data_9PHH # _entry.id 9PHH # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.412 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9PHH pdb_00009phh 10.2210/pdb9phh/pdb WWPDB D_1000294728 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-04-15 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9PHH _pdbx_database_status.recvd_initial_deposition_date 2025-07-09 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email antonina@ninds.nih.gov _pdbx_contact_author.name_first Antonina _pdbx_contact_author.name_last Roll-Mecak _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-2621-7307 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Liu, R.J.Y.' 1 ? 'Roll-Mecak, A.' 2 ? 'Park, J.H.' 3 ? 'Mahalingan, K.K.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'RPGR-TTLL5 complex structure offers insight into disease mechanism' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Park, J.H.' 1 ? primary 'Liu, R.J.Y.' 2 ? primary 'Sun, X.' 3 ? primary 'Mahalingan, K.K.' 4 ? primary 'Hiriyanna, S.' 5 ? primary 'Li, T.' 6 ? primary 'Roll-Mecak, A.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Tubulin polyglutamylase TTLL5, Isoform 6 of X-linked retinitis pigmentosa GTPase regulator chimera' _entity.formula_weight 23751.047 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'Coactivator Interacting Domain (UNP residues 658-822) + linker + GTPase regulator (UNP residues 1126-1152)' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'SRC1 and TIF2-associated modulatory protein,STAMP protein,Tubulin--tyrosine ligase-like protein 5' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SKFNLMQILQDNGNLSKMQARIAFSAYLQHVQIRLMKDSGGQTFSASWAAKEDEQMELVVRFLKRASNNLQHSLRMVLPS RRLALLERRRILAHQLGDFIIVYNKETEQMAEKKSKKKVEEEEEDGVNMENFQEFIRQASEAELEEVLTFYTQKNKSASV FLGTGSAGSAAGSGEFLPETGGSKRLLKNGPSGSKKFWNNVLPHYLELK ; _entity_poly.pdbx_seq_one_letter_code_can ;SKFNLMQILQDNGNLSKMQARIAFSAYLQHVQIRLMKDSGGQTFSASWAAKEDEQMELVVRFLKRASNNLQHSLRMVLPS RRLALLERRRILAHQLGDFIIVYNKETEQMAEKKSKKKVEEEEEDGVNMENFQEFIRQASEAELEEVLTFYTQKNKSASV FLGTGSAGSAAGSGEFLPETGGSKRLLKNGPSGSKKFWNNVLPHYLELK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 LYS n 1 3 PHE n 1 4 ASN n 1 5 LEU n 1 6 MET n 1 7 GLN n 1 8 ILE n 1 9 LEU n 1 10 GLN n 1 11 ASP n 1 12 ASN n 1 13 GLY n 1 14 ASN n 1 15 LEU n 1 16 SER n 1 17 LYS n 1 18 MET n 1 19 GLN n 1 20 ALA n 1 21 ARG n 1 22 ILE n 1 23 ALA n 1 24 PHE n 1 25 SER n 1 26 ALA n 1 27 TYR n 1 28 LEU n 1 29 GLN n 1 30 HIS n 1 31 VAL n 1 32 GLN n 1 33 ILE n 1 34 ARG n 1 35 LEU n 1 36 MET n 1 37 LYS n 1 38 ASP n 1 39 SER n 1 40 GLY n 1 41 GLY n 1 42 GLN n 1 43 THR n 1 44 PHE n 1 45 SER n 1 46 ALA n 1 47 SER n 1 48 TRP n 1 49 ALA n 1 50 ALA n 1 51 LYS n 1 52 GLU n 1 53 ASP n 1 54 GLU n 1 55 GLN n 1 56 MET n 1 57 GLU n 1 58 LEU n 1 59 VAL n 1 60 VAL n 1 61 ARG n 1 62 PHE n 1 63 LEU n 1 64 LYS n 1 65 ARG n 1 66 ALA n 1 67 SER n 1 68 ASN n 1 69 ASN n 1 70 LEU n 1 71 GLN n 1 72 HIS n 1 73 SER n 1 74 LEU n 1 75 ARG n 1 76 MET n 1 77 VAL n 1 78 LEU n 1 79 PRO n 1 80 SER n 1 81 ARG n 1 82 ARG n 1 83 LEU n 1 84 ALA n 1 85 LEU n 1 86 LEU n 1 87 GLU n 1 88 ARG n 1 89 ARG n 1 90 ARG n 1 91 ILE n 1 92 LEU n 1 93 ALA n 1 94 HIS n 1 95 GLN n 1 96 LEU n 1 97 GLY n 1 98 ASP n 1 99 PHE n 1 100 ILE n 1 101 ILE n 1 102 VAL n 1 103 TYR n 1 104 ASN n 1 105 LYS n 1 106 GLU n 1 107 THR n 1 108 GLU n 1 109 GLN n 1 110 MET n 1 111 ALA n 1 112 GLU n 1 113 LYS n 1 114 LYS n 1 115 SER n 1 116 LYS n 1 117 LYS n 1 118 LYS n 1 119 VAL n 1 120 GLU n 1 121 GLU n 1 122 GLU n 1 123 GLU n 1 124 GLU n 1 125 ASP n 1 126 GLY n 1 127 VAL n 1 128 ASN n 1 129 MET n 1 130 GLU n 1 131 ASN n 1 132 PHE n 1 133 GLN n 1 134 GLU n 1 135 PHE n 1 136 ILE n 1 137 ARG n 1 138 GLN n 1 139 ALA n 1 140 SER n 1 141 GLU n 1 142 ALA n 1 143 GLU n 1 144 LEU n 1 145 GLU n 1 146 GLU n 1 147 VAL n 1 148 LEU n 1 149 THR n 1 150 PHE n 1 151 TYR n 1 152 THR n 1 153 GLN n 1 154 LYS n 1 155 ASN n 1 156 LYS n 1 157 SER n 1 158 ALA n 1 159 SER n 1 160 VAL n 1 161 PHE n 1 162 LEU n 1 163 GLY n 1 164 THR n 1 165 GLY n 1 166 SER n 1 167 ALA n 1 168 GLY n 1 169 SER n 1 170 ALA n 1 171 ALA n 1 172 GLY n 1 173 SER n 1 174 GLY n 1 175 GLU n 1 176 PHE n 1 177 LEU n 1 178 PRO n 1 179 GLU n 1 180 THR n 1 181 GLY n 1 182 GLY n 1 183 SER n 1 184 LYS n 1 185 ARG n 1 186 LEU n 1 187 LEU n 1 188 LYS n 1 189 ASN n 1 190 GLY n 1 191 PRO n 1 192 SER n 1 193 GLY n 1 194 SER n 1 195 LYS n 1 196 LYS n 1 197 PHE n 1 198 TRP n 1 199 ASN n 1 200 ASN n 1 201 VAL n 1 202 LEU n 1 203 PRO n 1 204 HIS n 1 205 TYR n 1 206 LEU n 1 207 GLU n 1 208 LEU n 1 209 LYS n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 164 human ? 'TTLL5, KIAA0998, STAMP' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1 2 sample 'Biological sequence' 165 209 human ? 'RPGR, RP3, XLRP3' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 657 ? ? ? A . n A 1 2 LYS 2 658 ? ? ? A . n A 1 3 PHE 3 659 659 PHE PHE A . n A 1 4 ASN 4 660 660 ASN ASN A . n A 1 5 LEU 5 661 661 LEU LEU A . n A 1 6 MET 6 662 662 MET MET A . n A 1 7 GLN 7 663 663 GLN GLN A . n A 1 8 ILE 8 664 664 ILE ILE A . n A 1 9 LEU 9 665 665 LEU LEU A . n A 1 10 GLN 10 666 666 GLN GLN A . n A 1 11 ASP 11 667 667 ASP ASP A . n A 1 12 ASN 12 668 668 ASN ASN A . n A 1 13 GLY 13 669 669 GLY GLY A . n A 1 14 ASN 14 670 670 ASN ASN A . n A 1 15 LEU 15 671 671 LEU LEU A . n A 1 16 SER 16 672 672 SER SER A . n A 1 17 LYS 17 673 673 LYS LYS A . n A 1 18 MET 18 674 674 MET MET A . n A 1 19 GLN 19 675 675 GLN GLN A . n A 1 20 ALA 20 676 676 ALA ALA A . n A 1 21 ARG 21 677 677 ARG ARG A . n A 1 22 ILE 22 678 678 ILE ILE A . n A 1 23 ALA 23 679 679 ALA ALA A . n A 1 24 PHE 24 680 680 PHE PHE A . n A 1 25 SER 25 681 681 SER SER A . n A 1 26 ALA 26 682 682 ALA ALA A . n A 1 27 TYR 27 683 683 TYR TYR A . n A 1 28 LEU 28 684 684 LEU LEU A . n A 1 29 GLN 29 685 685 GLN GLN A . n A 1 30 HIS 30 686 686 HIS HIS A . n A 1 31 VAL 31 687 687 VAL VAL A . n A 1 32 GLN 32 688 688 GLN GLN A . n A 1 33 ILE 33 689 689 ILE ILE A . n A 1 34 ARG 34 690 690 ARG ARG A . n A 1 35 LEU 35 691 691 LEU LEU A . n A 1 36 MET 36 692 692 MET MET A . n A 1 37 LYS 37 693 693 LYS LYS A . n A 1 38 ASP 38 694 694 ASP ASP A . n A 1 39 SER 39 695 695 SER SER A . n A 1 40 GLY 40 696 696 GLY GLY A . n A 1 41 GLY 41 697 697 GLY GLY A . n A 1 42 GLN 42 698 698 GLN GLN A . n A 1 43 THR 43 699 699 THR THR A . n A 1 44 PHE 44 700 700 PHE PHE A . n A 1 45 SER 45 701 701 SER SER A . n A 1 46 ALA 46 702 702 ALA ALA A . n A 1 47 SER 47 703 703 SER SER A . n A 1 48 TRP 48 704 704 TRP TRP A . n A 1 49 ALA 49 705 705 ALA ALA A . n A 1 50 ALA 50 706 706 ALA ALA A . n A 1 51 LYS 51 707 707 LYS LYS A . n A 1 52 GLU 52 708 708 GLU GLU A . n A 1 53 ASP 53 709 709 ASP ASP A . n A 1 54 GLU 54 710 710 GLU GLU A . n A 1 55 GLN 55 711 711 GLN GLN A . n A 1 56 MET 56 712 712 MET MET A . n A 1 57 GLU 57 713 713 GLU GLU A . n A 1 58 LEU 58 714 714 LEU LEU A . n A 1 59 VAL 59 715 715 VAL VAL A . n A 1 60 VAL 60 716 716 VAL VAL A . n A 1 61 ARG 61 717 717 ARG ARG A . n A 1 62 PHE 62 718 718 PHE PHE A . n A 1 63 LEU 63 719 719 LEU LEU A . n A 1 64 LYS 64 720 720 LYS LYS A . n A 1 65 ARG 65 721 721 ARG ARG A . n A 1 66 ALA 66 722 722 ALA ALA A . n A 1 67 SER 67 723 723 SER SER A . n A 1 68 ASN 68 724 724 ASN ASN A . n A 1 69 ASN 69 725 725 ASN ASN A . n A 1 70 LEU 70 726 726 LEU LEU A . n A 1 71 GLN 71 727 727 GLN GLN A . n A 1 72 HIS 72 728 728 HIS HIS A . n A 1 73 SER 73 729 729 SER SER A . n A 1 74 LEU 74 730 730 LEU LEU A . n A 1 75 ARG 75 731 731 ARG ARG A . n A 1 76 MET 76 732 732 MET MET A . n A 1 77 VAL 77 733 733 VAL VAL A . n A 1 78 LEU 78 734 734 LEU LEU A . n A 1 79 PRO 79 735 735 PRO PRO A . n A 1 80 SER 80 736 736 SER SER A . n A 1 81 ARG 81 737 737 ARG ARG A . n A 1 82 ARG 82 738 738 ARG ARG A . n A 1 83 LEU 83 739 739 LEU LEU A . n A 1 84 ALA 84 740 740 ALA ALA A . n A 1 85 LEU 85 741 741 LEU LEU A . n A 1 86 LEU 86 742 742 LEU LEU A . n A 1 87 GLU 87 743 743 GLU GLU A . n A 1 88 ARG 88 744 744 ARG ARG A . n A 1 89 ARG 89 745 745 ARG ARG A . n A 1 90 ARG 90 746 746 ARG ARG A . n A 1 91 ILE 91 747 747 ILE ILE A . n A 1 92 LEU 92 748 748 LEU LEU A . n A 1 93 ALA 93 749 749 ALA ALA A . n A 1 94 HIS 94 750 750 HIS HIS A . n A 1 95 GLN 95 751 751 GLN GLN A . n A 1 96 LEU 96 752 752 LEU LEU A . n A 1 97 GLY 97 753 753 GLY GLY A . n A 1 98 ASP 98 754 754 ASP ASP A . n A 1 99 PHE 99 755 755 PHE PHE A . n A 1 100 ILE 100 756 756 ILE ILE A . n A 1 101 ILE 101 757 757 ILE ILE A . n A 1 102 VAL 102 758 758 VAL VAL A . n A 1 103 TYR 103 759 759 TYR TYR A . n A 1 104 ASN 104 760 760 ASN ASN A . n A 1 105 LYS 105 761 761 LYS LYS A . n A 1 106 GLU 106 762 762 GLU GLU A . n A 1 107 THR 107 763 763 THR THR A . n A 1 108 GLU 108 764 764 GLU GLU A . n A 1 109 GLN 109 765 765 GLN GLN A . n A 1 110 MET 110 766 766 MET MET A . n A 1 111 ALA 111 767 767 ALA ALA A . n A 1 112 GLU 112 768 768 GLU GLU A . n A 1 113 LYS 113 769 769 LYS LYS A . n A 1 114 LYS 114 770 ? ? ? A . n A 1 115 SER 115 771 ? ? ? A . n A 1 116 LYS 116 772 ? ? ? A . n A 1 117 LYS 117 773 ? ? ? A . n A 1 118 LYS 118 774 ? ? ? A . n A 1 119 VAL 119 775 ? ? ? A . n A 1 120 GLU 120 776 ? ? ? A . n A 1 121 GLU 121 777 ? ? ? A . n A 1 122 GLU 122 778 ? ? ? A . n A 1 123 GLU 123 779 ? ? ? A . n A 1 124 GLU 124 780 ? ? ? A . n A 1 125 ASP 125 781 ? ? ? A . n A 1 126 GLY 126 782 ? ? ? A . n A 1 127 VAL 127 783 783 VAL VAL A . n A 1 128 ASN 128 784 784 ASN ASN A . n A 1 129 MET 129 785 785 MET MET A . n A 1 130 GLU 130 786 786 GLU GLU A . n A 1 131 ASN 131 787 787 ASN ASN A . n A 1 132 PHE 132 788 788 PHE PHE A . n A 1 133 GLN 133 789 789 GLN GLN A . n A 1 134 GLU 134 790 790 GLU GLU A . n A 1 135 PHE 135 791 791 PHE PHE A . n A 1 136 ILE 136 792 792 ILE ILE A . n A 1 137 ARG 137 793 793 ARG ARG A . n A 1 138 GLN 138 794 794 GLN GLN A . n A 1 139 ALA 139 795 795 ALA ALA A . n A 1 140 SER 140 796 796 SER SER A . n A 1 141 GLU 141 797 797 GLU GLU A . n A 1 142 ALA 142 798 798 ALA ALA A . n A 1 143 GLU 143 799 799 GLU GLU A . n A 1 144 LEU 144 800 800 LEU LEU A . n A 1 145 GLU 145 801 801 GLU GLU A . n A 1 146 GLU 146 802 802 GLU GLU A . n A 1 147 VAL 147 803 803 VAL VAL A . n A 1 148 LEU 148 804 804 LEU LEU A . n A 1 149 THR 149 805 805 THR THR A . n A 1 150 PHE 150 806 806 PHE PHE A . n A 1 151 TYR 151 807 807 TYR TYR A . n A 1 152 THR 152 808 808 THR THR A . n A 1 153 GLN 153 809 809 GLN GLN A . n A 1 154 LYS 154 810 810 LYS LYS A . n A 1 155 ASN 155 811 811 ASN ASN A . n A 1 156 LYS 156 812 ? ? ? A . n A 1 157 SER 157 813 ? ? ? A . n A 1 158 ALA 158 814 ? ? ? A . n A 1 159 SER 159 815 ? ? ? A . n A 1 160 VAL 160 816 ? ? ? A . n A 1 161 PHE 161 817 ? ? ? A . n A 1 162 LEU 162 818 ? ? ? A . n A 1 163 GLY 163 819 ? ? ? A . n A 1 164 THR 164 820 ? ? ? A . n A 1 165 GLY 165 821 ? ? ? A . n A 1 166 SER 166 822 ? ? ? A . n A 1 167 ALA 167 823 ? ? ? A . n A 1 168 GLY 168 824 ? ? ? A . n A 1 169 SER 169 825 ? ? ? A . n A 1 170 ALA 170 826 ? ? ? A . n A 1 171 ALA 171 827 ? ? ? A . n A 1 172 GLY 172 828 ? ? ? A . n A 1 173 SER 173 829 ? ? ? A . n A 1 174 GLY 174 830 ? ? ? A . n A 1 175 GLU 175 831 ? ? ? A . n A 1 176 PHE 176 832 ? ? ? A . n A 1 177 LEU 177 833 ? ? ? A . n A 1 178 PRO 178 834 ? ? ? A . n A 1 179 GLU 179 835 ? ? ? A . n A 1 180 THR 180 836 ? ? ? A . n A 1 181 GLY 181 837 ? ? ? A . n A 1 182 GLY 182 838 ? ? ? A . n A 1 183 SER 183 839 ? ? ? A . n A 1 184 LYS 184 840 ? ? ? A . n A 1 185 ARG 185 841 ? ? ? A . n A 1 186 LEU 186 842 1129 LEU LEU A . n A 1 187 LEU 187 843 1130 LEU LEU A . n A 1 188 LYS 188 844 1131 LYS LYS A . n A 1 189 ASN 189 845 1132 ASN ASN A . n A 1 190 GLY 190 846 1133 GLY GLY A . n A 1 191 PRO 191 847 1134 PRO PRO A . n A 1 192 SER 192 848 1135 SER SER A . n A 1 193 GLY 193 849 1136 GLY GLY A . n A 1 194 SER 194 850 1137 SER SER A . n A 1 195 LYS 195 851 1138 LYS LYS A . n A 1 196 LYS 196 852 1139 LYS LYS A . n A 1 197 PHE 197 853 1140 PHE PHE A . n A 1 198 TRP 198 854 1141 TRP TRP A . n A 1 199 ASN 199 855 1142 ASN ASN A . n A 1 200 ASN 200 856 1143 ASN ASN A . n A 1 201 VAL 201 857 1144 VAL VAL A . n A 1 202 LEU 202 858 1145 LEU LEU A . n A 1 203 PRO 203 859 1146 PRO PRO A . n A 1 204 HIS 204 860 1147 HIS HIS A . n A 1 205 TYR 205 861 1148 TYR TYR A . n A 1 206 LEU 206 862 1149 LEU LEU A . n A 1 207 GLU 207 863 1150 GLU GLU A . n A 1 208 LEU 208 864 1151 LEU LEU A . n A 1 209 LYS 209 865 1152 LYS LYS A . n # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A PHE 659 ? CG ? A PHE 3 CG 2 1 Y 1 A PHE 659 ? CD1 ? A PHE 3 CD1 3 1 Y 1 A PHE 659 ? CD2 ? A PHE 3 CD2 4 1 Y 1 A PHE 659 ? CE1 ? A PHE 3 CE1 5 1 Y 1 A PHE 659 ? CE2 ? A PHE 3 CE2 6 1 Y 1 A PHE 659 ? CZ ? A PHE 3 CZ 7 1 Y 1 A ASN 660 ? CG ? A ASN 4 CG 8 1 Y 1 A ASN 660 ? OD1 ? A ASN 4 OD1 9 1 Y 1 A ASN 660 ? ND2 ? A ASN 4 ND2 10 1 Y 1 A ILE 664 ? CG1 ? A ILE 8 CG1 11 1 Y 1 A ILE 664 ? CG2 ? A ILE 8 CG2 12 1 Y 1 A ILE 664 ? CD1 ? A ILE 8 CD1 13 1 Y 1 A LYS 693 ? CG ? A LYS 37 CG 14 1 Y 1 A LYS 693 ? CD ? A LYS 37 CD 15 1 Y 1 A LYS 693 ? CE ? A LYS 37 CE 16 1 Y 1 A LYS 693 ? NZ ? A LYS 37 NZ 17 1 Y 1 A SER 695 ? OG ? A SER 39 OG 18 1 Y 1 A PHE 700 ? CG ? A PHE 44 CG 19 1 Y 1 A PHE 700 ? CD1 ? A PHE 44 CD1 20 1 Y 1 A PHE 700 ? CD2 ? A PHE 44 CD2 21 1 Y 1 A PHE 700 ? CE1 ? A PHE 44 CE1 22 1 Y 1 A PHE 700 ? CE2 ? A PHE 44 CE2 23 1 Y 1 A PHE 700 ? CZ ? A PHE 44 CZ 24 1 Y 1 A LYS 707 ? CG ? A LYS 51 CG 25 1 Y 1 A LYS 707 ? CD ? A LYS 51 CD 26 1 Y 1 A LYS 707 ? CE ? A LYS 51 CE 27 1 Y 1 A LYS 707 ? NZ ? A LYS 51 NZ 28 1 Y 1 A GLU 710 ? CG ? A GLU 54 CG 29 1 Y 1 A GLU 710 ? CD ? A GLU 54 CD 30 1 Y 1 A GLU 710 ? OE1 ? A GLU 54 OE1 31 1 Y 1 A GLU 710 ? OE2 ? A GLU 54 OE2 32 1 Y 1 A ARG 717 ? CG ? A ARG 61 CG 33 1 Y 1 A ARG 717 ? CD ? A ARG 61 CD 34 1 Y 1 A ARG 717 ? NE ? A ARG 61 NE 35 1 Y 1 A ARG 717 ? CZ ? A ARG 61 CZ 36 1 Y 1 A ARG 717 ? NH1 ? A ARG 61 NH1 37 1 Y 1 A ARG 717 ? NH2 ? A ARG 61 NH2 38 1 Y 1 A ASN 724 ? CG ? A ASN 68 CG 39 1 Y 1 A ASN 724 ? OD1 ? A ASN 68 OD1 40 1 Y 1 A ASN 724 ? ND2 ? A ASN 68 ND2 41 1 Y 1 A ASN 725 ? CG ? A ASN 69 CG 42 1 Y 1 A ASN 725 ? OD1 ? A ASN 69 OD1 43 1 Y 1 A ASN 725 ? ND2 ? A ASN 69 ND2 44 1 Y 1 A GLN 727 ? CG ? A GLN 71 CG 45 1 Y 1 A GLN 727 ? CD ? A GLN 71 CD 46 1 Y 1 A GLN 727 ? OE1 ? A GLN 71 OE1 47 1 Y 1 A GLN 727 ? NE2 ? A GLN 71 NE2 48 1 Y 1 A HIS 728 ? CB ? A HIS 72 CB 49 1 Y 1 A HIS 728 ? CG ? A HIS 72 CG 50 1 Y 1 A HIS 728 ? ND1 ? A HIS 72 ND1 51 1 Y 1 A HIS 728 ? CD2 ? A HIS 72 CD2 52 1 Y 1 A HIS 728 ? CE1 ? A HIS 72 CE1 53 1 Y 1 A HIS 728 ? NE2 ? A HIS 72 NE2 54 1 Y 1 A SER 729 ? OG ? A SER 73 OG 55 1 Y 1 A ARG 731 ? CG ? A ARG 75 CG 56 1 Y 1 A ARG 731 ? CD ? A ARG 75 CD 57 1 Y 1 A ARG 731 ? NE ? A ARG 75 NE 58 1 Y 1 A ARG 731 ? CZ ? A ARG 75 CZ 59 1 Y 1 A ARG 731 ? NH1 ? A ARG 75 NH1 60 1 Y 1 A ARG 731 ? NH2 ? A ARG 75 NH2 61 1 Y 1 A ARG 738 ? NE ? A ARG 82 NE 62 1 Y 1 A ARG 738 ? CZ ? A ARG 82 CZ 63 1 Y 1 A ARG 738 ? NH1 ? A ARG 82 NH1 64 1 Y 1 A ARG 738 ? NH2 ? A ARG 82 NH2 65 1 Y 1 A LEU 742 ? CG ? A LEU 86 CG 66 1 Y 1 A LEU 742 ? CD1 ? A LEU 86 CD1 67 1 Y 1 A LEU 742 ? CD2 ? A LEU 86 CD2 68 1 Y 1 A GLN 765 ? CG ? A GLN 109 CG 69 1 Y 1 A GLN 765 ? CD ? A GLN 109 CD 70 1 Y 1 A GLN 765 ? OE1 ? A GLN 109 OE1 71 1 Y 1 A GLN 765 ? NE2 ? A GLN 109 NE2 72 1 Y 1 A GLU 768 ? CG ? A GLU 112 CG 73 1 Y 1 A GLU 768 ? CD ? A GLU 112 CD 74 1 Y 1 A GLU 768 ? OE1 ? A GLU 112 OE1 75 1 Y 1 A GLU 768 ? OE2 ? A GLU 112 OE2 76 1 Y 1 A LYS 769 ? CG ? A LYS 113 CG 77 1 Y 1 A LYS 769 ? CD ? A LYS 113 CD 78 1 Y 1 A LYS 769 ? CE ? A LYS 113 CE 79 1 Y 1 A LYS 769 ? NZ ? A LYS 113 NZ 80 1 Y 1 A VAL 783 ? CG1 ? A VAL 127 CG1 81 1 Y 1 A VAL 783 ? CG2 ? A VAL 127 CG2 82 1 Y 1 A ASN 784 ? CG ? A ASN 128 CG 83 1 Y 1 A ASN 784 ? OD1 ? A ASN 128 OD1 84 1 Y 1 A ASN 784 ? ND2 ? A ASN 128 ND2 85 1 Y 1 A GLU 786 ? CG ? A GLU 130 CG 86 1 Y 1 A GLU 786 ? CD ? A GLU 130 CD 87 1 Y 1 A GLU 786 ? OE1 ? A GLU 130 OE1 88 1 Y 1 A GLU 786 ? OE2 ? A GLU 130 OE2 89 1 Y 1 A ASN 787 ? CG ? A ASN 131 CG 90 1 Y 1 A ASN 787 ? OD1 ? A ASN 131 OD1 91 1 Y 1 A ASN 787 ? ND2 ? A ASN 131 ND2 92 1 Y 1 A GLN 789 ? CG ? A GLN 133 CG 93 1 Y 1 A GLN 789 ? CD ? A GLN 133 CD 94 1 Y 1 A GLN 789 ? OE1 ? A GLN 133 OE1 95 1 Y 1 A GLN 789 ? NE2 ? A GLN 133 NE2 96 1 Y 1 A GLU 790 ? CG ? A GLU 134 CG 97 1 Y 1 A GLU 790 ? CD ? A GLU 134 CD 98 1 Y 1 A GLU 790 ? OE1 ? A GLU 134 OE1 99 1 Y 1 A GLU 790 ? OE2 ? A GLU 134 OE2 100 1 Y 1 A ARG 793 ? CG ? A ARG 137 CG 101 1 Y 1 A ARG 793 ? CD ? A ARG 137 CD 102 1 Y 1 A ARG 793 ? NE ? A ARG 137 NE 103 1 Y 1 A ARG 793 ? CZ ? A ARG 137 CZ 104 1 Y 1 A ARG 793 ? NH1 ? A ARG 137 NH1 105 1 Y 1 A ARG 793 ? NH2 ? A ARG 137 NH2 106 1 Y 1 A GLN 794 ? CG ? A GLN 138 CG 107 1 Y 1 A GLN 794 ? CD ? A GLN 138 CD 108 1 Y 1 A GLN 794 ? OE1 ? A GLN 138 OE1 109 1 Y 1 A GLN 794 ? NE2 ? A GLN 138 NE2 110 1 Y 1 A LEU 842 ? CG ? A LEU 186 CG 111 1 Y 1 A LEU 842 ? CD1 ? A LEU 186 CD1 112 1 Y 1 A LEU 842 ? CD2 ? A LEU 186 CD2 113 1 Y 1 A LEU 843 ? CG ? A LEU 187 CG 114 1 Y 1 A LEU 843 ? CD1 ? A LEU 187 CD1 115 1 Y 1 A LEU 843 ? CD2 ? A LEU 187 CD2 116 1 Y 1 A ASN 845 ? CG ? A ASN 189 CG 117 1 Y 1 A ASN 845 ? OD1 ? A ASN 189 OD1 118 1 Y 1 A ASN 845 ? ND2 ? A ASN 189 ND2 119 1 Y 1 A GLU 863 ? CG ? A GLU 207 CG 120 1 Y 1 A GLU 863 ? CD ? A GLU 207 CD 121 1 Y 1 A GLU 863 ? OE1 ? A GLU 207 OE1 122 1 Y 1 A GLU 863 ? OE2 ? A GLU 207 OE2 123 1 Y 1 A LYS 865 ? CG ? A LYS 209 CG 124 1 Y 1 A LYS 865 ? CD ? A LYS 209 CD 125 1 Y 1 A LYS 865 ? CE ? A LYS 209 CE 126 1 Y 1 A LYS 865 ? NZ ? A LYS 209 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.21.2_5419 ? 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . ? 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? . ? 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . ? 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 9PHH _cell.details ? _cell.formula_units_Z ? _cell.length_a 62.906 _cell.length_a_esd ? _cell.length_b 62.906 _cell.length_b_esd ? _cell.length_c 166.631 _cell.length_c_esd ? _cell.volume 659386.334 _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9PHH _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 _symmetry.space_group_name_Hall 'P 4abw 2nw' _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9PHH _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.51 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 65 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '100 mM sodium citrate, pH 6.4, 1.625 M lithium sulfate' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 2M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-05-08 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97741 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ALS BEAMLINE 5.0.1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97741 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 5.0.1 _diffrn_source.pdbx_synchrotron_site ALS # _reflns.B_iso_Wilson_estimate 73.80 _reflns.entry_id 9PHH _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.8 _reflns.d_resolution_low 42.98 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 8879 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 25.1 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 36 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.060 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.8 _reflns_shell.d_res_low 2.95 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1237 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.428 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 60.30 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9PHH _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.80 _refine.ls_d_res_low 42.98 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 8823 _refine.ls_number_reflns_R_free 887 _refine.ls_number_reflns_R_work 7936 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.95 _refine.ls_percent_reflns_R_free 10.05 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2607 _refine.ls_R_factor_R_free 0.2891 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2576 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 28.8953 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.5136 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.80 _refine_hist.d_res_low 42.98 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1223 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1223 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0016 ? 1241 ? f_bond_d ? ? ? 'X-RAY DIFFRACTION' ? 0.3938 ? 1675 ? f_angle_d ? ? ? 'X-RAY DIFFRACTION' ? 0.0296 ? 193 ? f_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.0024 ? 215 ? f_plane_restr ? ? ? 'X-RAY DIFFRACTION' ? 11.0427 ? 436 ? f_dihedral_angle_d ? ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.80 2.98 . . 137 1285 100.00 . . . . 0.4281 . . . . . . . . . . . . . . . 0.4593 'X-RAY DIFFRACTION' 2.98 3.20 . . 145 1290 99.93 . . . . 0.3143 . . . . . . . . . . . . . . . 0.3993 'X-RAY DIFFRACTION' 3.21 3.53 . . 161 1268 99.93 . . . . 0.2812 . . . . . . . . . . . . . . . 0.3459 'X-RAY DIFFRACTION' 3.53 4.04 . . 133 1325 100.00 . . . . 0.2587 . . . . . . . . . . . . . . . 0.3111 'X-RAY DIFFRACTION' 4.04 5.09 . . 168 1317 100.00 . . . . 0.2047 . . . . . . . . . . . . . . . 0.2436 'X-RAY DIFFRACTION' 5.09 42.98 . . 143 1451 99.87 . . . . 0.2509 . . . . . . . . . . . . . . . 0.2442 # _struct.entry_id 9PHH _struct.title 'TTLL5 CID-RPGR BD Complex' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9PHH _struct_keywords.text 'Complex, PROTEIN BINDING' _struct_keywords.pdbx_keywords 'PROTEIN BINDING' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP TTLL5_HUMAN Q6EMB2 ? 1 ;KFNLMQILQDNGNLSKMQARIAFSAYLQHVQIRLMKDSGGQTFSASWAAKEDEQMELVVRFLKRASNNLQHSLRMVLPSR RLALLERRRILAHQLGDFIIVYNKETEQMAEKKSKKKVEEEEEDGVNMENFQEFIRQASEAELEEVLTFYTQKNKSASVF LGT ; 658 2 UNP RPGR_HUMAN Q92834 Q92834-6 1 SKRLLKNGPSGSKKFWNNVLPHYLELK 1126 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 9PHH A 2 ? 164 ? Q6EMB2 658 ? 820 ? 658 820 2 2 9PHH A 183 ? 209 ? Q92834 1126 ? 1152 ? 839 865 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9PHH SER A 1 ? UNP Q6EMB2 ? ? 'expression tag' 657 1 1 9PHH GLY A 165 ? UNP Q6EMB2 ? ? linker 821 2 1 9PHH SER A 166 ? UNP Q6EMB2 ? ? linker 822 3 1 9PHH ALA A 167 ? UNP Q6EMB2 ? ? linker 823 4 1 9PHH GLY A 168 ? UNP Q6EMB2 ? ? linker 824 5 1 9PHH SER A 169 ? UNP Q6EMB2 ? ? linker 825 6 1 9PHH ALA A 170 ? UNP Q6EMB2 ? ? linker 826 7 1 9PHH ALA A 171 ? UNP Q6EMB2 ? ? linker 827 8 1 9PHH GLY A 172 ? UNP Q6EMB2 ? ? linker 828 9 1 9PHH SER A 173 ? UNP Q6EMB2 ? ? linker 829 10 1 9PHH GLY A 174 ? UNP Q6EMB2 ? ? linker 830 11 1 9PHH GLU A 175 ? UNP Q6EMB2 ? ? linker 831 12 1 9PHH PHE A 176 ? UNP Q6EMB2 ? ? linker 832 13 1 9PHH LEU A 177 ? UNP Q6EMB2 ? ? linker 833 14 1 9PHH PRO A 178 ? UNP Q6EMB2 ? ? linker 834 15 1 9PHH GLU A 179 ? UNP Q6EMB2 ? ? linker 835 16 1 9PHH THR A 180 ? UNP Q6EMB2 ? ? linker 836 17 1 9PHH GLY A 181 ? UNP Q6EMB2 ? ? linker 837 18 1 9PHH GLY A 182 ? UNP Q6EMB2 ? ? linker 838 19 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 9140 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'isothermal titration calorimetry' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 4 ? ASP A 11 ? ASN A 660 ASP A 667 1 ? 8 HELX_P HELX_P2 AA2 SER A 16 ? LYS A 37 ? SER A 672 LYS A 693 1 ? 22 HELX_P HELX_P3 AA3 SER A 45 ? GLN A 71 ? SER A 701 GLN A 727 1 ? 27 HELX_P HELX_P4 AA4 ALA A 84 ? LYS A 113 ? ALA A 740 LYS A 769 1 ? 30 HELX_P HELX_P5 AA5 ASN A 128 ? ALA A 139 ? ASN A 784 ALA A 795 1 ? 12 HELX_P HELX_P6 AA6 SER A 140 ? ASN A 155 ? SER A 796 ASN A 811 1 ? 16 HELX_P HELX_P7 AA7 SER A 192 ? VAL A 201 ? SER A 848 VAL A 857 1 ? 10 HELX_P HELX_P8 AA8 LEU A 202 ? LEU A 206 ? LEU A 858 LEU A 862 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _pdbx_entry_details.entry_id 9PHH _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 667 ? ? -102.21 46.94 2 1 PHE A 700 ? ? -67.38 69.63 3 1 GLN A 727 ? ? 64.75 69.13 4 1 HIS A 728 ? ? 59.33 10.71 5 1 ASN A 856 ? ? -130.22 -32.26 6 1 GLU A 863 ? ? -91.81 40.66 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y+1/2,x+1/2,z+1/4 3 y+1/2,-x+1/2,z+3/4 4 x+1/2,-y+1/2,-z+3/4 5 -x+1/2,y+1/2,-z+1/4 6 -x,-y,z+1/2 7 y,x,-z 8 -y,-x,-z+1/2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 657 ? A SER 1 2 1 Y 1 A LYS 658 ? A LYS 2 3 1 Y 1 A LYS 770 ? A LYS 114 4 1 Y 1 A SER 771 ? A SER 115 5 1 Y 1 A LYS 772 ? A LYS 116 6 1 Y 1 A LYS 773 ? A LYS 117 7 1 Y 1 A LYS 774 ? A LYS 118 8 1 Y 1 A VAL 775 ? A VAL 119 9 1 Y 1 A GLU 776 ? A GLU 120 10 1 Y 1 A GLU 777 ? A GLU 121 11 1 Y 1 A GLU 778 ? A GLU 122 12 1 Y 1 A GLU 779 ? A GLU 123 13 1 Y 1 A GLU 780 ? A GLU 124 14 1 Y 1 A ASP 781 ? A ASP 125 15 1 Y 1 A GLY 782 ? A GLY 126 16 1 Y 1 A LYS 812 ? A LYS 156 17 1 Y 1 A SER 813 ? A SER 157 18 1 Y 1 A ALA 814 ? A ALA 158 19 1 Y 1 A SER 815 ? A SER 159 20 1 Y 1 A VAL 816 ? A VAL 160 21 1 Y 1 A PHE 817 ? A PHE 161 22 1 Y 1 A LEU 818 ? A LEU 162 23 1 Y 1 A GLY 819 ? A GLY 163 24 1 Y 1 A THR 820 ? A THR 164 25 1 Y 1 A GLY 821 ? A GLY 165 26 1 Y 1 A SER 822 ? A SER 166 27 1 Y 1 A ALA 823 ? A ALA 167 28 1 Y 1 A GLY 824 ? A GLY 168 29 1 Y 1 A SER 825 ? A SER 169 30 1 Y 1 A ALA 826 ? A ALA 170 31 1 Y 1 A ALA 827 ? A ALA 171 32 1 Y 1 A GLY 828 ? A GLY 172 33 1 Y 1 A SER 829 ? A SER 173 34 1 Y 1 A GLY 830 ? A GLY 174 35 1 Y 1 A GLU 831 ? A GLU 175 36 1 Y 1 A PHE 832 ? A PHE 176 37 1 Y 1 A LEU 833 ? A LEU 177 38 1 Y 1 A PRO 834 ? A PRO 178 39 1 Y 1 A GLU 835 ? A GLU 179 40 1 Y 1 A THR 836 ? A THR 180 41 1 Y 1 A GLY 837 ? A GLY 181 42 1 Y 1 A GLY 838 ? A GLY 182 43 1 Y 1 A SER 839 ? A SER 183 44 1 Y 1 A LYS 840 ? A LYS 184 45 1 Y 1 A ARG 841 ? A ARG 185 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 PHE N N N N 233 PHE CA C N S 234 PHE C C N N 235 PHE O O N N 236 PHE CB C N N 237 PHE CG C Y N 238 PHE CD1 C Y N 239 PHE CD2 C Y N 240 PHE CE1 C Y N 241 PHE CE2 C Y N 242 PHE CZ C Y N 243 PHE OXT O N N 244 PHE H H N N 245 PHE H2 H N N 246 PHE HA H N N 247 PHE HB2 H N N 248 PHE HB3 H N N 249 PHE HD1 H N N 250 PHE HD2 H N N 251 PHE HE1 H N N 252 PHE HE2 H N N 253 PHE HZ H N N 254 PHE HXT H N N 255 PRO N N N N 256 PRO CA C N S 257 PRO C C N N 258 PRO O O N N 259 PRO CB C N N 260 PRO CG C N N 261 PRO CD C N N 262 PRO OXT O N N 263 PRO H H N N 264 PRO HA H N N 265 PRO HB2 H N N 266 PRO HB3 H N N 267 PRO HG2 H N N 268 PRO HG3 H N N 269 PRO HD2 H N N 270 PRO HD3 H N N 271 PRO HXT H N N 272 SER N N N N 273 SER CA C N S 274 SER C C N N 275 SER O O N N 276 SER CB C N N 277 SER OG O N N 278 SER OXT O N N 279 SER H H N N 280 SER H2 H N N 281 SER HA H N N 282 SER HB2 H N N 283 SER HB3 H N N 284 SER HG H N N 285 SER HXT H N N 286 THR N N N N 287 THR CA C N S 288 THR C C N N 289 THR O O N N 290 THR CB C N R 291 THR OG1 O N N 292 THR CG2 C N N 293 THR OXT O N N 294 THR H H N N 295 THR H2 H N N 296 THR HA H N N 297 THR HB H N N 298 THR HG1 H N N 299 THR HG21 H N N 300 THR HG22 H N N 301 THR HG23 H N N 302 THR HXT H N N 303 TRP N N N N 304 TRP CA C N S 305 TRP C C N N 306 TRP O O N N 307 TRP CB C N N 308 TRP CG C Y N 309 TRP CD1 C Y N 310 TRP CD2 C Y N 311 TRP NE1 N Y N 312 TRP CE2 C Y N 313 TRP CE3 C Y N 314 TRP CZ2 C Y N 315 TRP CZ3 C Y N 316 TRP CH2 C Y N 317 TRP OXT O N N 318 TRP H H N N 319 TRP H2 H N N 320 TRP HA H N N 321 TRP HB2 H N N 322 TRP HB3 H N N 323 TRP HD1 H N N 324 TRP HE1 H N N 325 TRP HE3 H N N 326 TRP HZ2 H N N 327 TRP HZ3 H N N 328 TRP HH2 H N N 329 TRP HXT H N N 330 TYR N N N N 331 TYR CA C N S 332 TYR C C N N 333 TYR O O N N 334 TYR CB C N N 335 TYR CG C Y N 336 TYR CD1 C Y N 337 TYR CD2 C Y N 338 TYR CE1 C Y N 339 TYR CE2 C Y N 340 TYR CZ C Y N 341 TYR OH O N N 342 TYR OXT O N N 343 TYR H H N N 344 TYR H2 H N N 345 TYR HA H N N 346 TYR HB2 H N N 347 TYR HB3 H N N 348 TYR HD1 H N N 349 TYR HD2 H N N 350 TYR HE1 H N N 351 TYR HE2 H N N 352 TYR HH H N N 353 TYR HXT H N N 354 VAL N N N N 355 VAL CA C N S 356 VAL C C N N 357 VAL O O N N 358 VAL CB C N N 359 VAL CG1 C N N 360 VAL CG2 C N N 361 VAL OXT O N N 362 VAL H H N N 363 VAL H2 H N N 364 VAL HA H N N 365 VAL HB H N N 366 VAL HG11 H N N 367 VAL HG12 H N N 368 VAL HG13 H N N 369 VAL HG21 H N N 370 VAL HG22 H N N 371 VAL HG23 H N N 372 VAL HXT H N N 373 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 PRO N CA sing N N 245 PRO N CD sing N N 246 PRO N H sing N N 247 PRO CA C sing N N 248 PRO CA CB sing N N 249 PRO CA HA sing N N 250 PRO C O doub N N 251 PRO C OXT sing N N 252 PRO CB CG sing N N 253 PRO CB HB2 sing N N 254 PRO CB HB3 sing N N 255 PRO CG CD sing N N 256 PRO CG HG2 sing N N 257 PRO CG HG3 sing N N 258 PRO CD HD2 sing N N 259 PRO CD HD3 sing N N 260 PRO OXT HXT sing N N 261 SER N CA sing N N 262 SER N H sing N N 263 SER N H2 sing N N 264 SER CA C sing N N 265 SER CA CB sing N N 266 SER CA HA sing N N 267 SER C O doub N N 268 SER C OXT sing N N 269 SER CB OG sing N N 270 SER CB HB2 sing N N 271 SER CB HB3 sing N N 272 SER OG HG sing N N 273 SER OXT HXT sing N N 274 THR N CA sing N N 275 THR N H sing N N 276 THR N H2 sing N N 277 THR CA C sing N N 278 THR CA CB sing N N 279 THR CA HA sing N N 280 THR C O doub N N 281 THR C OXT sing N N 282 THR CB OG1 sing N N 283 THR CB CG2 sing N N 284 THR CB HB sing N N 285 THR OG1 HG1 sing N N 286 THR CG2 HG21 sing N N 287 THR CG2 HG22 sing N N 288 THR CG2 HG23 sing N N 289 THR OXT HXT sing N N 290 TRP N CA sing N N 291 TRP N H sing N N 292 TRP N H2 sing N N 293 TRP CA C sing N N 294 TRP CA CB sing N N 295 TRP CA HA sing N N 296 TRP C O doub N N 297 TRP C OXT sing N N 298 TRP CB CG sing N N 299 TRP CB HB2 sing N N 300 TRP CB HB3 sing N N 301 TRP CG CD1 doub Y N 302 TRP CG CD2 sing Y N 303 TRP CD1 NE1 sing Y N 304 TRP CD1 HD1 sing N N 305 TRP CD2 CE2 doub Y N 306 TRP CD2 CE3 sing Y N 307 TRP NE1 CE2 sing Y N 308 TRP NE1 HE1 sing N N 309 TRP CE2 CZ2 sing Y N 310 TRP CE3 CZ3 doub Y N 311 TRP CE3 HE3 sing N N 312 TRP CZ2 CH2 doub Y N 313 TRP CZ2 HZ2 sing N N 314 TRP CZ3 CH2 sing Y N 315 TRP CZ3 HZ3 sing N N 316 TRP CH2 HH2 sing N N 317 TRP OXT HXT sing N N 318 TYR N CA sing N N 319 TYR N H sing N N 320 TYR N H2 sing N N 321 TYR CA C sing N N 322 TYR CA CB sing N N 323 TYR CA HA sing N N 324 TYR C O doub N N 325 TYR C OXT sing N N 326 TYR CB CG sing N N 327 TYR CB HB2 sing N N 328 TYR CB HB3 sing N N 329 TYR CG CD1 doub Y N 330 TYR CG CD2 sing Y N 331 TYR CD1 CE1 sing Y N 332 TYR CD1 HD1 sing N N 333 TYR CD2 CE2 doub Y N 334 TYR CD2 HD2 sing N N 335 TYR CE1 CZ doub Y N 336 TYR CE1 HE1 sing N N 337 TYR CE2 CZ sing Y N 338 TYR CE2 HE2 sing N N 339 TYR CZ OH sing N N 340 TYR OH HH sing N N 341 TYR OXT HXT sing N N 342 VAL N CA sing N N 343 VAL N H sing N N 344 VAL N H2 sing N N 345 VAL CA C sing N N 346 VAL CA CB sing N N 347 VAL CA HA sing N N 348 VAL C O doub N N 349 VAL C OXT sing N N 350 VAL CB CG1 sing N N 351 VAL CB CG2 sing N N 352 VAL CB HB sing N N 353 VAL CG1 HG11 sing N N 354 VAL CG1 HG12 sing N N 355 VAL CG1 HG13 sing N N 356 VAL CG2 HG21 sing N N 357 VAL CG2 HG22 sing N N 358 VAL CG2 HG23 sing N N 359 VAL OXT HXT sing N N 360 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of Neurological Disorders and Stroke (NIH/NINDS)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number '1ZIA NS003163-08' _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'in silico model' _pdbx_initial_refinement_model.source_name AlphaFold _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'P 41 21 2' _space_group.name_Hall 'P 4abw 2nw' _space_group.IT_number 92 _space_group.crystal_system tetragonal _space_group.id 1 # _atom_sites.entry_id 9PHH _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.015897 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015897 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006001 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 7.96527 ? ? ? 9.05267 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ #