data_9PHR # _entry.id 9PHR # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.407 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9PHR pdb_00009phr 10.2210/pdb9phr/pdb WWPDB D_1000297853 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2025-11-19 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9PHR _pdbx_database_status.recvd_initial_deposition_date 2025-07-09 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 4 _pdbx_contact_author.email aimee.eggler@villanova.edu _pdbx_contact_author.name_first Aimee _pdbx_contact_author.name_last Eggler _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-7286-2107 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Ragwan, E.R.' 1 0000-0003-3233-4956 'Kung, Y.' 2 0000-0002-6132-7969 'Eggler, A.L.' 3 0000-0002-7286-2107 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Redox Biol' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2213-2317 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 88 _citation.language ? _citation.page_first 103906 _citation.page_last 103906 _citation.title 'KEAP1 C151 active site catalysis drives electrophilic signaling to upregulate cytoprotective enzyme expression.' _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.redox.2025.103906 _citation.pdbx_database_id_PubMed 41187500 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Schnell, M.R.' 1 ? primary 'Zhai, T.' 2 ? primary 'Ragwan, E.R.' 3 ? primary 'Jung, H.' 4 ? primary 'Zhang, J.' 5 ? primary 'Lagalante, A.F.' 6 ? primary 'Kung, Y.' 7 ? primary 'Kraut, D.A.' 8 ? primary 'Huang, Z.' 9 ? primary 'Eggler, A.L.' 10 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Kelch-like ECH-associated protein 1' 14709.019 1 ? S172A ? ? 2 non-polymer syn '3-(bromomethyl)-2,5,6-trimethyl-1H,7H-pyrazolo[1,2-a]pyrazole-1,7-dione' 271.111 1 ? ? ? ? 3 water nat water 18.015 16 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Cytosolic inhibitor of Nrf2,INrf2,Kelch-like protein 19' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;RTFSYTLEDHTKQAFGIMNELRLSQQLCDVTLQVKYQDAPAAQFMAHKVVLASSSPVFKAMFTNGLREQGMEVVSIEGIH PKVMERLIEFAYTASISMGEKCVLHVMNGAVMYQIDSVVRACADFLVQQLD ; _entity_poly.pdbx_seq_one_letter_code_can ;RTFSYTLEDHTKQAFGIMNELRLSQQLCDVTLQVKYQDAPAAQFMAHKVVLASSSPVFKAMFTNGLREQGMEVVSIEGIH PKVMERLIEFAYTASISMGEKCVLHVMNGAVMYQIDSVVRACADFLVQQLD ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '3-(bromomethyl)-2,5,6-trimethyl-1H,7H-pyrazolo[1,2-a]pyrazole-1,7-dione' 9UM 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ARG n 1 2 THR n 1 3 PHE n 1 4 SER n 1 5 TYR n 1 6 THR n 1 7 LEU n 1 8 GLU n 1 9 ASP n 1 10 HIS n 1 11 THR n 1 12 LYS n 1 13 GLN n 1 14 ALA n 1 15 PHE n 1 16 GLY n 1 17 ILE n 1 18 MET n 1 19 ASN n 1 20 GLU n 1 21 LEU n 1 22 ARG n 1 23 LEU n 1 24 SER n 1 25 GLN n 1 26 GLN n 1 27 LEU n 1 28 CYS n 1 29 ASP n 1 30 VAL n 1 31 THR n 1 32 LEU n 1 33 GLN n 1 34 VAL n 1 35 LYS n 1 36 TYR n 1 37 GLN n 1 38 ASP n 1 39 ALA n 1 40 PRO n 1 41 ALA n 1 42 ALA n 1 43 GLN n 1 44 PHE n 1 45 MET n 1 46 ALA n 1 47 HIS n 1 48 LYS n 1 49 VAL n 1 50 VAL n 1 51 LEU n 1 52 ALA n 1 53 SER n 1 54 SER n 1 55 SER n 1 56 PRO n 1 57 VAL n 1 58 PHE n 1 59 LYS n 1 60 ALA n 1 61 MET n 1 62 PHE n 1 63 THR n 1 64 ASN n 1 65 GLY n 1 66 LEU n 1 67 ARG n 1 68 GLU n 1 69 GLN n 1 70 GLY n 1 71 MET n 1 72 GLU n 1 73 VAL n 1 74 VAL n 1 75 SER n 1 76 ILE n 1 77 GLU n 1 78 GLY n 1 79 ILE n 1 80 HIS n 1 81 PRO n 1 82 LYS n 1 83 VAL n 1 84 MET n 1 85 GLU n 1 86 ARG n 1 87 LEU n 1 88 ILE n 1 89 GLU n 1 90 PHE n 1 91 ALA n 1 92 TYR n 1 93 THR n 1 94 ALA n 1 95 SER n 1 96 ILE n 1 97 SER n 1 98 MET n 1 99 GLY n 1 100 GLU n 1 101 LYS n 1 102 CYS n 1 103 VAL n 1 104 LEU n 1 105 HIS n 1 106 VAL n 1 107 MET n 1 108 ASN n 1 109 GLY n 1 110 ALA n 1 111 VAL n 1 112 MET n 1 113 TYR n 1 114 GLN n 1 115 ILE n 1 116 ASP n 1 117 SER n 1 118 VAL n 1 119 VAL n 1 120 ARG n 1 121 ALA n 1 122 CYS n 1 123 ALA n 1 124 ASP n 1 125 PHE n 1 126 LEU n 1 127 VAL n 1 128 GLN n 1 129 GLN n 1 130 LEU n 1 131 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 131 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'KEAP1, INRF2, KIAA0132, KLHL19' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 9UM non-polymer . '3-(bromomethyl)-2,5,6-trimethyl-1H,7H-pyrazolo[1,2-a]pyrazole-1,7-dione' ? 'C10 H11 Br N2 O2' 271.111 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ARG 1 50 50 ARG ARG A . n A 1 2 THR 2 51 51 THR THR A . n A 1 3 PHE 3 52 52 PHE PHE A . n A 1 4 SER 4 53 53 SER SER A . n A 1 5 TYR 5 54 54 TYR TYR A . n A 1 6 THR 6 55 55 THR THR A . n A 1 7 LEU 7 56 56 LEU LEU A . n A 1 8 GLU 8 57 57 GLU GLU A . n A 1 9 ASP 9 58 58 ASP ASP A . n A 1 10 HIS 10 59 59 HIS HIS A . n A 1 11 THR 11 60 60 THR THR A . n A 1 12 LYS 12 61 61 LYS LYS A . n A 1 13 GLN 13 62 62 GLN GLN A . n A 1 14 ALA 14 63 63 ALA ALA A . n A 1 15 PHE 15 64 64 PHE PHE A . n A 1 16 GLY 16 65 65 GLY GLY A . n A 1 17 ILE 17 66 66 ILE ILE A . n A 1 18 MET 18 67 67 MET MET A . n A 1 19 ASN 19 68 68 ASN ASN A . n A 1 20 GLU 20 69 69 GLU GLU A . n A 1 21 LEU 21 70 70 LEU LEU A . n A 1 22 ARG 22 71 71 ARG ARG A . n A 1 23 LEU 23 72 72 LEU LEU A . n A 1 24 SER 24 73 73 SER SER A . n A 1 25 GLN 25 74 74 GLN GLN A . n A 1 26 GLN 26 75 75 GLN GLN A . n A 1 27 LEU 27 76 76 LEU LEU A . n A 1 28 CYS 28 77 77 CYS CYS A . n A 1 29 ASP 29 78 78 ASP ASP A . n A 1 30 VAL 30 79 79 VAL VAL A . n A 1 31 THR 31 80 80 THR THR A . n A 1 32 LEU 32 81 81 LEU LEU A . n A 1 33 GLN 33 82 82 GLN GLN A . n A 1 34 VAL 34 83 83 VAL VAL A . n A 1 35 LYS 35 84 84 LYS LYS A . n A 1 36 TYR 36 85 85 TYR TYR A . n A 1 37 GLN 37 86 86 GLN GLN A . n A 1 38 ASP 38 87 87 ASP ASP A . n A 1 39 ALA 39 88 88 ALA ALA A . n A 1 40 PRO 40 89 89 PRO PRO A . n A 1 41 ALA 41 90 90 ALA ALA A . n A 1 42 ALA 42 91 91 ALA ALA A . n A 1 43 GLN 43 92 92 GLN GLN A . n A 1 44 PHE 44 93 93 PHE PHE A . n A 1 45 MET 45 94 94 MET MET A . n A 1 46 ALA 46 95 95 ALA ALA A . n A 1 47 HIS 47 96 96 HIS HIS A . n A 1 48 LYS 48 97 97 LYS LYS A . n A 1 49 VAL 49 98 98 VAL VAL A . n A 1 50 VAL 50 99 99 VAL VAL A . n A 1 51 LEU 51 100 100 LEU LEU A . n A 1 52 ALA 52 101 101 ALA ALA A . n A 1 53 SER 53 102 102 SER SER A . n A 1 54 SER 54 103 103 SER SER A . n A 1 55 SER 55 104 104 SER SER A . n A 1 56 PRO 56 105 105 PRO PRO A . n A 1 57 VAL 57 106 106 VAL VAL A . n A 1 58 PHE 58 107 107 PHE PHE A . n A 1 59 LYS 59 108 108 LYS LYS A . n A 1 60 ALA 60 109 109 ALA ALA A . n A 1 61 MET 61 110 110 MET MET A . n A 1 62 PHE 62 111 111 PHE PHE A . n A 1 63 THR 63 112 112 THR THR A . n A 1 64 ASN 64 113 113 ASN ASN A . n A 1 65 GLY 65 114 114 GLY GLY A . n A 1 66 LEU 66 115 115 LEU LEU A . n A 1 67 ARG 67 116 116 ARG ARG A . n A 1 68 GLU 68 117 117 GLU GLU A . n A 1 69 GLN 69 118 118 GLN GLN A . n A 1 70 GLY 70 119 119 GLY GLY A . n A 1 71 MET 71 120 120 MET MET A . n A 1 72 GLU 72 121 121 GLU GLU A . n A 1 73 VAL 73 122 122 VAL VAL A . n A 1 74 VAL 74 123 123 VAL VAL A . n A 1 75 SER 75 124 124 SER SER A . n A 1 76 ILE 76 125 125 ILE ILE A . n A 1 77 GLU 77 126 126 GLU GLU A . n A 1 78 GLY 78 127 127 GLY GLY A . n A 1 79 ILE 79 128 128 ILE ILE A . n A 1 80 HIS 80 129 129 HIS HIS A . n A 1 81 PRO 81 130 130 PRO PRO A . n A 1 82 LYS 82 131 131 LYS LYS A . n A 1 83 VAL 83 132 132 VAL VAL A . n A 1 84 MET 84 133 133 MET MET A . n A 1 85 GLU 85 134 134 GLU GLU A . n A 1 86 ARG 86 135 135 ARG ARG A . n A 1 87 LEU 87 136 136 LEU LEU A . n A 1 88 ILE 88 137 137 ILE ILE A . n A 1 89 GLU 89 138 138 GLU GLU A . n A 1 90 PHE 90 139 139 PHE PHE A . n A 1 91 ALA 91 140 140 ALA ALA A . n A 1 92 TYR 92 141 141 TYR TYR A . n A 1 93 THR 93 142 142 THR THR A . n A 1 94 ALA 94 143 143 ALA ALA A . n A 1 95 SER 95 144 144 SER SER A . n A 1 96 ILE 96 145 145 ILE ILE A . n A 1 97 SER 97 146 146 SER SER A . n A 1 98 MET 98 147 147 MET MET A . n A 1 99 GLY 99 148 148 GLY GLY A . n A 1 100 GLU 100 149 149 GLU GLU A . n A 1 101 LYS 101 150 150 LYS LYS A . n A 1 102 CYS 102 151 151 CYS CYS A . n A 1 103 VAL 103 152 152 VAL VAL A . n A 1 104 LEU 104 153 153 LEU LEU A . n A 1 105 HIS 105 154 154 HIS HIS A . n A 1 106 VAL 106 155 155 VAL VAL A . n A 1 107 MET 107 156 156 MET MET A . n A 1 108 ASN 108 157 157 ASN ASN A . n A 1 109 GLY 109 158 158 GLY GLY A . n A 1 110 ALA 110 159 159 ALA ALA A . n A 1 111 VAL 111 160 160 VAL VAL A . n A 1 112 MET 112 161 161 MET MET A . n A 1 113 TYR 113 162 162 TYR TYR A . n A 1 114 GLN 114 163 163 GLN GLN A . n A 1 115 ILE 115 164 164 ILE ILE A . n A 1 116 ASP 116 165 165 ASP ASP A . n A 1 117 SER 117 166 166 SER SER A . n A 1 118 VAL 118 167 167 VAL VAL A . n A 1 119 VAL 119 168 168 VAL VAL A . n A 1 120 ARG 120 169 169 ARG ARG A . n A 1 121 ALA 121 170 170 ALA ALA A . n A 1 122 CYS 122 171 171 CYS CYS A . n A 1 123 ALA 123 172 172 ALA ALA A . n A 1 124 ASP 124 173 173 ASP ASP A . n A 1 125 PHE 125 174 174 PHE PHE A . n A 1 126 LEU 126 175 175 LEU LEU A . n A 1 127 VAL 127 176 176 VAL VAL A . n A 1 128 GLN 128 177 177 GLN GLN A . n A 1 129 GLN 129 178 178 GLN GLN A . n A 1 130 LEU 130 179 179 LEU LEU A . n A 1 131 ASP 131 180 180 ASP ASP A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id 9UM _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id 9UM _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 9UM 1 201 201 9UM 9UM A . C 3 HOH 1 301 15 HOH HOH A . C 3 HOH 2 302 4 HOH HOH A . C 3 HOH 3 303 13 HOH HOH A . C 3 HOH 4 304 2 HOH HOH A . C 3 HOH 5 305 3 HOH HOH A . C 3 HOH 6 306 16 HOH HOH A . C 3 HOH 7 307 12 HOH HOH A . C 3 HOH 8 308 9 HOH HOH A . C 3 HOH 9 309 11 HOH HOH A . C 3 HOH 10 310 10 HOH HOH A . C 3 HOH 11 311 5 HOH HOH A . C 3 HOH 12 312 7 HOH HOH A . C 3 HOH 13 313 14 HOH HOH A . C 3 HOH 14 314 8 HOH HOH A . C 3 HOH 15 315 6 HOH HOH A . C 3 HOH 16 316 1 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 50 ? CG ? A ARG 1 CG 2 1 Y 1 A ARG 50 ? CD ? A ARG 1 CD 3 1 Y 1 A ARG 50 ? NE ? A ARG 1 NE 4 1 Y 1 A ARG 50 ? CZ ? A ARG 1 CZ 5 1 Y 1 A ARG 50 ? NH1 ? A ARG 1 NH1 6 1 Y 1 A ARG 50 ? NH2 ? A ARG 1 NH2 7 1 Y 1 A LEU 115 ? CG ? A LEU 66 CG 8 1 Y 1 A LEU 115 ? CD1 ? A LEU 66 CD1 9 1 Y 1 A LEU 115 ? CD2 ? A LEU 66 CD2 10 1 Y 1 A ARG 116 ? CG ? A ARG 67 CG 11 1 Y 1 A ARG 116 ? CD ? A ARG 67 CD 12 1 Y 1 A ARG 116 ? NE ? A ARG 67 NE 13 1 Y 1 A ARG 116 ? CZ ? A ARG 67 CZ 14 1 Y 1 A ARG 116 ? NH1 ? A ARG 67 NH1 15 1 Y 1 A ARG 116 ? NH2 ? A ARG 67 NH2 16 1 Y 1 A GLN 118 ? CG ? A GLN 69 CG 17 1 Y 1 A GLN 118 ? CD ? A GLN 69 CD 18 1 Y 1 A GLN 118 ? OE1 ? A GLN 69 OE1 19 1 Y 1 A GLN 118 ? NE2 ? A GLN 69 NE2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.21.1_5286: ???)' ? 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . ? 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . ? 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . ? 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 9PHR _cell.details ? _cell.formula_units_Z ? _cell.length_a 42.976 _cell.length_a_esd ? _cell.length_b 42.976 _cell.length_b_esd ? _cell.length_c 266.628 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9PHR _symmetry.cell_setting ? _symmetry.Int_Tables_number 179 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 65 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9PHR _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.42 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 49.09 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M lithium acetate, 5% glycerol, and 14 to 20% PEG 3350' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 289.15 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2024-06-21 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9201 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'NSLS-II BEAMLINE 17-ID-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9201 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 17-ID-1 _diffrn_source.pdbx_synchrotron_site NSLS-II # _reflns.B_iso_Wilson_estimate 44.77 _reflns.entry_id 9PHR _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.801 _reflns.d_resolution_low 32.36 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 14489 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.07 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 36.7 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 12.45 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.801 _reflns_shell.d_res_low 1.94 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 2786 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.485 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9PHR _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.801 _refine.ls_d_res_low 32.36 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 14393 _refine.ls_number_reflns_R_free 729 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.07 _refine.ls_percent_reflns_R_free ? _refine.ls_R_factor_all ? _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.2820 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2339 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.801 _refine_hist.d_res_low 32.36 _refine_hist.number_atoms_solvent 16 _refine_hist.number_atoms_total 1036 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1006 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 14 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.801 _refine_ls_shell.d_res_low 1.94 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 146 _refine_ls_shell.number_reflns_R_work 2702 _refine_ls_shell.percent_reflns_obs 95.82 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.3541 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.correlation_coeff_Fo_to_Fc ? _refine_ls_shell.correlation_coeff_Fo_to_Fc_free ? _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work ? _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free ? _refine_ls_shell.pdbx_total_number_of_bins_used ? _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? _refine_ls_shell.R_factor_R_free 0.3817 # _struct.entry_id 9PHR _struct.title 'BTB modified at C151 with monobimane' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9PHR _struct_keywords.text 'BTB modified at C151 with monobimane, SIGNALING PROTEIN' _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code KEAP1_HUMAN _struct_ref.pdbx_db_accession Q14145 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;RTFSYTLEDHTKQAFGIMNELRLSQQLCDVTLQVKYQDAPAAQFMAHKVVLASSSPVFKAMFTNGLREQGMEVVSIEGIH PKVMERLIEFAYTASISMGEKCVLHVMNGAVMYQIDSVVRACSDFLVQQLD ; _struct_ref.pdbx_align_begin 50 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9PHR _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 131 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q14145 _struct_ref_seq.db_align_beg 50 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 180 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 50 _struct_ref_seq.pdbx_auth_seq_align_end 180 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 9PHR _struct_ref_seq_dif.mon_id ALA _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 123 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q14145 _struct_ref_seq_dif.db_mon_id SER _struct_ref_seq_dif.pdbx_seq_db_seq_num 172 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 172 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 9 ? SER A 24 ? ASP A 58 SER A 73 1 ? 16 HELX_P HELX_P2 AA2 HIS A 47 ? SER A 55 ? HIS A 96 SER A 104 1 ? 9 HELX_P HELX_P3 AA3 SER A 55 ? THR A 63 ? SER A 104 THR A 112 1 ? 9 HELX_P HELX_P4 AA4 HIS A 80 ? ALA A 94 ? HIS A 129 ALA A 143 1 ? 15 HELX_P HELX_P5 AA5 GLY A 99 ? LYS A 101 ? GLY A 148 LYS A 150 5 ? 3 HELX_P HELX_P6 AA6 CYS A 102 ? GLN A 114 ? CYS A 151 GLN A 163 1 ? 13 HELX_P HELX_P7 AA7 ILE A 115 ? GLN A 129 ? ILE A 164 GLN A 178 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale one ? A CYS 102 SG A ? ? 1_555 B 9UM . C8 A ? A CYS 151 A 9UM 201 1_555 ? ? ? ? ? ? ? 1.766 ? ? covale2 covale one ? A CYS 102 SG B ? ? 1_555 B 9UM . C8 B ? A CYS 151 A 9UM 201 1_555 ? ? ? ? ? ? ? 1.768 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 9UM B . A CYS A 102 A 9UM A 201 ? 1_555 CYS A 151 ? 1_555 C8 SG CYS 1 9UM None 'Covalent chemical modification' 2 9UM B . B CYS A 102 B 9UM A 201 ? 1_555 CYS A 151 ? 1_555 C8 SG CYS 1 9UM None 'Covalent chemical modification' # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ALA A 42 ? ALA A 46 ? ALA A 91 ALA A 95 AA1 2 VAL A 30 ? VAL A 34 ? VAL A 79 VAL A 83 AA1 3 GLU A 72 ? ILE A 76 ? GLU A 121 ILE A 125 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O ALA A 42 ? O ALA A 91 N VAL A 34 ? N VAL A 83 AA1 2 3 N GLN A 33 ? N GLN A 82 O VAL A 74 ? O VAL A 123 # _pdbx_entry_details.entry_id 9PHR _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OD1 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ASP _pdbx_validate_close_contact.auth_seq_id_1 58 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 NE2 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 GLN _pdbx_validate_close_contact.auth_seq_id_2 62 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.13 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CG A MET 67 ? ? SD A MET 67 ? ? CE A MET 67 ? ? 87.41 100.20 -12.79 1.60 N 2 1 CB A TYR 85 ? ? CG A TYR 85 ? ? CD1 A TYR 85 ? ? 116.16 121.00 -4.84 0.60 N 3 1 CG A ARG 135 ? ? CD A ARG 135 ? ? NE A ARG 135 ? ? 89.91 111.80 -21.89 2.10 N 4 1 CG A MET 156 ? ? SD A MET 156 ? ? CE A MET 156 ? ? 86.23 100.20 -13.97 1.60 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 74 ? ? 38.71 47.25 2 1 GLN A 86 ? ? 39.43 -112.81 3 1 LEU A 115 ? ? -165.75 113.84 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 TYR A 85 ? ? 0.061 'SIDE CHAIN' 2 1 ARG A 135 ? ? 0.201 'SIDE CHAIN' # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x-y,x,z+5/6 3 y,-x+y,z+1/6 4 -y,x-y,z+2/3 5 -x+y,-x,z+1/3 6 x-y,-y,-z 7 -x,-x+y,-z+1/3 8 -x,-y,z+1/2 9 y,x,-z+2/3 10 -y,-x,-z+1/6 11 -x+y,y,-z+1/2 12 x,x-y,-z+5/6 # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 29.9391 -21.6640 -29.3800 0.5103 ? 0.1173 ? -0.0798 ? 1.0943 ? 0.0430 ? 0.8004 ? 9.2596 ? -6.9595 ? -5.3304 ? 7.0501 ? 6.9051 ? 8.8810 ? 1.2109 ? 1.7317 ? 2.2609 ? -0.0234 ? -1.7662 ? -3.4899 ? -0.2560 ? 0.8794 ? 0.1465 ? 2 'X-RAY DIFFRACTION' ? refined 10.8988 -12.1426 -27.1340 0.5065 ? 0.0874 ? 0.0583 ? 0.3684 ? 0.0243 ? 0.3009 ? 3.2382 ? -1.6606 ? 4.8373 ? 5.8056 ? -0.6065 ? 8.0120 ? -0.1057 ? 0.5503 ? 0.3600 ? -0.6135 ? -0.2893 ? -0.3115 ? -0.5077 ? 0.2909 ? 0.2942 ? 3 'X-RAY DIFFRACTION' ? refined -2.0318 -14.5744 -20.9195 0.5202 ? 0.1881 ? 0.0600 ? 0.4730 ? -0.0911 ? 0.4872 ? 3.7198 ? -4.4873 ? -5.2793 ? 5.4765 ? 6.7662 ? 8.3569 ? 0.8047 ? 0.9706 ? -0.3019 ? -0.1839 ? -0.5897 ? 0.4562 ? -0.8420 ? -2.0188 ? 0.0710 ? 4 'X-RAY DIFFRACTION' ? refined -5.1403 -5.7762 -13.7682 0.8720 ? 0.3262 ? 0.0814 ? 0.4601 ? -0.0550 ? 0.4357 ? 5.2667 ? -2.6831 ? -4.4642 ? 5.0968 ? 4.8973 ? 7.3721 ? -0.1061 ? -0.4908 ? 0.2945 ? 0.9424 ? -0.0108 ? 0.5590 ? -1.3931 ? -0.3789 ? 0.1701 ? 5 'X-RAY DIFFRACTION' ? refined 6.7675 -18.0274 -12.3733 0.6870 ? 0.1709 ? 0.0890 ? 0.3653 ? -0.0191 ? 0.3288 ? 5.3038 ? 3.4754 ? 1.1869 ? 9.0342 ? -3.5837 ? 3.1814 ? -0.0230 ? -0.5008 ? -0.3473 ? 0.8196 ? 0.0029 ? 0.5926 ? -0.2397 ? 0.3425 ? 0.0980 ? 6 'X-RAY DIFFRACTION' ? refined -1.2461 -26.6310 -14.7205 1.4176 ? 0.0727 ? 0.0933 ? 0.7386 ? 0.0552 ? 1.4840 ? 7.7784 ? -3.9648 ? -2.5911 ? 7.4880 ? -1.0639 ? 1.9965 ? 0.3955 ? -0.2338 ? -3.9514 ? -1.0840 ? -1.3244 ? 1.8448 ? 2.7359 ? -0.2479 ? 1.0432 ? 7 'X-RAY DIFFRACTION' ? refined -4.0495 -10.6646 -9.8810 0.9608 ? 0.3393 ? 0.2434 ? 0.6872 ? -0.0078 ? 0.5670 ? 8.5521 ? 4.7555 ? 3.7073 ? 2.8201 ? 1.9696 ? 1.6544 ? -0.4054 ? -1.6767 ? -1.0609 ? 0.3771 ? -0.4999 ? -0.6692 ? -0.2930 ? -0.4086 ? 0.7295 ? 8 'X-RAY DIFFRACTION' ? refined 5.9489 -5.1379 -16.2003 0.8006 ? 0.0788 ? -0.0963 ? 0.2941 ? 0.0263 ? 0.3118 ? 7.6935 ? -7.1795 ? -5.4371 ? 7.5040 ? 6.6660 ? 6.8621 ? -0.0690 ? 0.3048 ? 0.8412 ? -0.1709 ? 0.0329 ? -0.1850 ? -1.0958 ? -0.0784 ? 0.1726 ? 9 'X-RAY DIFFRACTION' ? refined 11.6568 0.6547 -15.3385 1.6594 ? -0.1004 ? -0.1977 ? 0.4378 ? 0.0239 ? 0.6226 ? 2.7111 ? 1.9217 ? 0.5765 ? 4.8459 ? 3.8215 ? 3.4626 ? -0.2948 ? 0.6383 ? 2.0191 ? 0.1527 ? -0.4029 ? -0.4502 ? -3.3195 ? -0.8606 ? 0.7040 ? 10 'X-RAY DIFFRACTION' ? refined 6.9192 -0.3285 -6.1882 1.2639 ? 0.1376 ? -0.1394 ? 0.5102 ? -0.0967 ? 0.5132 ? 8.2506 ? 0.9793 ? -1.6992 ? 5.0372 ? 3.1521 ? 2.6573 ? -0.0105 ? -0.6091 ? 1.2622 ? -0.0330 ? -0.0369 ? 0.4165 ? -0.8772 ? -0.1596 ? -0.1114 ? 11 'X-RAY DIFFRACTION' ? refined 16.5004 0.6127 -4.3878 1.0644 ? -0.0417 ? 0.0341 ? 0.6112 ? -0.1140 ? 0.4373 ? 5.9895 ? 4.4915 ? 4.8578 ? 6.1159 ? 5.5108 ? 5.1473 ? 0.2998 ? -0.0835 ? 0.8795 ? -0.3886 ? -0.5614 ? 0.2923 ? -0.5840 ? 0.9218 ? 0.1481 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 50 through 58 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 59 through 73 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 74 through 83 ) ; 4 'X-RAY DIFFRACTION' 4 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 84 through 96 ) ; 5 'X-RAY DIFFRACTION' 5 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 97 through 111 ) ; 6 'X-RAY DIFFRACTION' 6 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 112 through 120 ) ; 7 'X-RAY DIFFRACTION' 7 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 121 through 129 ) ; 8 'X-RAY DIFFRACTION' 8 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 130 through 142 ) ; 9 'X-RAY DIFFRACTION' 9 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 143 through 148 ) ; 10 'X-RAY DIFFRACTION' 10 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 149 through 162 ) ; 11 'X-RAY DIFFRACTION' 11 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 163 through 180 ) ; # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 9UM C1 C N N 1 9UM C2 C N N 2 9UM C3 C N N 3 9UM C4 C N N 4 9UM C5 C N N 5 9UM C6 C N N 6 9UM C7 C N N 7 9UM C8 C N N 8 9UM C9 C N N 9 9UM C10 C N N 10 9UM N1 N N N 11 9UM N2 N N N 12 9UM O1 O N N 13 9UM O2 O N N 14 9UM BR1 BR N N 15 9UM H1 H N N 16 9UM H2 H N N 17 9UM H3 H N N 18 9UM H4 H N N 19 9UM H5 H N N 20 9UM H6 H N N 21 9UM H7 H N N 22 9UM H8 H N N 23 9UM H9 H N N 24 9UM H10 H N N 25 9UM H11 H N N 26 ALA N N N N 27 ALA CA C N S 28 ALA C C N N 29 ALA O O N N 30 ALA CB C N N 31 ALA OXT O N N 32 ALA H H N N 33 ALA H2 H N N 34 ALA HA H N N 35 ALA HB1 H N N 36 ALA HB2 H N N 37 ALA HB3 H N N 38 ALA HXT H N N 39 ARG N N N N 40 ARG CA C N S 41 ARG C C N N 42 ARG O O N N 43 ARG CB C N N 44 ARG CG C N N 45 ARG CD C N N 46 ARG NE N N N 47 ARG CZ C N N 48 ARG NH1 N N N 49 ARG NH2 N N N 50 ARG OXT O N N 51 ARG H H N N 52 ARG H2 H N N 53 ARG HA H N N 54 ARG HB2 H N N 55 ARG HB3 H N N 56 ARG HG2 H N N 57 ARG HG3 H N N 58 ARG HD2 H N N 59 ARG HD3 H N N 60 ARG HE H N N 61 ARG HH11 H N N 62 ARG HH12 H N N 63 ARG HH21 H N N 64 ARG HH22 H N N 65 ARG HXT H N N 66 ASN N N N N 67 ASN CA C N S 68 ASN C C N N 69 ASN O O N N 70 ASN CB C N N 71 ASN CG C N N 72 ASN OD1 O N N 73 ASN ND2 N N N 74 ASN OXT O N N 75 ASN H H N N 76 ASN H2 H N N 77 ASN HA H N N 78 ASN HB2 H N N 79 ASN HB3 H N N 80 ASN HD21 H N N 81 ASN HD22 H N N 82 ASN HXT H N N 83 ASP N N N N 84 ASP CA C N S 85 ASP C C N N 86 ASP O O N N 87 ASP CB C N N 88 ASP CG C N N 89 ASP OD1 O N N 90 ASP OD2 O N N 91 ASP OXT O N N 92 ASP H H N N 93 ASP H2 H N N 94 ASP HA H N N 95 ASP HB2 H N N 96 ASP HB3 H N N 97 ASP HD2 H N N 98 ASP HXT H N N 99 CYS N N N N 100 CYS CA C N R 101 CYS C C N N 102 CYS O O N N 103 CYS CB C N N 104 CYS SG S N N 105 CYS OXT O N N 106 CYS H H N N 107 CYS H2 H N N 108 CYS HA H N N 109 CYS HB2 H N N 110 CYS HB3 H N N 111 CYS HG H N N 112 CYS HXT H N N 113 GLN N N N N 114 GLN CA C N S 115 GLN C C N N 116 GLN O O N N 117 GLN CB C N N 118 GLN CG C N N 119 GLN CD C N N 120 GLN OE1 O N N 121 GLN NE2 N N N 122 GLN OXT O N N 123 GLN H H N N 124 GLN H2 H N N 125 GLN HA H N N 126 GLN HB2 H N N 127 GLN HB3 H N N 128 GLN HG2 H N N 129 GLN HG3 H N N 130 GLN HE21 H N N 131 GLN HE22 H N N 132 GLN HXT H N N 133 GLU N N N N 134 GLU CA C N S 135 GLU C C N N 136 GLU O O N N 137 GLU CB C N N 138 GLU CG C N N 139 GLU CD C N N 140 GLU OE1 O N N 141 GLU OE2 O N N 142 GLU OXT O N N 143 GLU H H N N 144 GLU H2 H N N 145 GLU HA H N N 146 GLU HB2 H N N 147 GLU HB3 H N N 148 GLU HG2 H N N 149 GLU HG3 H N N 150 GLU HE2 H N N 151 GLU HXT H N N 152 GLY N N N N 153 GLY CA C N N 154 GLY C C N N 155 GLY O O N N 156 GLY OXT O N N 157 GLY H H N N 158 GLY H2 H N N 159 GLY HA2 H N N 160 GLY HA3 H N N 161 GLY HXT H N N 162 HIS N N N N 163 HIS CA C N S 164 HIS C C N N 165 HIS O O N N 166 HIS CB C N N 167 HIS CG C Y N 168 HIS ND1 N Y N 169 HIS CD2 C Y N 170 HIS CE1 C Y N 171 HIS NE2 N Y N 172 HIS OXT O N N 173 HIS H H N N 174 HIS H2 H N N 175 HIS HA H N N 176 HIS HB2 H N N 177 HIS HB3 H N N 178 HIS HD1 H N N 179 HIS HD2 H N N 180 HIS HE1 H N N 181 HIS HE2 H N N 182 HIS HXT H N N 183 HOH O O N N 184 HOH H1 H N N 185 HOH H2 H N N 186 ILE N N N N 187 ILE CA C N S 188 ILE C C N N 189 ILE O O N N 190 ILE CB C N S 191 ILE CG1 C N N 192 ILE CG2 C N N 193 ILE CD1 C N N 194 ILE OXT O N N 195 ILE H H N N 196 ILE H2 H N N 197 ILE HA H N N 198 ILE HB H N N 199 ILE HG12 H N N 200 ILE HG13 H N N 201 ILE HG21 H N N 202 ILE HG22 H N N 203 ILE HG23 H N N 204 ILE HD11 H N N 205 ILE HD12 H N N 206 ILE HD13 H N N 207 ILE HXT H N N 208 LEU N N N N 209 LEU CA C N S 210 LEU C C N N 211 LEU O O N N 212 LEU CB C N N 213 LEU CG C N N 214 LEU CD1 C N N 215 LEU CD2 C N N 216 LEU OXT O N N 217 LEU H H N N 218 LEU H2 H N N 219 LEU HA H N N 220 LEU HB2 H N N 221 LEU HB3 H N N 222 LEU HG H N N 223 LEU HD11 H N N 224 LEU HD12 H N N 225 LEU HD13 H N N 226 LEU HD21 H N N 227 LEU HD22 H N N 228 LEU HD23 H N N 229 LEU HXT H N N 230 LYS N N N N 231 LYS CA C N S 232 LYS C C N N 233 LYS O O N N 234 LYS CB C N N 235 LYS CG C N N 236 LYS CD C N N 237 LYS CE C N N 238 LYS NZ N N N 239 LYS OXT O N N 240 LYS H H N N 241 LYS H2 H N N 242 LYS HA H N N 243 LYS HB2 H N N 244 LYS HB3 H N N 245 LYS HG2 H N N 246 LYS HG3 H N N 247 LYS HD2 H N N 248 LYS HD3 H N N 249 LYS HE2 H N N 250 LYS HE3 H N N 251 LYS HZ1 H N N 252 LYS HZ2 H N N 253 LYS HZ3 H N N 254 LYS HXT H N N 255 MET N N N N 256 MET CA C N S 257 MET C C N N 258 MET O O N N 259 MET CB C N N 260 MET CG C N N 261 MET SD S N N 262 MET CE C N N 263 MET OXT O N N 264 MET H H N N 265 MET H2 H N N 266 MET HA H N N 267 MET HB2 H N N 268 MET HB3 H N N 269 MET HG2 H N N 270 MET HG3 H N N 271 MET HE1 H N N 272 MET HE2 H N N 273 MET HE3 H N N 274 MET HXT H N N 275 PHE N N N N 276 PHE CA C N S 277 PHE C C N N 278 PHE O O N N 279 PHE CB C N N 280 PHE CG C Y N 281 PHE CD1 C Y N 282 PHE CD2 C Y N 283 PHE CE1 C Y N 284 PHE CE2 C Y N 285 PHE CZ C Y N 286 PHE OXT O N N 287 PHE H H N N 288 PHE H2 H N N 289 PHE HA H N N 290 PHE HB2 H N N 291 PHE HB3 H N N 292 PHE HD1 H N N 293 PHE HD2 H N N 294 PHE HE1 H N N 295 PHE HE2 H N N 296 PHE HZ H N N 297 PHE HXT H N N 298 PRO N N N N 299 PRO CA C N S 300 PRO C C N N 301 PRO O O N N 302 PRO CB C N N 303 PRO CG C N N 304 PRO CD C N N 305 PRO OXT O N N 306 PRO H H N N 307 PRO HA H N N 308 PRO HB2 H N N 309 PRO HB3 H N N 310 PRO HG2 H N N 311 PRO HG3 H N N 312 PRO HD2 H N N 313 PRO HD3 H N N 314 PRO HXT H N N 315 SER N N N N 316 SER CA C N S 317 SER C C N N 318 SER O O N N 319 SER CB C N N 320 SER OG O N N 321 SER OXT O N N 322 SER H H N N 323 SER H2 H N N 324 SER HA H N N 325 SER HB2 H N N 326 SER HB3 H N N 327 SER HG H N N 328 SER HXT H N N 329 THR N N N N 330 THR CA C N S 331 THR C C N N 332 THR O O N N 333 THR CB C N R 334 THR OG1 O N N 335 THR CG2 C N N 336 THR OXT O N N 337 THR H H N N 338 THR H2 H N N 339 THR HA H N N 340 THR HB H N N 341 THR HG1 H N N 342 THR HG21 H N N 343 THR HG22 H N N 344 THR HG23 H N N 345 THR HXT H N N 346 TYR N N N N 347 TYR CA C N S 348 TYR C C N N 349 TYR O O N N 350 TYR CB C N N 351 TYR CG C Y N 352 TYR CD1 C Y N 353 TYR CD2 C Y N 354 TYR CE1 C Y N 355 TYR CE2 C Y N 356 TYR CZ C Y N 357 TYR OH O N N 358 TYR OXT O N N 359 TYR H H N N 360 TYR H2 H N N 361 TYR HA H N N 362 TYR HB2 H N N 363 TYR HB3 H N N 364 TYR HD1 H N N 365 TYR HD2 H N N 366 TYR HE1 H N N 367 TYR HE2 H N N 368 TYR HH H N N 369 TYR HXT H N N 370 VAL N N N N 371 VAL CA C N S 372 VAL C C N N 373 VAL O O N N 374 VAL CB C N N 375 VAL CG1 C N N 376 VAL CG2 C N N 377 VAL OXT O N N 378 VAL H H N N 379 VAL H2 H N N 380 VAL HA H N N 381 VAL HB H N N 382 VAL HG11 H N N 383 VAL HG12 H N N 384 VAL HG13 H N N 385 VAL HG21 H N N 386 VAL HG22 H N N 387 VAL HG23 H N N 388 VAL HXT H N N 389 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 9UM C8 C4 sing N N 1 9UM C7 C5 sing N N 2 9UM C4 C5 doub N N 3 9UM C4 N1 sing N N 4 9UM C5 C6 sing N N 5 9UM N1 C3 sing N N 6 9UM N1 N2 sing N N 7 9UM C6 O2 doub N N 8 9UM C6 N2 sing N N 9 9UM C9 C3 sing N N 10 9UM C3 C2 doub N N 11 9UM N2 C1 sing N N 12 9UM C2 C1 sing N N 13 9UM C2 C10 sing N N 14 9UM C1 O1 doub N N 15 9UM C8 BR1 sing N N 16 9UM C7 H1 sing N N 17 9UM C7 H2 sing N N 18 9UM C7 H3 sing N N 19 9UM C8 H4 sing N N 20 9UM C8 H5 sing N N 21 9UM C9 H6 sing N N 22 9UM C9 H7 sing N N 23 9UM C9 H8 sing N N 24 9UM C10 H9 sing N N 25 9UM C10 H10 sing N N 26 9UM C10 H11 sing N N 27 ALA N CA sing N N 28 ALA N H sing N N 29 ALA N H2 sing N N 30 ALA CA C sing N N 31 ALA CA CB sing N N 32 ALA CA HA sing N N 33 ALA C O doub N N 34 ALA C OXT sing N N 35 ALA CB HB1 sing N N 36 ALA CB HB2 sing N N 37 ALA CB HB3 sing N N 38 ALA OXT HXT sing N N 39 ARG N CA sing N N 40 ARG N H sing N N 41 ARG N H2 sing N N 42 ARG CA C sing N N 43 ARG CA CB sing N N 44 ARG CA HA sing N N 45 ARG C O doub N N 46 ARG C OXT sing N N 47 ARG CB CG sing N N 48 ARG CB HB2 sing N N 49 ARG CB HB3 sing N N 50 ARG CG CD sing N N 51 ARG CG HG2 sing N N 52 ARG CG HG3 sing N N 53 ARG CD NE sing N N 54 ARG CD HD2 sing N N 55 ARG CD HD3 sing N N 56 ARG NE CZ sing N N 57 ARG NE HE sing N N 58 ARG CZ NH1 sing N N 59 ARG CZ NH2 doub N N 60 ARG NH1 HH11 sing N N 61 ARG NH1 HH12 sing N N 62 ARG NH2 HH21 sing N N 63 ARG NH2 HH22 sing N N 64 ARG OXT HXT sing N N 65 ASN N CA sing N N 66 ASN N H sing N N 67 ASN N H2 sing N N 68 ASN CA C sing N N 69 ASN CA CB sing N N 70 ASN CA HA sing N N 71 ASN C O doub N N 72 ASN C OXT sing N N 73 ASN CB CG sing N N 74 ASN CB HB2 sing N N 75 ASN CB HB3 sing N N 76 ASN CG OD1 doub N N 77 ASN CG ND2 sing N N 78 ASN ND2 HD21 sing N N 79 ASN ND2 HD22 sing N N 80 ASN OXT HXT sing N N 81 ASP N CA sing N N 82 ASP N H sing N N 83 ASP N H2 sing N N 84 ASP CA C sing N N 85 ASP CA CB sing N N 86 ASP CA HA sing N N 87 ASP C O doub N N 88 ASP C OXT sing N N 89 ASP CB CG sing N N 90 ASP CB HB2 sing N N 91 ASP CB HB3 sing N N 92 ASP CG OD1 doub N N 93 ASP CG OD2 sing N N 94 ASP OD2 HD2 sing N N 95 ASP OXT HXT sing N N 96 CYS N CA sing N N 97 CYS N H sing N N 98 CYS N H2 sing N N 99 CYS CA C sing N N 100 CYS CA CB sing N N 101 CYS CA HA sing N N 102 CYS C O doub N N 103 CYS C OXT sing N N 104 CYS CB SG sing N N 105 CYS CB HB2 sing N N 106 CYS CB HB3 sing N N 107 CYS SG HG sing N N 108 CYS OXT HXT sing N N 109 GLN N CA sing N N 110 GLN N H sing N N 111 GLN N H2 sing N N 112 GLN CA C sing N N 113 GLN CA CB sing N N 114 GLN CA HA sing N N 115 GLN C O doub N N 116 GLN C OXT sing N N 117 GLN CB CG sing N N 118 GLN CB HB2 sing N N 119 GLN CB HB3 sing N N 120 GLN CG CD sing N N 121 GLN CG HG2 sing N N 122 GLN CG HG3 sing N N 123 GLN CD OE1 doub N N 124 GLN CD NE2 sing N N 125 GLN NE2 HE21 sing N N 126 GLN NE2 HE22 sing N N 127 GLN OXT HXT sing N N 128 GLU N CA sing N N 129 GLU N H sing N N 130 GLU N H2 sing N N 131 GLU CA C sing N N 132 GLU CA CB sing N N 133 GLU CA HA sing N N 134 GLU C O doub N N 135 GLU C OXT sing N N 136 GLU CB CG sing N N 137 GLU CB HB2 sing N N 138 GLU CB HB3 sing N N 139 GLU CG CD sing N N 140 GLU CG HG2 sing N N 141 GLU CG HG3 sing N N 142 GLU CD OE1 doub N N 143 GLU CD OE2 sing N N 144 GLU OE2 HE2 sing N N 145 GLU OXT HXT sing N N 146 GLY N CA sing N N 147 GLY N H sing N N 148 GLY N H2 sing N N 149 GLY CA C sing N N 150 GLY CA HA2 sing N N 151 GLY CA HA3 sing N N 152 GLY C O doub N N 153 GLY C OXT sing N N 154 GLY OXT HXT sing N N 155 HIS N CA sing N N 156 HIS N H sing N N 157 HIS N H2 sing N N 158 HIS CA C sing N N 159 HIS CA CB sing N N 160 HIS CA HA sing N N 161 HIS C O doub N N 162 HIS C OXT sing N N 163 HIS CB CG sing N N 164 HIS CB HB2 sing N N 165 HIS CB HB3 sing N N 166 HIS CG ND1 sing Y N 167 HIS CG CD2 doub Y N 168 HIS ND1 CE1 doub Y N 169 HIS ND1 HD1 sing N N 170 HIS CD2 NE2 sing Y N 171 HIS CD2 HD2 sing N N 172 HIS CE1 NE2 sing Y N 173 HIS CE1 HE1 sing N N 174 HIS NE2 HE2 sing N N 175 HIS OXT HXT sing N N 176 HOH O H1 sing N N 177 HOH O H2 sing N N 178 ILE N CA sing N N 179 ILE N H sing N N 180 ILE N H2 sing N N 181 ILE CA C sing N N 182 ILE CA CB sing N N 183 ILE CA HA sing N N 184 ILE C O doub N N 185 ILE C OXT sing N N 186 ILE CB CG1 sing N N 187 ILE CB CG2 sing N N 188 ILE CB HB sing N N 189 ILE CG1 CD1 sing N N 190 ILE CG1 HG12 sing N N 191 ILE CG1 HG13 sing N N 192 ILE CG2 HG21 sing N N 193 ILE CG2 HG22 sing N N 194 ILE CG2 HG23 sing N N 195 ILE CD1 HD11 sing N N 196 ILE CD1 HD12 sing N N 197 ILE CD1 HD13 sing N N 198 ILE OXT HXT sing N N 199 LEU N CA sing N N 200 LEU N H sing N N 201 LEU N H2 sing N N 202 LEU CA C sing N N 203 LEU CA CB sing N N 204 LEU CA HA sing N N 205 LEU C O doub N N 206 LEU C OXT sing N N 207 LEU CB CG sing N N 208 LEU CB HB2 sing N N 209 LEU CB HB3 sing N N 210 LEU CG CD1 sing N N 211 LEU CG CD2 sing N N 212 LEU CG HG sing N N 213 LEU CD1 HD11 sing N N 214 LEU CD1 HD12 sing N N 215 LEU CD1 HD13 sing N N 216 LEU CD2 HD21 sing N N 217 LEU CD2 HD22 sing N N 218 LEU CD2 HD23 sing N N 219 LEU OXT HXT sing N N 220 LYS N CA sing N N 221 LYS N H sing N N 222 LYS N H2 sing N N 223 LYS CA C sing N N 224 LYS CA CB sing N N 225 LYS CA HA sing N N 226 LYS C O doub N N 227 LYS C OXT sing N N 228 LYS CB CG sing N N 229 LYS CB HB2 sing N N 230 LYS CB HB3 sing N N 231 LYS CG CD sing N N 232 LYS CG HG2 sing N N 233 LYS CG HG3 sing N N 234 LYS CD CE sing N N 235 LYS CD HD2 sing N N 236 LYS CD HD3 sing N N 237 LYS CE NZ sing N N 238 LYS CE HE2 sing N N 239 LYS CE HE3 sing N N 240 LYS NZ HZ1 sing N N 241 LYS NZ HZ2 sing N N 242 LYS NZ HZ3 sing N N 243 LYS OXT HXT sing N N 244 MET N CA sing N N 245 MET N H sing N N 246 MET N H2 sing N N 247 MET CA C sing N N 248 MET CA CB sing N N 249 MET CA HA sing N N 250 MET C O doub N N 251 MET C OXT sing N N 252 MET CB CG sing N N 253 MET CB HB2 sing N N 254 MET CB HB3 sing N N 255 MET CG SD sing N N 256 MET CG HG2 sing N N 257 MET CG HG3 sing N N 258 MET SD CE sing N N 259 MET CE HE1 sing N N 260 MET CE HE2 sing N N 261 MET CE HE3 sing N N 262 MET OXT HXT sing N N 263 PHE N CA sing N N 264 PHE N H sing N N 265 PHE N H2 sing N N 266 PHE CA C sing N N 267 PHE CA CB sing N N 268 PHE CA HA sing N N 269 PHE C O doub N N 270 PHE C OXT sing N N 271 PHE CB CG sing N N 272 PHE CB HB2 sing N N 273 PHE CB HB3 sing N N 274 PHE CG CD1 doub Y N 275 PHE CG CD2 sing Y N 276 PHE CD1 CE1 sing Y N 277 PHE CD1 HD1 sing N N 278 PHE CD2 CE2 doub Y N 279 PHE CD2 HD2 sing N N 280 PHE CE1 CZ doub Y N 281 PHE CE1 HE1 sing N N 282 PHE CE2 CZ sing Y N 283 PHE CE2 HE2 sing N N 284 PHE CZ HZ sing N N 285 PHE OXT HXT sing N N 286 PRO N CA sing N N 287 PRO N CD sing N N 288 PRO N H sing N N 289 PRO CA C sing N N 290 PRO CA CB sing N N 291 PRO CA HA sing N N 292 PRO C O doub N N 293 PRO C OXT sing N N 294 PRO CB CG sing N N 295 PRO CB HB2 sing N N 296 PRO CB HB3 sing N N 297 PRO CG CD sing N N 298 PRO CG HG2 sing N N 299 PRO CG HG3 sing N N 300 PRO CD HD2 sing N N 301 PRO CD HD3 sing N N 302 PRO OXT HXT sing N N 303 SER N CA sing N N 304 SER N H sing N N 305 SER N H2 sing N N 306 SER CA C sing N N 307 SER CA CB sing N N 308 SER CA HA sing N N 309 SER C O doub N N 310 SER C OXT sing N N 311 SER CB OG sing N N 312 SER CB HB2 sing N N 313 SER CB HB3 sing N N 314 SER OG HG sing N N 315 SER OXT HXT sing N N 316 THR N CA sing N N 317 THR N H sing N N 318 THR N H2 sing N N 319 THR CA C sing N N 320 THR CA CB sing N N 321 THR CA HA sing N N 322 THR C O doub N N 323 THR C OXT sing N N 324 THR CB OG1 sing N N 325 THR CB CG2 sing N N 326 THR CB HB sing N N 327 THR OG1 HG1 sing N N 328 THR CG2 HG21 sing N N 329 THR CG2 HG22 sing N N 330 THR CG2 HG23 sing N N 331 THR OXT HXT sing N N 332 TYR N CA sing N N 333 TYR N H sing N N 334 TYR N H2 sing N N 335 TYR CA C sing N N 336 TYR CA CB sing N N 337 TYR CA HA sing N N 338 TYR C O doub N N 339 TYR C OXT sing N N 340 TYR CB CG sing N N 341 TYR CB HB2 sing N N 342 TYR CB HB3 sing N N 343 TYR CG CD1 doub Y N 344 TYR CG CD2 sing Y N 345 TYR CD1 CE1 sing Y N 346 TYR CD1 HD1 sing N N 347 TYR CD2 CE2 doub Y N 348 TYR CD2 HD2 sing N N 349 TYR CE1 CZ doub Y N 350 TYR CE1 HE1 sing N N 351 TYR CE2 CZ sing Y N 352 TYR CE2 HE2 sing N N 353 TYR CZ OH sing N N 354 TYR OH HH sing N N 355 TYR OXT HXT sing N N 356 VAL N CA sing N N 357 VAL N H sing N N 358 VAL N H2 sing N N 359 VAL CA C sing N N 360 VAL CA CB sing N N 361 VAL CA HA sing N N 362 VAL C O doub N N 363 VAL C OXT sing N N 364 VAL CB CG1 sing N N 365 VAL CB CG2 sing N N 366 VAL CB HB sing N N 367 VAL CG1 HG11 sing N N 368 VAL CG1 HG12 sing N N 369 VAL CG1 HG13 sing N N 370 VAL CG2 HG21 sing N N 371 VAL CG2 HG22 sing N N 372 VAL CG2 HG23 sing N N 373 VAL OXT HXT sing N N 374 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' P30GM133893 1 'Department of Energy (DOE, United States)' 'United States' KP1605010 2 'Other private' ? ? 3 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4cxi _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'P 65 2 2' _space_group.name_Hall 'P 65 2 (x,y,z+1/12)' _space_group.IT_number 179 _space_group.crystal_system hexagonal _space_group.id 1 # _atom_sites.entry_id 9PHR _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.023269 _atom_sites.fract_transf_matrix[1][2] 0.013434 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.026868 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.003751 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? 0.51345 0.48472 ? ? 24.73122 6.32584 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ # loop_ #