779 ? A ASN 22 23 1 Y 1 A GLU 780 ? A GLU 23 24 1 Y 1 A GLU 781 ? A GLU 24 25 1 Y 1 A LYS 837 ? A LYS 80 26 1 Y 1 A ILE 838 ? A ILE 81 27 1 Y 1 B THR 758 ? B THR 1 28 1 Y 1 B GLN 759 ? B GLN 2 29 1 Y 1 B GLU 760 ? B GLU 3 30 1 Y 1 B GLY 761 ? B GLY 4 31 1 Y 1 B GLN 762 ? B GLN 5 32 1 Y 1 B ARG 763 ? B ARG 6 33 1 Y 1 B TYR 764 ? B TYR 7 34 1 Y 1 B GLN 765 ? B GLN 8 35 1 Y 1 B ALA 766 ? B ALA 9 36 1 Y 1 B LEU 767 ? B LEU 10 37 1 Y 1 B LYS 768 ? B LYS 11 38 1 Y 1 B ALA 769 ? B ALA 12 39 1 Y 1 B HIS 770 ? B HIS 13 40 1 Y 1 B ALA 771 ? B ALA 14 41 1 Y 1 B GLU 772 ? B GLU 15 42 1 Y 1 B GLU 773 ? B GLU 16 43 1 Y 1 B LYS 774 ? B LYS 17 44 1 Y 1 B LEU 775 ? B LEU 18 45 1 Y 1 B GLN 776 ? B GLN 19 46 1 Y 1 B LEU 777 ? B LEU 20 47 1 Y 1 B ALA 778 ? B ALA 21 48 1 Y 1 B ASN 779 ? B ASN 22 49 1 Y 1 B LYS 837 ? B LYS 80 50 1 Y 1 B ILE 838 ? B ILE 81 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 SER N N N N 250 SER CA C N S 251 SER C C N N 252 SER O O N N 253 SER CB C N N 254 SER OG O N N 255 SER OXT O N N 256 SER H H N N 257 SER H2 H N N 258 SER HA H N N 259 SER HB2 H N N 260 SER HB3 H N N 261 SER HG H N N 262 SER HXT H N N 263 THR N N N N 264 THR CA C N S 265 THR C C N N 266 THR O O N N 267 THR CB C N R 268 THR OG1 O N N 269 THR CG2 C N N 270 THR OXT O N N 271 THR H H N N 272 THR H2 H N N 273 THR HA H N N 274 THR HB H N N 275 THR HG1 H N N 276 THR HG21 H N N 277 THR HG22 H N N 278 THR HG23 H N N 279 THR HXT H N N 280 TYR N N N N 281 TYR CA C N S 282 TYR C C N N 283 TYR O O N N 284 TYR CB C N N 285 TYR CG C Y N 286 TYR CD1 C Y N 287 TYR CD2 C Y N 288 TYR CE1 C Y N 289 TYR CE2 C Y N 290 TYR CZ C Y N 291 TYR OH O N N 292 TYR OXT O N N 293 TYR H H N N 294 TYR H2 H N N 295 TYR HA H N N 296 TYR HB2 H N N 297 TYR HB3 H N N 298 TYR HD1 H N N 299 TYR HD2 H N N 300 TYR HE1 H N N 301 TYR HE2 H N N 302 TYR HH H N N 303 TYR HXT H N N 304 VAL N N N N 305 VAL CA C N S 306 VAL C C N N 307 VAL O O N N 308 VAL CB C N N 309 VAL CG1 C N N 310 VAL CG2 C N N 311 VAL OXT O N N 312 VAL H H N N 313 VAL H2 H N N 314 VAL HA H N N 315 VAL HB H N N 316 VAL HG11 H N N 317 VAL HG12 H N N 318 VAL HG13 H N N 319 VAL HG21 H N N 320 VAL HG22 H N N 321 VAL HG23 H N N 322 VAL HXT H N N 323 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 SER N CA sing N N 237 SER N H sing N N 238 SER N H2 sing N N 239 SER CA C sing N N 240 SER CA CB sing N N 241 SER CA HA sing N N 242 SER C O doub N N 243 SER C OXT sing N N 244 SER CB OG sing N N 245 SER CB HB2 sing N N 246 SER CB HB3 sing N N 247 SER OG HG sing N N 248 SER OXT HXT sing N N 249 THR N CA sing N N 250 THR N H sing N N 251 THR N H2 sing N N 252 THR CA C sing N N 253 THR CA CB sing N N 254 THR CA HA sing N N 255 THR C O doub N N 256 THR C OXT sing N N 257 THR CB OG1 sing N N 258 THR CB CG2 sing N N 259 THR CB HB sing N N 260 THR OG1 HG1 sing N N 261 THR CG2 HG21 sing N N 262 THR CG2 HG22 sing N N 263 THR CG2 HG23 sing N N 264 THR OXT HXT sing N N 265 TYR N CA sing N N 266 TYR N H sing N N 267 TYR N H2 sing N N 268 TYR CA C sing N N 269 TYR CA CB sing N N 270 TYR CA HA sing N N 271 TYR C O doub N N 272 TYR C OXT sing N N 273 TYR CB CG sing N N 274 TYR CB HB2 sing N N 275 TYR CB HB3 sing N N 276 TYR CG CD1 doub Y N 277 TYR CG CD2 sing Y N 278 TYR CD1 CE1 sing Y N 279 TYR CD1 HD1 sing N N 280 TYR CD2 CE2 doub Y N 281 TYR CD2 HD2 sing N N 282 TYR CE1 CZ doub Y N 283 TYR CE1 HE1 sing N N 284 TYR CE2 CZ sing Y N 285 TYR CE2 HE2 sing N N 286 TYR CZ OH sing N N 287 TYR OH HH sing N N 288 TYR OXT HXT sing N N 289 VAL N CA sing N N 290 VAL N H sing N N 291 VAL N H2 sing N N 292 VAL CA C sing N N 293 VAL CA CB sing N N 294 VAL CA HA sing N N 295 VAL C O doub N N 296 VAL C OXT sing N N 297 VAL CB CG1 sing N N 298 VAL CB CG2 sing N N 299 VAL CB HB sing N N 300 VAL CG1 HG11 sing N N 301 VAL CG1 HG12 sing N N 302 VAL CG1 HG13 sing N N 303 VAL CG2 HG21 sing N N 304 VAL CG2 HG22 sing N N 305 VAL CG2 HG23 sing N N 306 VAL OXT HXT sing N N 307 # _pdbx_audit_support.funding_organization 'National Science Foundation (NSF, United States)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number MCB1818148 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list 2 _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4pky _pdbx_initial_refinement_model.details 'chains B, C' # _space_group.name_H-M_alt 'C 1 2 1' _space_group.name_Hall 'C 2y' _space_group.IT_number 5 _space_group.crystal_system monoclinic _space_group.id 1 # _atom_sites.entry_id 9OPF _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.003801 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000121 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.041971 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.031412 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? 0.51345 0.48472 ? ? 24.73122 6.32584 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ #