data_9PJ4 # _entry.id 9PJ4 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.416 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9PJ4 pdb_00009pj4 10.2210/pdb9pj4/pdb WWPDB D_1000297939 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-07-22 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9PJ4 _pdbx_database_status.recvd_initial_deposition_date 2025-07-11 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email tmmakris@ncsu.edu _pdbx_contact_author.name_first Thomas _pdbx_contact_author.name_last Makris _pdbx_contact_author.name_mi M. _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-7927-620X # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Phan, H.N.' 1 0000-0002-2949-8944 'Makris, T.M.' 2 0000-0001-7927-620X # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Crystal structure of u-1,2 Peroxo Intermediate from pABA synthase Nitrosomonas urea CADD (NuCADD)' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Phan, H.N.' 1 0000-0002-2949-8944 primary 'Makris, T.M.' 2 0000-0001-7927-620X # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man '4-aminobenzoate synthase' 30176.973 1 ? ? ? ? 2 non-polymer syn 'PEROXIDE ION' 31.999 1 ? ? ? ? 3 non-polymer syn GLYCEROL 92.094 1 ? ? ? ? 4 non-polymer syn 'FE (III) ION' 55.845 2 ? ? ? ? 5 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 6 water nat water 18.015 53 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSSHHHHHHSSGLVPRGSHMTTNTILKQKITAIISEKHLLKHPFYIAWTEGKLTKEQLRHYAEQYFYNVLAEPTYLSAV HFNTPHIHSESNSGDISVRQEVLKNLIDEEHGEKNHPALWKNFAFALGANDKILASASALPTTEKLVSTFRDICLNRPFY AGLAALHAFESQVPDIAAVKIDGLAKFYGMKNPEDYEFFSVHQKADIYHSQAEWAIIERFADNPEKQAEVLAATQEACDA LWGFLDGIHETYCANLMCEQKEAATLH ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSSGLVPRGSHMTTNTILKQKITAIISEKHLLKHPFYIAWTEGKLTKEQLRHYAEQYFYNVLAEPTYLSAV HFNTPHIHSESNSGDISVRQEVLKNLIDEEHGEKNHPALWKNFAFALGANDKILASASALPTTEKLVSTFRDICLNRPFY AGLAALHAFESQVPDIAAVKIDGLAKFYGMKNPEDYEFFSVHQKADIYHSQAEWAIIERFADNPEKQAEVLAATQEACDA LWGFLDGIHETYCANLMCEQKEAATLH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'PEROXIDE ION' PER 3 GLYCEROL GOL 4 'FE (III) ION' FE 5 'SULFATE ION' SO4 6 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 LEU n 1 15 VAL n 1 16 PRO n 1 17 ARG n 1 18 GLY n 1 19 SER n 1 20 HIS n 1 21 MET n 1 22 THR n 1 23 THR n 1 24 ASN n 1 25 THR n 1 26 ILE n 1 27 LEU n 1 28 LYS n 1 29 GLN n 1 30 LYS n 1 31 ILE n 1 32 THR n 1 33 ALA n 1 34 ILE n 1 35 ILE n 1 36 SER n 1 37 GLU n 1 38 LYS n 1 39 HIS n 1 40 LEU n 1 41 LEU n 1 42 LYS n 1 43 HIS n 1 44 PRO n 1 45 PHE n 1 46 TYR n 1 47 ILE n 1 48 ALA n 1 49 TRP n 1 50 THR n 1 51 GLU n 1 52 GLY n 1 53 LYS n 1 54 LEU n 1 55 THR n 1 56 LYS n 1 57 GLU n 1 58 GLN n 1 59 LEU n 1 60 ARG n 1 61 HIS n 1 62 TYR n 1 63 ALA n 1 64 GLU n 1 65 GLN n 1 66 TYR n 1 67 PHE n 1 68 TYR n 1 69 ASN n 1 70 VAL n 1 71 LEU n 1 72 ALA n 1 73 GLU n 1 74 PRO n 1 75 THR n 1 76 TYR n 1 77 LEU n 1 78 SER n 1 79 ALA n 1 80 VAL n 1 81 HIS n 1 82 PHE n 1 83 ASN n 1 84 THR n 1 85 PRO n 1 86 HIS n 1 87 ILE n 1 88 HIS n 1 89 SER n 1 90 GLU n 1 91 SER n 1 92 ASN n 1 93 SER n 1 94 GLY n 1 95 ASP n 1 96 ILE n 1 97 SER n 1 98 VAL n 1 99 ARG n 1 100 GLN n 1 101 GLU n 1 102 VAL n 1 103 LEU n 1 104 LYS n 1 105 ASN n 1 106 LEU n 1 107 ILE n 1 108 ASP n 1 109 GLU n 1 110 GLU n 1 111 HIS n 1 112 GLY n 1 113 GLU n 1 114 LYS n 1 115 ASN n 1 116 HIS n 1 117 PRO n 1 118 ALA n 1 119 LEU n 1 120 TRP n 1 121 LYS n 1 122 ASN n 1 123 PHE n 1 124 ALA n 1 125 PHE n 1 126 ALA n 1 127 LEU n 1 128 GLY n 1 129 ALA n 1 130 ASN n 1 131 ASP n 1 132 LYS n 1 133 ILE n 1 134 LEU n 1 135 ALA n 1 136 SER n 1 137 ALA n 1 138 SER n 1 139 ALA n 1 140 LEU n 1 141 PRO n 1 142 THR n 1 143 THR n 1 144 GLU n 1 145 LYS n 1 146 LEU n 1 147 VAL n 1 148 SER n 1 149 THR n 1 150 PHE n 1 151 ARG n 1 152 ASP n 1 153 ILE n 1 154 CYS n 1 155 LEU n 1 156 ASN n 1 157 ARG n 1 158 PRO n 1 159 PHE n 1 160 TYR n 1 161 ALA n 1 162 GLY n 1 163 LEU n 1 164 ALA n 1 165 ALA n 1 166 LEU n 1 167 HIS n 1 168 ALA n 1 169 PHE n 1 170 GLU n 1 171 SER n 1 172 GLN n 1 173 VAL n 1 174 PRO n 1 175 ASP n 1 176 ILE n 1 177 ALA n 1 178 ALA n 1 179 VAL n 1 180 LYS n 1 181 ILE n 1 182 ASP n 1 183 GLY n 1 184 LEU n 1 185 ALA n 1 186 LYS n 1 187 PHE n 1 188 TYR n 1 189 GLY n 1 190 MET n 1 191 LYS n 1 192 ASN n 1 193 PRO n 1 194 GLU n 1 195 ASP n 1 196 TYR n 1 197 GLU n 1 198 PHE n 1 199 PHE n 1 200 SER n 1 201 VAL n 1 202 HIS n 1 203 GLN n 1 204 LYS n 1 205 ALA n 1 206 ASP n 1 207 ILE n 1 208 TYR n 1 209 HIS n 1 210 SER n 1 211 GLN n 1 212 ALA n 1 213 GLU n 1 214 TRP n 1 215 ALA n 1 216 ILE n 1 217 ILE n 1 218 GLU n 1 219 ARG n 1 220 PHE n 1 221 ALA n 1 222 ASP n 1 223 ASN n 1 224 PRO n 1 225 GLU n 1 226 LYS n 1 227 GLN n 1 228 ALA n 1 229 GLU n 1 230 VAL n 1 231 LEU n 1 232 ALA n 1 233 ALA n 1 234 THR n 1 235 GLN n 1 236 GLU n 1 237 ALA n 1 238 CYS n 1 239 ASP n 1 240 ALA n 1 241 LEU n 1 242 TRP n 1 243 GLY n 1 244 PHE n 1 245 LEU n 1 246 ASP n 1 247 GLY n 1 248 ILE n 1 249 HIS n 1 250 GLU n 1 251 THR n 1 252 TYR n 1 253 CYS n 1 254 ALA n 1 255 ASN n 1 256 LEU n 1 257 MET n 1 258 CYS n 1 259 GLU n 1 260 GLN n 1 261 LYS n 1 262 GLU n 1 263 ALA n 1 264 ALA n 1 265 THR n 1 266 LEU n 1 267 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 267 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'SAMN05216406_1428, SAMN06297164_2219' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Nitrosomonas ureae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 44577 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FE non-polymer . 'FE (III) ION' ? 'Fe 3' 55.845 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PER non-polymer . 'PEROXIDE ION' ? 'O2 -2' 31.999 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -19 ? ? ? A . n A 1 2 GLY 2 -18 ? ? ? A . n A 1 3 SER 3 -17 ? ? ? A . n A 1 4 SER 4 -16 ? ? ? A . n A 1 5 HIS 5 -15 ? ? ? A . n A 1 6 HIS 6 -14 ? ? ? A . n A 1 7 HIS 7 -13 ? ? ? A . n A 1 8 HIS 8 -12 ? ? ? A . n A 1 9 HIS 9 -11 ? ? ? A . n A 1 10 HIS 10 -10 ? ? ? A . n A 1 11 SER 11 -9 ? ? ? A . n A 1 12 SER 12 -8 ? ? ? A . n A 1 13 GLY 13 -7 ? ? ? A . n A 1 14 LEU 14 -6 ? ? ? A . n A 1 15 VAL 15 -5 ? ? ? A . n A 1 16 PRO 16 -4 ? ? ? A . n A 1 17 ARG 17 -3 ? ? ? A . n A 1 18 GLY 18 -2 ? ? ? A . n A 1 19 SER 19 -1 ? ? ? A . n A 1 20 HIS 20 0 ? ? ? A . n A 1 21 MET 21 1 ? ? ? A . n A 1 22 THR 22 2 ? ? ? A . n A 1 23 THR 23 3 ? ? ? A . n A 1 24 ASN 24 4 4 ASN ASN A . n A 1 25 THR 25 5 5 THR THR A . n A 1 26 ILE 26 6 6 ILE ILE A . n A 1 27 LEU 27 7 7 LEU LEU A . n A 1 28 LYS 28 8 8 LYS LYS A . n A 1 29 GLN 29 9 9 GLN GLN A . n A 1 30 LYS 30 10 10 LYS LYS A . n A 1 31 ILE 31 11 11 ILE ILE A . n A 1 32 THR 32 12 12 THR THR A . n A 1 33 ALA 33 13 13 ALA ALA A . n A 1 34 ILE 34 14 14 ILE ILE A . n A 1 35 ILE 35 15 15 ILE ILE A . n A 1 36 SER 36 16 16 SER SER A . n A 1 37 GLU 37 17 17 GLU GLU A . n A 1 38 LYS 38 18 18 LYS LYS A . n A 1 39 HIS 39 19 19 HIS HIS A . n A 1 40 LEU 40 20 20 LEU LEU A . n A 1 41 LEU 41 21 21 LEU LEU A . n A 1 42 LYS 42 22 22 LYS LYS A . n A 1 43 HIS 43 23 23 HIS HIS A . n A 1 44 PRO 44 24 24 PRO PRO A . n A 1 45 PHE 45 25 25 PHE PHE A . n A 1 46 TYR 46 26 26 TYR TYR A . n A 1 47 ILE 47 27 27 ILE ILE A . n A 1 48 ALA 48 28 28 ALA ALA A . n A 1 49 TRP 49 29 29 TRP TRP A . n A 1 50 THR 50 30 30 THR THR A . n A 1 51 GLU 51 31 31 GLU GLU A . n A 1 52 GLY 52 32 32 GLY GLY A . n A 1 53 LYS 53 33 33 LYS LYS A . n A 1 54 LEU 54 34 34 LEU LEU A . n A 1 55 THR 55 35 35 THR THR A . n A 1 56 LYS 56 36 36 LYS LYS A . n A 1 57 GLU 57 37 37 GLU GLU A . n A 1 58 GLN 58 38 38 GLN GLN A . n A 1 59 LEU 59 39 39 LEU LEU A . n A 1 60 ARG 60 40 40 ARG ARG A . n A 1 61 HIS 61 41 41 HIS HIS A . n A 1 62 TYR 62 42 42 TYR TYR A . n A 1 63 ALA 63 43 43 ALA ALA A . n A 1 64 GLU 64 44 44 GLU GLU A . n A 1 65 GLN 65 45 45 GLN GLN A . n A 1 66 TYR 66 46 46 TYR TYR A . n A 1 67 PHE 67 47 47 PHE PHE A . n A 1 68 TYR 68 48 48 TYR TYR A . n A 1 69 ASN 69 49 49 ASN ASN A . n A 1 70 VAL 70 50 50 VAL VAL A . n A 1 71 LEU 71 51 51 LEU LEU A . n A 1 72 ALA 72 52 52 ALA ALA A . n A 1 73 GLU 73 53 53 GLU GLU A . n A 1 74 PRO 74 54 54 PRO PRO A . n A 1 75 THR 75 55 55 THR THR A . n A 1 76 TYR 76 56 56 TYR TYR A . n A 1 77 LEU 77 57 57 LEU LEU A . n A 1 78 SER 78 58 58 SER SER A . n A 1 79 ALA 79 59 59 ALA ALA A . n A 1 80 VAL 80 60 60 VAL VAL A . n A 1 81 HIS 81 61 61 HIS HIS A . n A 1 82 PHE 82 62 62 PHE PHE A . n A 1 83 ASN 83 63 63 ASN ASN A . n A 1 84 THR 84 64 64 THR THR A . n A 1 85 PRO 85 65 65 PRO PRO A . n A 1 86 HIS 86 66 66 HIS HIS A . n A 1 87 ILE 87 67 67 ILE ILE A . n A 1 88 HIS 88 68 68 HIS HIS A . n A 1 89 SER 89 69 69 SER SER A . n A 1 90 GLU 90 70 70 GLU GLU A . n A 1 91 SER 91 71 71 SER SER A . n A 1 92 ASN 92 72 72 ASN ASN A . n A 1 93 SER 93 73 73 SER SER A . n A 1 94 GLY 94 74 74 GLY GLY A . n A 1 95 ASP 95 75 75 ASP ASP A . n A 1 96 ILE 96 76 76 ILE ILE A . n A 1 97 SER 97 77 77 SER SER A . n A 1 98 VAL 98 78 78 VAL VAL A . n A 1 99 ARG 99 79 79 ARG ARG A . n A 1 100 GLN 100 80 80 GLN GLN A . n A 1 101 GLU 101 81 81 GLU GLU A . n A 1 102 VAL 102 82 82 VAL VAL A . n A 1 103 LEU 103 83 83 LEU LEU A . n A 1 104 LYS 104 84 84 LYS LYS A . n A 1 105 ASN 105 85 85 ASN ASN A . n A 1 106 LEU 106 86 86 LEU LEU A . n A 1 107 ILE 107 87 87 ILE ILE A . n A 1 108 ASP 108 88 88 ASP ASP A . n A 1 109 GLU 109 89 89 GLU GLU A . n A 1 110 GLU 110 90 90 GLU GLU A . n A 1 111 HIS 111 91 91 HIS HIS A . n A 1 112 GLY 112 92 92 GLY GLY A . n A 1 113 GLU 113 93 93 GLU GLU A . n A 1 114 LYS 114 94 94 LYS LYS A . n A 1 115 ASN 115 95 95 ASN ASN A . n A 1 116 HIS 116 96 96 HIS HIS A . n A 1 117 PRO 117 97 97 PRO PRO A . n A 1 118 ALA 118 98 98 ALA ALA A . n A 1 119 LEU 119 99 99 LEU LEU A . n A 1 120 TRP 120 100 100 TRP TRP A . n A 1 121 LYS 121 101 101 LYS LYS A . n A 1 122 ASN 122 102 102 ASN ASN A . n A 1 123 PHE 123 103 103 PHE PHE A . n A 1 124 ALA 124 104 104 ALA ALA A . n A 1 125 PHE 125 105 105 PHE PHE A . n A 1 126 ALA 126 106 106 ALA ALA A . n A 1 127 LEU 127 107 107 LEU LEU A . n A 1 128 GLY 128 108 108 GLY GLY A . n A 1 129 ALA 129 109 109 ALA ALA A . n A 1 130 ASN 130 110 110 ASN ASN A . n A 1 131 ASP 131 111 111 ASP ASP A . n A 1 132 LYS 132 112 112 LYS LYS A . n A 1 133 ILE 133 113 113 ILE ILE A . n A 1 134 LEU 134 114 114 LEU LEU A . n A 1 135 ALA 135 115 115 ALA ALA A . n A 1 136 SER 136 116 116 SER SER A . n A 1 137 ALA 137 117 117 ALA ALA A . n A 1 138 SER 138 118 118 SER SER A . n A 1 139 ALA 139 119 119 ALA ALA A . n A 1 140 LEU 140 120 120 LEU LEU A . n A 1 141 PRO 141 121 121 PRO PRO A . n A 1 142 THR 142 122 122 THR THR A . n A 1 143 THR 143 123 123 THR THR A . n A 1 144 GLU 144 124 124 GLU GLU A . n A 1 145 LYS 145 125 125 LYS LYS A . n A 1 146 LEU 146 126 126 LEU LEU A . n A 1 147 VAL 147 127 127 VAL VAL A . n A 1 148 SER 148 128 128 SER SER A . n A 1 149 THR 149 129 129 THR THR A . n A 1 150 PHE 150 130 130 PHE PHE A . n A 1 151 ARG 151 131 131 ARG ARG A . n A 1 152 ASP 152 132 132 ASP ASP A . n A 1 153 ILE 153 133 133 ILE ILE A . n A 1 154 CYS 154 134 134 CYS CYS A . n A 1 155 LEU 155 135 135 LEU LEU A . n A 1 156 ASN 156 136 136 ASN ASN A . n A 1 157 ARG 157 137 137 ARG ARG A . n A 1 158 PRO 158 138 138 PRO PRO A . n A 1 159 PHE 159 139 139 PHE PHE A . n A 1 160 TYR 160 140 140 TYR TYR A . n A 1 161 ALA 161 141 141 ALA ALA A . n A 1 162 GLY 162 142 142 GLY GLY A . n A 1 163 LEU 163 143 143 LEU LEU A . n A 1 164 ALA 164 144 144 ALA ALA A . n A 1 165 ALA 165 145 145 ALA ALA A . n A 1 166 LEU 166 146 146 LEU LEU A . n A 1 167 HIS 167 147 147 HIS HIS A . n A 1 168 ALA 168 148 148 ALA ALA A . n A 1 169 PHE 169 149 149 PHE PHE A . n A 1 170 GLU 170 150 150 GLU GLU A . n A 1 171 SER 171 151 151 SER SER A . n A 1 172 GLN 172 152 152 GLN GLN A . n A 1 173 VAL 173 153 153 VAL VAL A . n A 1 174 PRO 174 154 154 PRO PRO A . n A 1 175 ASP 175 155 155 ASP ASP A . n A 1 176 ILE 176 156 156 ILE ILE A . n A 1 177 ALA 177 157 157 ALA ALA A . n A 1 178 ALA 178 158 158 ALA ALA A . n A 1 179 VAL 179 159 159 VAL VAL A . n A 1 180 LYS 180 160 160 LYS LYS A . n A 1 181 ILE 181 161 161 ILE ILE A . n A 1 182 ASP 182 162 162 ASP ASP A . n A 1 183 GLY 183 163 163 GLY GLY A . n A 1 184 LEU 184 164 164 LEU LEU A . n A 1 185 ALA 185 165 165 ALA ALA A . n A 1 186 LYS 186 166 166 LYS LYS A . n A 1 187 PHE 187 167 167 PHE PHE A . n A 1 188 TYR 188 168 168 TYR TYR A . n A 1 189 GLY 189 169 169 GLY GLY A . n A 1 190 MET 190 170 170 MET MET A . n A 1 191 LYS 191 171 171 LYS LYS A . n A 1 192 ASN 192 172 172 ASN ASN A . n A 1 193 PRO 193 173 173 PRO PRO A . n A 1 194 GLU 194 174 174 GLU GLU A . n A 1 195 ASP 195 175 175 ASP ASP A . n A 1 196 TYR 196 176 176 TYR TYR A . n A 1 197 GLU 197 177 177 GLU GLU A . n A 1 198 PHE 198 178 178 PHE PHE A . n A 1 199 PHE 199 179 179 PHE PHE A . n A 1 200 SER 200 180 180 SER SER A . n A 1 201 VAL 201 181 181 VAL VAL A . n A 1 202 HIS 202 182 182 HIS HIS A . n A 1 203 GLN 203 183 183 GLN GLN A . n A 1 204 LYS 204 184 184 LYS LYS A . n A 1 205 ALA 205 185 185 ALA ALA A . n A 1 206 ASP 206 186 186 ASP ASP A . n A 1 207 ILE 207 187 187 ILE ILE A . n A 1 208 TYR 208 188 188 TYR TYR A . n A 1 209 HIS 209 189 189 HIS HIS A . n A 1 210 SER 210 190 190 SER SER A . n A 1 211 GLN 211 191 191 GLN GLN A . n A 1 212 ALA 212 192 192 ALA ALA A . n A 1 213 GLU 213 193 193 GLU GLU A . n A 1 214 TRP 214 194 194 TRP TRP A . n A 1 215 ALA 215 195 195 ALA ALA A . n A 1 216 ILE 216 196 196 ILE ILE A . n A 1 217 ILE 217 197 197 ILE ILE A . n A 1 218 GLU 218 198 198 GLU GLU A . n A 1 219 ARG 219 199 199 ARG ARG A . n A 1 220 PHE 220 200 200 PHE PHE A . n A 1 221 ALA 221 201 201 ALA ALA A . n A 1 222 ASP 222 202 202 ASP ASP A . n A 1 223 ASN 223 203 203 ASN ASN A . n A 1 224 PRO 224 204 204 PRO PRO A . n A 1 225 GLU 225 205 205 GLU GLU A . n A 1 226 LYS 226 206 206 LYS LYS A . n A 1 227 GLN 227 207 207 GLN GLN A . n A 1 228 ALA 228 208 208 ALA ALA A . n A 1 229 GLU 229 209 209 GLU GLU A . n A 1 230 VAL 230 210 210 VAL VAL A . n A 1 231 LEU 231 211 211 LEU LEU A . n A 1 232 ALA 232 212 212 ALA ALA A . n A 1 233 ALA 233 213 213 ALA ALA A . n A 1 234 THR 234 214 214 THR THR A . n A 1 235 GLN 235 215 215 GLN GLN A . n A 1 236 GLU 236 216 216 GLU GLU A . n A 1 237 ALA 237 217 217 ALA ALA A . n A 1 238 CYS 238 218 218 CYS CYS A . n A 1 239 ASP 239 219 219 ASP ASP A . n A 1 240 ALA 240 220 220 ALA ALA A . n A 1 241 LEU 241 221 221 LEU LEU A . n A 1 242 TRP 242 222 222 TRP TRP A . n A 1 243 GLY 243 223 223 GLY GLY A . n A 1 244 PHE 244 224 224 PHE PHE A . n A 1 245 LEU 245 225 225 LEU LEU A . n A 1 246 ASP 246 226 226 ASP ASP A . n A 1 247 GLY 247 227 227 GLY GLY A . n A 1 248 ILE 248 228 228 ILE ILE A . n A 1 249 HIS 249 229 229 HIS HIS A . n A 1 250 GLU 250 230 230 GLU GLU A . n A 1 251 THR 251 231 231 THR THR A . n A 1 252 TYR 252 232 232 TYR TYR A . n A 1 253 CYS 253 233 233 CYS CYS A . n A 1 254 ALA 254 234 234 ALA ALA A . n A 1 255 ASN 255 235 235 ASN ASN A . n A 1 256 LEU 256 236 236 LEU LEU A . n A 1 257 MET 257 237 237 MET MET A . n A 1 258 CYS 258 238 238 CYS CYS A . n A 1 259 GLU 259 239 239 GLU GLU A . n A 1 260 GLN 260 240 ? ? ? A . n A 1 261 LYS 261 241 ? ? ? A . n A 1 262 GLU 262 242 ? ? ? A . n A 1 263 ALA 263 243 ? ? ? A . n A 1 264 ALA 264 244 ? ? ? A . n A 1 265 THR 265 245 ? ? ? A . n A 1 266 LEU 266 246 ? ? ? A . n A 1 267 HIS 267 247 ? ? ? A . n # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 FE ? ? FE ? ? 'SUBJECT OF INVESTIGATION' ? 2 PER ? ? PER ? ? 'SUBJECT OF INVESTIGATION' ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 PER 1 301 301 PER PER A . C 3 GOL 1 302 302 GOL GOL A . D 4 FE 1 303 1 FE FE A . E 4 FE 1 304 2 FE FE A . F 5 SO4 1 305 1 SO4 SO4 A . G 6 HOH 1 401 1 HOH HOH A . G 6 HOH 2 402 13 HOH HOH A . G 6 HOH 3 403 47 HOH HOH A . G 6 HOH 4 404 8 HOH HOH A . G 6 HOH 5 405 31 HOH HOH A . G 6 HOH 6 406 2 HOH HOH A . G 6 HOH 7 407 10 HOH HOH A . G 6 HOH 8 408 54 HOH HOH A . G 6 HOH 9 409 26 HOH HOH A . G 6 HOH 10 410 15 HOH HOH A . G 6 HOH 11 411 7 HOH HOH A . G 6 HOH 12 412 44 HOH HOH A . G 6 HOH 13 413 24 HOH HOH A . G 6 HOH 14 414 4 HOH HOH A . G 6 HOH 15 415 14 HOH HOH A . G 6 HOH 16 416 32 HOH HOH A . G 6 HOH 17 417 19 HOH HOH A . G 6 HOH 18 418 33 HOH HOH A . G 6 HOH 19 419 53 HOH HOH A . G 6 HOH 20 420 38 HOH HOH A . G 6 HOH 21 421 9 HOH HOH A . G 6 HOH 22 422 23 HOH HOH A . G 6 HOH 23 423 16 HOH HOH A . G 6 HOH 24 424 20 HOH HOH A . G 6 HOH 25 425 18 HOH HOH A . G 6 HOH 26 426 28 HOH HOH A . G 6 HOH 27 427 40 HOH HOH A . G 6 HOH 28 428 27 HOH HOH A . G 6 HOH 29 429 36 HOH HOH A . G 6 HOH 30 430 3 HOH HOH A . G 6 HOH 31 431 5 HOH HOH A . G 6 HOH 32 432 46 HOH HOH A . G 6 HOH 33 433 25 HOH HOH A . G 6 HOH 34 434 29 HOH HOH A . G 6 HOH 35 435 6 HOH HOH A . G 6 HOH 36 436 30 HOH HOH A . G 6 HOH 37 437 17 HOH HOH A . G 6 HOH 38 438 42 HOH HOH A . G 6 HOH 39 439 12 HOH HOH A . G 6 HOH 40 440 11 HOH HOH A . G 6 HOH 41 441 41 HOH HOH A . G 6 HOH 42 442 21 HOH HOH A . G 6 HOH 43 443 52 HOH HOH A . G 6 HOH 44 444 34 HOH HOH A . G 6 HOH 45 445 50 HOH HOH A . G 6 HOH 46 446 43 HOH HOH A . G 6 HOH 47 447 45 HOH HOH A . G 6 HOH 48 448 49 HOH HOH A . G 6 HOH 49 449 48 HOH HOH A . G 6 HOH 50 450 37 HOH HOH A . G 6 HOH 51 451 39 HOH HOH A . G 6 HOH 52 452 35 HOH HOH A . G 6 HOH 53 453 51 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ASN 4 ? CG ? A ASN 24 CG 2 1 Y 1 A ASN 4 ? OD1 ? A ASN 24 OD1 3 1 Y 1 A ASN 4 ? ND2 ? A ASN 24 ND2 4 1 Y 1 A ILE 6 ? CD1 ? A ILE 26 CD1 5 1 Y 1 A LYS 33 ? CE ? A LYS 53 CE 6 1 Y 1 A LYS 33 ? NZ ? A LYS 53 NZ 7 1 Y 1 A LYS 36 ? CD ? A LYS 56 CD 8 1 Y 1 A LYS 36 ? CE ? A LYS 56 CE 9 1 Y 1 A LYS 36 ? NZ ? A LYS 56 NZ 10 1 Y 1 A GLU 37 ? CD ? A GLU 57 CD 11 1 Y 1 A GLU 37 ? OE1 ? A GLU 57 OE1 12 1 Y 1 A GLU 37 ? OE2 ? A GLU 57 OE2 13 1 Y 1 A GLU 70 ? CG ? A GLU 90 CG 14 1 Y 1 A GLU 70 ? CD ? A GLU 90 CD 15 1 Y 1 A GLU 70 ? OE1 ? A GLU 90 OE1 16 1 Y 1 A GLU 70 ? OE2 ? A GLU 90 OE2 17 1 Y 1 A LYS 84 ? CE ? A LYS 104 CE 18 1 Y 1 A LYS 84 ? NZ ? A LYS 104 NZ 19 1 Y 1 A GLU 93 ? CG ? A GLU 113 CG 20 1 Y 1 A GLU 93 ? CD ? A GLU 113 CD 21 1 Y 1 A GLU 93 ? OE1 ? A GLU 113 OE1 22 1 Y 1 A GLU 93 ? OE2 ? A GLU 113 OE2 23 1 Y 1 A LYS 94 ? CE ? A LYS 114 CE 24 1 Y 1 A LYS 94 ? NZ ? A LYS 114 NZ 25 1 Y 1 A LYS 112 ? CG ? A LYS 132 CG 26 1 Y 1 A LYS 112 ? CD ? A LYS 132 CD 27 1 Y 1 A LYS 112 ? CE ? A LYS 132 CE 28 1 Y 1 A LYS 112 ? NZ ? A LYS 132 NZ 29 1 Y 1 A GLU 124 ? CG ? A GLU 144 CG 30 1 Y 1 A GLU 124 ? CD ? A GLU 144 CD 31 1 Y 1 A GLU 124 ? OE1 ? A GLU 144 OE1 32 1 Y 1 A GLU 124 ? OE2 ? A GLU 144 OE2 33 1 Y 1 A LYS 125 ? CE ? A LYS 145 CE 34 1 Y 1 A LYS 125 ? NZ ? A LYS 145 NZ 35 1 Y 1 A ASP 162 ? OD1 ? A ASP 182 OD1 36 1 Y 1 A ASP 162 ? OD2 ? A ASP 182 OD2 37 1 Y 1 A LYS 166 ? CE ? A LYS 186 CE 38 1 Y 1 A LYS 166 ? NZ ? A LYS 186 NZ 39 1 Y 1 A LYS 171 ? CG ? A LYS 191 CG 40 1 Y 1 A LYS 171 ? CD ? A LYS 191 CD 41 1 Y 1 A LYS 171 ? CE ? A LYS 191 CE 42 1 Y 1 A LYS 171 ? NZ ? A LYS 191 NZ 43 1 Y 1 A LYS 184 ? CG ? A LYS 204 CG 44 1 Y 1 A LYS 184 ? CD ? A LYS 204 CD 45 1 Y 1 A LYS 184 ? CE ? A LYS 204 CE 46 1 Y 1 A LYS 184 ? NZ ? A LYS 204 NZ 47 1 Y 1 A GLU 205 ? CG ? A GLU 225 CG 48 1 Y 1 A GLU 205 ? CD ? A GLU 225 CD 49 1 Y 1 A GLU 205 ? OE1 ? A GLU 225 OE1 50 1 Y 1 A GLU 205 ? OE2 ? A GLU 225 OE2 51 1 Y 1 A GLU 230 ? CG ? A GLU 250 CG 52 1 Y 1 A GLU 230 ? CD ? A GLU 250 CD 53 1 Y 1 A GLU 230 ? OE1 ? A GLU 250 OE1 54 1 Y 1 A GLU 230 ? OE2 ? A GLU 250 OE2 55 1 Y 1 A GLU 239 ? CB ? A GLU 259 CB 56 1 Y 1 A GLU 239 ? CG ? A GLU 259 CG 57 1 Y 1 A GLU 239 ? CD ? A GLU 259 CD 58 1 Y 1 A GLU 239 ? OE1 ? A GLU 259 OE1 59 1 Y 1 A GLU 239 ? OE2 ? A GLU 259 OE2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.20.1_4487 ? 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . ? 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . ? 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . ? 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 120.370 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 9PJ4 _cell.details ? _cell.formula_units_Z ? _cell.length_a 107.523 _cell.length_a_esd ? _cell.length_b 37.217 _cell.length_b_esd ? _cell.length_c 81.079 _cell.length_c_esd ? _cell.volume 279930.641 _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9PJ4 _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall 'C 2y' _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9PJ4 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.32 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 46.96 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1M HEPES pH 7.5, 0.2 M NaCl, 25% P3350' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 291 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2023-04-09 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol MAD _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 1.000 1.0 2 1.730 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 22-ID' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list '1.000, 1.730' _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 22-ID _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 39.04 _reflns.entry_id 9PJ4 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.07 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 30838 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 94.6 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.4 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 30.1 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.041 _reflns.pdbx_Rpim_I_all 0.022 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.992 _reflns.pdbx_CC_star 0.998 _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.035 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.07 _reflns_shell.d_res_low 2.11 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 3.6 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 823 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 3.3 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.262 _reflns_shell.pdbx_Rpim_I_all 0.139 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.971 _reflns_shell.pdbx_CC_star 0.993 _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 94.5 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.221 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 42.91 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9PJ4 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.07 _refine.ls_d_res_low 34.98 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 30479 _refine.ls_number_reflns_R_free 3027 _refine.ls_number_reflns_R_work 27452 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 92.24 _refine.ls_percent_reflns_R_free 9.93 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1946 _refine.ls_R_factor_R_free 0.2383 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1899 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 24.5646 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2232 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.07 _refine_hist.d_res_low 34.98 _refine_hist.number_atoms_solvent 53 _refine_hist.number_atoms_total 1901 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1833 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 15 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0077 ? 1894 ? f_bond_d ? ? ? 'X-RAY DIFFRACTION' ? 0.8036 ? 2580 ? f_angle_d ? ? ? 'X-RAY DIFFRACTION' ? 0.0513 ? 284 ? f_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.0066 ? 332 ? f_plane_restr ? ? ? 'X-RAY DIFFRACTION' ? 15.9809 ? 646 ? f_dihedral_angle_d ? ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.07 2.10 . . 136 1230 89.81 . . . . 0.2574 . . . . . . . . . . . . . . . 0.2875 'X-RAY DIFFRACTION' 2.10 2.14 . . 128 1230 92.76 . . . . 0.2384 . . . . . . . . . . . . . . . 0.2969 'X-RAY DIFFRACTION' 2.14 2.17 . . 142 1270 93.39 . . . . 0.2208 . . . . . . . . . . . . . . . 0.3030 'X-RAY DIFFRACTION' 2.17 2.21 . . 147 1277 94.43 . . . . 0.2166 . . . . . . . . . . . . . . . 0.2744 'X-RAY DIFFRACTION' 2.21 2.26 . . 139 1279 95.55 . . . . 0.2103 . . . . . . . . . . . . . . . 0.2529 'X-RAY DIFFRACTION' 2.26 2.30 . . 147 1328 96.41 . . . . 0.2134 . . . . . . . . . . . . . . . 0.2764 'X-RAY DIFFRACTION' 2.30 2.35 . . 142 1281 95.63 . . . . 0.2187 . . . . . . . . . . . . . . . 0.2241 'X-RAY DIFFRACTION' 2.35 2.41 . . 138 1263 96.22 . . . . 0.2182 . . . . . . . . . . . . . . . 0.2733 'X-RAY DIFFRACTION' 2.41 2.47 . . 148 1341 95.63 . . . . 0.2058 . . . . . . . . . . . . . . . 0.2296 'X-RAY DIFFRACTION' 2.47 2.53 . . 134 1263 96.01 . . . . 0.2079 . . . . . . . . . . . . . . . 0.3125 'X-RAY DIFFRACTION' 2.53 2.61 . . 152 1328 95.92 . . . . 0.2070 . . . . . . . . . . . . . . . 0.2550 'X-RAY DIFFRACTION' 2.61 2.69 . . 144 1299 95.69 . . . . 0.2036 . . . . . . . . . . . . . . . 0.2553 'X-RAY DIFFRACTION' 2.69 2.79 . . 141 1267 95.72 . . . . 0.1928 . . . . . . . . . . . . . . . 0.2188 'X-RAY DIFFRACTION' 2.79 2.90 . . 143 1302 95.63 . . . . 0.2004 . . . . . . . . . . . . . . . 0.2742 'X-RAY DIFFRACTION' 2.90 3.03 . . 144 1259 94.22 . . . . 0.2051 . . . . . . . . . . . . . . . 0.2348 'X-RAY DIFFRACTION' 3.03 3.19 . . 145 1262 92.87 . . . . 0.2140 . . . . . . . . . . . . . . . 0.2290 'X-RAY DIFFRACTION' 3.19 3.39 . . 133 1232 90.40 . . . . 0.1943 . . . . . . . . . . . . . . . 0.3045 'X-RAY DIFFRACTION' 3.39 3.65 . . 106 977 73.37 . . . . 0.1705 . . . . . . . . . . . . . . . 0.2263 'X-RAY DIFFRACTION' 3.65 4.02 . . 108 1014 74.65 . . . . 0.1761 . . . . . . . . . . . . . . . 0.2199 'X-RAY DIFFRACTION' 4.02 4.60 . . 126 1193 86.72 . . . . 0.1546 . . . . . . . . . . . . . . . 0.1963 'X-RAY DIFFRACTION' 4.60 5.79 . . 138 1259 93.38 . . . . 0.1853 . . . . . . . . . . . . . . . 0.2208 'X-RAY DIFFRACTION' 5.80 34.98 . . 146 1298 95.69 . . . . 0.1721 . . . . . . . . . . . . . . . 0.2208 # _struct.entry_id 9PJ4 _struct.title 'Crystal structure of u-1,2 Peroxo Intermediate from pABA synthase Nitrosomonas urea CADD (NuCADD)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9PJ4 _struct_keywords.text '4-aminobenzoate synthase, OXIDOREDUCTASE' _struct_keywords.pdbx_keywords OXIDOREDUCTASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? F N N 5 ? G N N 6 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A0S3AKG1_9PROT _struct_ref.pdbx_db_accession A0A0S3AKG1 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MTTNTILKQKITAIISEKHLLKHPFYIAWTEGKLTKEQLRHYAEQYFYNVLAEPTYLSAVHFNTPHIHSESNSGDISVRQ EVLKNLIDEEHGEKNHPALWKNFAFALGANDKILASASALPTTEKLVSTFRDICLNRPFYAGLAALHAFESQVPDIAAVK IDGLAKFYGMKNPEDYEFFSVHQKADIYHSQAEWAIIERFADNPEKQAEVLAATQEACDALWGFLDGIHETYCANLMCEQ KEAATLH ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9PJ4 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 21 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 267 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A0S3AKG1 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 247 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 247 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9PJ4 MET A 1 ? UNP A0A0S3AKG1 ? ? 'expression tag' -19 1 1 9PJ4 GLY A 2 ? UNP A0A0S3AKG1 ? ? 'expression tag' -18 2 1 9PJ4 SER A 3 ? UNP A0A0S3AKG1 ? ? 'expression tag' -17 3 1 9PJ4 SER A 4 ? UNP A0A0S3AKG1 ? ? 'expression tag' -16 4 1 9PJ4 HIS A 5 ? UNP A0A0S3AKG1 ? ? 'expression tag' -15 5 1 9PJ4 HIS A 6 ? UNP A0A0S3AKG1 ? ? 'expression tag' -14 6 1 9PJ4 HIS A 7 ? UNP A0A0S3AKG1 ? ? 'expression tag' -13 7 1 9PJ4 HIS A 8 ? UNP A0A0S3AKG1 ? ? 'expression tag' -12 8 1 9PJ4 HIS A 9 ? UNP A0A0S3AKG1 ? ? 'expression tag' -11 9 1 9PJ4 HIS A 10 ? UNP A0A0S3AKG1 ? ? 'expression tag' -10 10 1 9PJ4 SER A 11 ? UNP A0A0S3AKG1 ? ? 'expression tag' -9 11 1 9PJ4 SER A 12 ? UNP A0A0S3AKG1 ? ? 'expression tag' -8 12 1 9PJ4 GLY A 13 ? UNP A0A0S3AKG1 ? ? 'expression tag' -7 13 1 9PJ4 LEU A 14 ? UNP A0A0S3AKG1 ? ? 'expression tag' -6 14 1 9PJ4 VAL A 15 ? UNP A0A0S3AKG1 ? ? 'expression tag' -5 15 1 9PJ4 PRO A 16 ? UNP A0A0S3AKG1 ? ? 'expression tag' -4 16 1 9PJ4 ARG A 17 ? UNP A0A0S3AKG1 ? ? 'expression tag' -3 17 1 9PJ4 GLY A 18 ? UNP A0A0S3AKG1 ? ? 'expression tag' -2 18 1 9PJ4 SER A 19 ? UNP A0A0S3AKG1 ? ? 'expression tag' -1 19 1 9PJ4 HIS A 20 ? UNP A0A0S3AKG1 ? ? 'expression tag' 0 20 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 4990 ? 1 MORE -92 ? 1 'SSA (A^2)' 17480 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_556 -x,y,-z+1 -1.0000000000 0.0000000000 0.0000000000 -40.9920897623 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 69.9532187817 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 24 ? LYS A 38 ? ASN A 4 LYS A 18 1 ? 15 HELX_P HELX_P2 AA2 HIS A 39 ? LYS A 42 ? HIS A 19 LYS A 22 5 ? 4 HELX_P HELX_P3 AA3 HIS A 43 ? GLY A 52 ? HIS A 23 GLY A 32 1 ? 10 HELX_P HELX_P4 AA4 THR A 55 ? THR A 84 ? THR A 35 THR A 64 1 ? 30 HELX_P HELX_P5 AA5 ILE A 96 ? HIS A 111 ? ILE A 76 HIS A 91 1 ? 16 HELX_P HELX_P6 AA6 ASN A 115 ? LEU A 127 ? ASN A 95 LEU A 107 1 ? 13 HELX_P HELX_P7 AA7 ASN A 130 ? ALA A 137 ? ASN A 110 ALA A 117 1 ? 8 HELX_P HELX_P8 AA8 LEU A 140 ? ARG A 157 ? LEU A 120 ARG A 137 1 ? 18 HELX_P HELX_P9 AA9 PRO A 158 ? SER A 171 ? PRO A 138 SER A 151 1 ? 14 HELX_P HELX_P10 AB1 GLN A 172 ? PHE A 187 ? GLN A 152 PHE A 167 1 ? 16 HELX_P HELX_P11 AB2 ASN A 192 ? ASP A 195 ? ASN A 172 ASP A 175 5 ? 4 HELX_P HELX_P12 AB3 TYR A 196 ? ALA A 221 ? TYR A 176 ALA A 201 1 ? 26 HELX_P HELX_P13 AB4 ASN A 223 ? CYS A 253 ? ASN A 203 CYS A 233 1 ? 31 HELX_P HELX_P14 AB5 CYS A 253 ? CYS A 258 ? CYS A 233 CYS A 238 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A GLU 109 OE1 ? ? ? 1_555 D FE . FE ? ? A GLU 89 A FE 303 1_555 ? ? ? ? ? ? ? 2.114 ? ? metalc2 metalc ? ? A GLU 109 OE2 ? ? ? 1_555 E FE . FE ? ? A GLU 89 A FE 304 1_555 ? ? ? ? ? ? ? 2.183 ? ? metalc3 metalc ? ? A HIS 116 ND1 ? ? ? 1_555 D FE . FE ? ? A HIS 96 A FE 303 1_555 ? ? ? ? ? ? ? 2.106 ? ? metalc4 metalc ? ? A GLU 170 OE2 ? ? ? 1_555 E FE . FE ? ? A GLU 150 A FE 304 1_555 ? ? ? ? ? ? ? 1.780 ? ? metalc5 metalc ? ? A HIS 202 NE2 ? ? ? 1_555 D FE . FE ? ? A HIS 182 A FE 303 1_555 ? ? ? ? ? ? ? 2.090 ? ? metalc6 metalc ? ? A ASP 206 OD1 ? ? ? 1_555 E FE . FE ? ? A ASP 186 A FE 304 1_555 ? ? ? ? ? ? ? 2.115 ? ? metalc7 metalc ? ? A HIS 209 ND1 ? ? ? 1_555 E FE . FE ? ? A HIS 189 A FE 304 1_555 ? ? ? ? ? ? ? 2.226 ? ? metalc8 metalc ? ? B PER . O2 ? ? ? 1_555 D FE . FE ? ? A PER 301 A FE 303 1_555 ? ? ? ? ? ? ? 2.062 ? ? metalc9 metalc ? ? B PER . O1 ? ? ? 1_555 E FE . FE ? ? A PER 301 A FE 304 1_555 ? ? ? ? ? ? ? 2.098 ? ? metalc10 metalc ? ? D FE . FE ? ? ? 1_555 G HOH . O ? ? A FE 303 A HOH 401 1_555 ? ? ? ? ? ? ? 2.122 ? ? metalc11 metalc ? ? D FE . FE ? ? ? 1_555 G HOH . O ? ? A FE 303 A HOH 406 1_555 ? ? ? ? ? ? ? 2.347 ? ? metalc12 metalc ? ? E FE . FE ? ? ? 1_555 G HOH . O ? ? A FE 304 A HOH 406 1_555 ? ? ? ? ? ? ? 2.055 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE1 ? A GLU 109 ? A GLU 89 ? 1_555 FE ? D FE . ? A FE 303 ? 1_555 ND1 ? A HIS 116 ? A HIS 96 ? 1_555 85.0 ? 2 OE1 ? A GLU 109 ? A GLU 89 ? 1_555 FE ? D FE . ? A FE 303 ? 1_555 NE2 ? A HIS 202 ? A HIS 182 ? 1_555 176.5 ? 3 ND1 ? A HIS 116 ? A HIS 96 ? 1_555 FE ? D FE . ? A FE 303 ? 1_555 NE2 ? A HIS 202 ? A HIS 182 ? 1_555 94.6 ? 4 OE1 ? A GLU 109 ? A GLU 89 ? 1_555 FE ? D FE . ? A FE 303 ? 1_555 O2 ? B PER . ? A PER 301 ? 1_555 99.5 ? 5 ND1 ? A HIS 116 ? A HIS 96 ? 1_555 FE ? D FE . ? A FE 303 ? 1_555 O2 ? B PER . ? A PER 301 ? 1_555 171.8 ? 6 NE2 ? A HIS 202 ? A HIS 182 ? 1_555 FE ? D FE . ? A FE 303 ? 1_555 O2 ? B PER . ? A PER 301 ? 1_555 80.4 ? 7 OE1 ? A GLU 109 ? A GLU 89 ? 1_555 FE ? D FE . ? A FE 303 ? 1_555 O ? G HOH . ? A HOH 401 ? 1_555 89.5 ? 8 ND1 ? A HIS 116 ? A HIS 96 ? 1_555 FE ? D FE . ? A FE 303 ? 1_555 O ? G HOH . ? A HOH 401 ? 1_555 107.9 ? 9 NE2 ? A HIS 202 ? A HIS 182 ? 1_555 FE ? D FE . ? A FE 303 ? 1_555 O ? G HOH . ? A HOH 401 ? 1_555 87.3 ? 10 O2 ? B PER . ? A PER 301 ? 1_555 FE ? D FE . ? A FE 303 ? 1_555 O ? G HOH . ? A HOH 401 ? 1_555 65.6 ? 11 OE1 ? A GLU 109 ? A GLU 89 ? 1_555 FE ? D FE . ? A FE 303 ? 1_555 O ? G HOH . ? A HOH 406 ? 1_555 91.6 ? 12 ND1 ? A HIS 116 ? A HIS 96 ? 1_555 FE ? D FE . ? A FE 303 ? 1_555 O ? G HOH . ? A HOH 406 ? 1_555 99.4 ? 13 NE2 ? A HIS 202 ? A HIS 182 ? 1_555 FE ? D FE . ? A FE 303 ? 1_555 O ? G HOH . ? A HOH 406 ? 1_555 91.9 ? 14 O2 ? B PER . ? A PER 301 ? 1_555 FE ? D FE . ? A FE 303 ? 1_555 O ? G HOH . ? A HOH 406 ? 1_555 87.3 ? 15 O ? G HOH . ? A HOH 401 ? 1_555 FE ? D FE . ? A FE 303 ? 1_555 O ? G HOH . ? A HOH 406 ? 1_555 152.6 ? 16 OE2 ? A GLU 109 ? A GLU 89 ? 1_555 FE ? E FE . ? A FE 304 ? 1_555 OE2 ? A GLU 170 ? A GLU 150 ? 1_555 97.0 ? 17 OE2 ? A GLU 109 ? A GLU 89 ? 1_555 FE ? E FE . ? A FE 304 ? 1_555 OD1 ? A ASP 206 ? A ASP 186 ? 1_555 169.6 ? 18 OE2 ? A GLU 170 ? A GLU 150 ? 1_555 FE ? E FE . ? A FE 304 ? 1_555 OD1 ? A ASP 206 ? A ASP 186 ? 1_555 91.1 ? 19 OE2 ? A GLU 109 ? A GLU 89 ? 1_555 FE ? E FE . ? A FE 304 ? 1_555 ND1 ? A HIS 209 ? A HIS 189 ? 1_555 95.4 ? 20 OE2 ? A GLU 170 ? A GLU 150 ? 1_555 FE ? E FE . ? A FE 304 ? 1_555 ND1 ? A HIS 209 ? A HIS 189 ? 1_555 103.7 ? 21 OD1 ? A ASP 206 ? A ASP 186 ? 1_555 FE ? E FE . ? A FE 304 ? 1_555 ND1 ? A HIS 209 ? A HIS 189 ? 1_555 89.0 ? 22 OE2 ? A GLU 109 ? A GLU 89 ? 1_555 FE ? E FE . ? A FE 304 ? 1_555 O1 ? B PER . ? A PER 301 ? 1_555 91.2 ? 23 OE2 ? A GLU 170 ? A GLU 150 ? 1_555 FE ? E FE . ? A FE 304 ? 1_555 O1 ? B PER . ? A PER 301 ? 1_555 70.9 ? 24 OD1 ? A ASP 206 ? A ASP 186 ? 1_555 FE ? E FE . ? A FE 304 ? 1_555 O1 ? B PER . ? A PER 301 ? 1_555 85.3 ? 25 ND1 ? A HIS 209 ? A HIS 189 ? 1_555 FE ? E FE . ? A FE 304 ? 1_555 O1 ? B PER . ? A PER 301 ? 1_555 172.0 ? 26 OE2 ? A GLU 109 ? A GLU 89 ? 1_555 FE ? E FE . ? A FE 304 ? 1_555 O ? G HOH . ? A HOH 406 ? 1_555 98.4 ? 27 OE2 ? A GLU 170 ? A GLU 150 ? 1_555 FE ? E FE . ? A FE 304 ? 1_555 O ? G HOH . ? A HOH 406 ? 1_555 160.6 ? 28 OD1 ? A ASP 206 ? A ASP 186 ? 1_555 FE ? E FE . ? A FE 304 ? 1_555 O ? G HOH . ? A HOH 406 ? 1_555 72.4 ? 29 ND1 ? A HIS 209 ? A HIS 189 ? 1_555 FE ? E FE . ? A FE 304 ? 1_555 O ? G HOH . ? A HOH 406 ? 1_555 86.6 ? 30 O1 ? B PER . ? A PER 301 ? 1_555 FE ? E FE . ? A FE 304 ? 1_555 O ? G HOH . ? A HOH 406 ? 1_555 97.0 ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 87 ? SER A 89 ? ILE A 67 SER A 69 AA1 2 ASN A 92 ? ASP A 95 ? ASN A 72 ASP A 75 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id ILE _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 87 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 67 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id ASP _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 95 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id ASP _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 75 # _pdbx_entry_details.entry_id 9PJ4 _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 68 ? ? -101.28 68.01 2 1 ASN A 72 ? ? -155.72 88.05 3 1 LYS A 94 ? ? -96.96 31.55 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 452 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id G _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -x,y,-z 3 x+1/2,y+1/2,z 4 -x+1/2,y+1/2,-z # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -19 ? A MET 1 2 1 Y 1 A GLY -18 ? A GLY 2 3 1 Y 1 A SER -17 ? A SER 3 4 1 Y 1 A SER -16 ? A SER 4 5 1 Y 1 A HIS -15 ? A HIS 5 6 1 Y 1 A HIS -14 ? A HIS 6 7 1 Y 1 A HIS -13 ? A HIS 7 8 1 Y 1 A HIS -12 ? A HIS 8 9 1 Y 1 A HIS -11 ? A HIS 9 10 1 Y 1 A HIS -10 ? A HIS 10 11 1 Y 1 A SER -9 ? A SER 11 12 1 Y 1 A SER -8 ? A SER 12 13 1 Y 1 A GLY -7 ? A GLY 13 14 1 Y 1 A LEU -6 ? A LEU 14 15 1 Y 1 A VAL -5 ? A VAL 15 16 1 Y 1 A PRO -4 ? A PRO 16 17 1 Y 1 A ARG -3 ? A ARG 17 18 1 Y 1 A GLY -2 ? A GLY 18 19 1 Y 1 A SER -1 ? A SER 19 20 1 Y 1 A HIS 0 ? A HIS 20 21 1 Y 1 A MET 1 ? A MET 21 22 1 Y 1 A THR 2 ? A THR 22 23 1 Y 1 A THR 3 ? A THR 23 24 1 Y 1 A GLN 240 ? A GLN 260 25 1 Y 1 A LYS 241 ? A LYS 261 26 1 Y 1 A GLU 242 ? A GLU 262 27 1 Y 1 A ALA 243 ? A ALA 263 28 1 Y 1 A ALA 244 ? A ALA 264 29 1 Y 1 A THR 245 ? A THR 265 30 1 Y 1 A LEU 246 ? A LEU 266 31 1 Y 1 A HIS 247 ? A HIS 267 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 FE FE FE N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 GOL C1 C N N 138 GOL O1 O N N 139 GOL C2 C N N 140 GOL O2 O N N 141 GOL C3 C N N 142 GOL O3 O N N 143 GOL H11 H N N 144 GOL H12 H N N 145 GOL HO1 H N N 146 GOL H2 H N N 147 GOL HO2 H N N 148 GOL H31 H N N 149 GOL H32 H N N 150 GOL HO3 H N N 151 HIS N N N N 152 HIS CA C N S 153 HIS C C N N 154 HIS O O N N 155 HIS CB C N N 156 HIS CG C Y N 157 HIS ND1 N Y N 158 HIS CD2 C Y N 159 HIS CE1 C Y N 160 HIS NE2 N Y N 161 HIS OXT O N N 162 HIS H H N N 163 HIS H2 H N N 164 HIS HA H N N 165 HIS HB2 H N N 166 HIS HB3 H N N 167 HIS HD1 H N N 168 HIS HD2 H N N 169 HIS HE1 H N N 170 HIS HE2 H N N 171 HIS HXT H N N 172 HOH O O N N 173 HOH H1 H N N 174 HOH H2 H N N 175 ILE N N N N 176 ILE CA C N S 177 ILE C C N N 178 ILE O O N N 179 ILE CB C N S 180 ILE CG1 C N N 181 ILE CG2 C N N 182 ILE CD1 C N N 183 ILE OXT O N N 184 ILE H H N N 185 ILE H2 H N N 186 ILE HA H N N 187 ILE HB H N N 188 ILE HG12 H N N 189 ILE HG13 H N N 190 ILE HG21 H N N 191 ILE HG22 H N N 192 ILE HG23 H N N 193 ILE HD11 H N N 194 ILE HD12 H N N 195 ILE HD13 H N N 196 ILE HXT H N N 197 LEU N N N N 198 LEU CA C N S 199 LEU C C N N 200 LEU O O N N 201 LEU CB C N N 202 LEU CG C N N 203 LEU CD1 C N N 204 LEU CD2 C N N 205 LEU OXT O N N 206 LEU H H N N 207 LEU H2 H N N 208 LEU HA H N N 209 LEU HB2 H N N 210 LEU HB3 H N N 211 LEU HG H N N 212 LEU HD11 H N N 213 LEU HD12 H N N 214 LEU HD13 H N N 215 LEU HD21 H N N 216 LEU HD22 H N N 217 LEU HD23 H N N 218 LEU HXT H N N 219 LYS N N N N 220 LYS CA C N S 221 LYS C C N N 222 LYS O O N N 223 LYS CB C N N 224 LYS CG C N N 225 LYS CD C N N 226 LYS CE C N N 227 LYS NZ N N N 228 LYS OXT O N N 229 LYS H H N N 230 LYS H2 H N N 231 LYS HA H N N 232 LYS HB2 H N N 233 LYS HB3 H N N 234 LYS HG2 H N N 235 LYS HG3 H N N 236 LYS HD2 H N N 237 LYS HD3 H N N 238 LYS HE2 H N N 239 LYS HE3 H N N 240 LYS HZ1 H N N 241 LYS HZ2 H N N 242 LYS HZ3 H N N 243 LYS HXT H N N 244 MET N N N N 245 MET CA C N S 246 MET C C N N 247 MET O O N N 248 MET CB C N N 249 MET CG C N N 250 MET SD S N N 251 MET CE C N N 252 MET OXT O N N 253 MET H H N N 254 MET H2 H N N 255 MET HA H N N 256 MET HB2 H N N 257 MET HB3 H N N 258 MET HG2 H N N 259 MET HG3 H N N 260 MET HE1 H N N 261 MET HE2 H N N 262 MET HE3 H N N 263 MET HXT H N N 264 PER O1 O N N 265 PER O2 O N N 266 PHE N N N N 267 PHE CA C N S 268 PHE C C N N 269 PHE O O N N 270 PHE CB C N N 271 PHE CG C Y N 272 PHE CD1 C Y N 273 PHE CD2 C Y N 274 PHE CE1 C Y N 275 PHE CE2 C Y N 276 PHE CZ C Y N 277 PHE OXT O N N 278 PHE H H N N 279 PHE H2 H N N 280 PHE HA H N N 281 PHE HB2 H N N 282 PHE HB3 H N N 283 PHE HD1 H N N 284 PHE HD2 H N N 285 PHE HE1 H N N 286 PHE HE2 H N N 287 PHE HZ H N N 288 PHE HXT H N N 289 PRO N N N N 290 PRO CA C N S 291 PRO C C N N 292 PRO O O N N 293 PRO CB C N N 294 PRO CG C N N 295 PRO CD C N N 296 PRO OXT O N N 297 PRO H H N N 298 PRO HA H N N 299 PRO HB2 H N N 300 PRO HB3 H N N 301 PRO HG2 H N N 302 PRO HG3 H N N 303 PRO HD2 H N N 304 PRO HD3 H N N 305 PRO HXT H N N 306 SER N N N N 307 SER CA C N S 308 SER C C N N 309 SER O O N N 310 SER CB C N N 311 SER OG O N N 312 SER OXT O N N 313 SER H H N N 314 SER H2 H N N 315 SER HA H N N 316 SER HB2 H N N 317 SER HB3 H N N 318 SER HG H N N 319 SER HXT H N N 320 SO4 S S N N 321 SO4 O1 O N N 322 SO4 O2 O N N 323 SO4 O3 O N N 324 SO4 O4 O N N 325 THR N N N N 326 THR CA C N S 327 THR C C N N 328 THR O O N N 329 THR CB C N R 330 THR OG1 O N N 331 THR CG2 C N N 332 THR OXT O N N 333 THR H H N N 334 THR H2 H N N 335 THR HA H N N 336 THR HB H N N 337 THR HG1 H N N 338 THR HG21 H N N 339 THR HG22 H N N 340 THR HG23 H N N 341 THR HXT H N N 342 TRP N N N N 343 TRP CA C N S 344 TRP C C N N 345 TRP O O N N 346 TRP CB C N N 347 TRP CG C Y N 348 TRP CD1 C Y N 349 TRP CD2 C Y N 350 TRP NE1 N Y N 351 TRP CE2 C Y N 352 TRP CE3 C Y N 353 TRP CZ2 C Y N 354 TRP CZ3 C Y N 355 TRP CH2 C Y N 356 TRP OXT O N N 357 TRP H H N N 358 TRP H2 H N N 359 TRP HA H N N 360 TRP HB2 H N N 361 TRP HB3 H N N 362 TRP HD1 H N N 363 TRP HE1 H N N 364 TRP HE3 H N N 365 TRP HZ2 H N N 366 TRP HZ3 H N N 367 TRP HH2 H N N 368 TRP HXT H N N 369 TYR N N N N 370 TYR CA C N S 371 TYR C C N N 372 TYR O O N N 373 TYR CB C N N 374 TYR CG C Y N 375 TYR CD1 C Y N 376 TYR CD2 C Y N 377 TYR CE1 C Y N 378 TYR CE2 C Y N 379 TYR CZ C Y N 380 TYR OH O N N 381 TYR OXT O N N 382 TYR H H N N 383 TYR H2 H N N 384 TYR HA H N N 385 TYR HB2 H N N 386 TYR HB3 H N N 387 TYR HD1 H N N 388 TYR HD2 H N N 389 TYR HE1 H N N 390 TYR HE2 H N N 391 TYR HH H N N 392 TYR HXT H N N 393 VAL N N N N 394 VAL CA C N S 395 VAL C C N N 396 VAL O O N N 397 VAL CB C N N 398 VAL CG1 C N N 399 VAL CG2 C N N 400 VAL OXT O N N 401 VAL H H N N 402 VAL H2 H N N 403 VAL HA H N N 404 VAL HB H N N 405 VAL HG11 H N N 406 VAL HG12 H N N 407 VAL HG13 H N N 408 VAL HG21 H N N 409 VAL HG22 H N N 410 VAL HG23 H N N 411 VAL HXT H N N 412 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 GOL C1 O1 sing N N 129 GOL C1 C2 sing N N 130 GOL C1 H11 sing N N 131 GOL C1 H12 sing N N 132 GOL O1 HO1 sing N N 133 GOL C2 O2 sing N N 134 GOL C2 C3 sing N N 135 GOL C2 H2 sing N N 136 GOL O2 HO2 sing N N 137 GOL C3 O3 sing N N 138 GOL C3 H31 sing N N 139 GOL C3 H32 sing N N 140 GOL O3 HO3 sing N N 141 HIS N CA sing N N 142 HIS N H sing N N 143 HIS N H2 sing N N 144 HIS CA C sing N N 145 HIS CA CB sing N N 146 HIS CA HA sing N N 147 HIS C O doub N N 148 HIS C OXT sing N N 149 HIS CB CG sing N N 150 HIS CB HB2 sing N N 151 HIS CB HB3 sing N N 152 HIS CG ND1 sing Y N 153 HIS CG CD2 doub Y N 154 HIS ND1 CE1 doub Y N 155 HIS ND1 HD1 sing N N 156 HIS CD2 NE2 sing Y N 157 HIS CD2 HD2 sing N N 158 HIS CE1 NE2 sing Y N 159 HIS CE1 HE1 sing N N 160 HIS NE2 HE2 sing N N 161 HIS OXT HXT sing N N 162 HOH O H1 sing N N 163 HOH O H2 sing N N 164 ILE N CA sing N N 165 ILE N H sing N N 166 ILE N H2 sing N N 167 ILE CA C sing N N 168 ILE CA CB sing N N 169 ILE CA HA sing N N 170 ILE C O doub N N 171 ILE C OXT sing N N 172 ILE CB CG1 sing N N 173 ILE CB CG2 sing N N 174 ILE CB HB sing N N 175 ILE CG1 CD1 sing N N 176 ILE CG1 HG12 sing N N 177 ILE CG1 HG13 sing N N 178 ILE CG2 HG21 sing N N 179 ILE CG2 HG22 sing N N 180 ILE CG2 HG23 sing N N 181 ILE CD1 HD11 sing N N 182 ILE CD1 HD12 sing N N 183 ILE CD1 HD13 sing N N 184 ILE OXT HXT sing N N 185 LEU N CA sing N N 186 LEU N H sing N N 187 LEU N H2 sing N N 188 LEU CA C sing N N 189 LEU CA CB sing N N 190 LEU CA HA sing N N 191 LEU C O doub N N 192 LEU C OXT sing N N 193 LEU CB CG sing N N 194 LEU CB HB2 sing N N 195 LEU CB HB3 sing N N 196 LEU CG CD1 sing N N 197 LEU CG CD2 sing N N 198 LEU CG HG sing N N 199 LEU CD1 HD11 sing N N 200 LEU CD1 HD12 sing N N 201 LEU CD1 HD13 sing N N 202 LEU CD2 HD21 sing N N 203 LEU CD2 HD22 sing N N 204 LEU CD2 HD23 sing N N 205 LEU OXT HXT sing N N 206 LYS N CA sing N N 207 LYS N H sing N N 208 LYS N H2 sing N N 209 LYS CA C sing N N 210 LYS CA CB sing N N 211 LYS CA HA sing N N 212 LYS C O doub N N 213 LYS C OXT sing N N 214 LYS CB CG sing N N 215 LYS CB HB2 sing N N 216 LYS CB HB3 sing N N 217 LYS CG CD sing N N 218 LYS CG HG2 sing N N 219 LYS CG HG3 sing N N 220 LYS CD CE sing N N 221 LYS CD HD2 sing N N 222 LYS CD HD3 sing N N 223 LYS CE NZ sing N N 224 LYS CE HE2 sing N N 225 LYS CE HE3 sing N N 226 LYS NZ HZ1 sing N N 227 LYS NZ HZ2 sing N N 228 LYS NZ HZ3 sing N N 229 LYS OXT HXT sing N N 230 MET N CA sing N N 231 MET N H sing N N 232 MET N H2 sing N N 233 MET CA C sing N N 234 MET CA CB sing N N 235 MET CA HA sing N N 236 MET C O doub N N 237 MET C OXT sing N N 238 MET CB CG sing N N 239 MET CB HB2 sing N N 240 MET CB HB3 sing N N 241 MET CG SD sing N N 242 MET CG HG2 sing N N 243 MET CG HG3 sing N N 244 MET SD CE sing N N 245 MET CE HE1 sing N N 246 MET CE HE2 sing N N 247 MET CE HE3 sing N N 248 MET OXT HXT sing N N 249 PER O1 O2 sing N N 250 PHE N CA sing N N 251 PHE N H sing N N 252 PHE N H2 sing N N 253 PHE CA C sing N N 254 PHE CA CB sing N N 255 PHE CA HA sing N N 256 PHE C O doub N N 257 PHE C OXT sing N N 258 PHE CB CG sing N N 259 PHE CB HB2 sing N N 260 PHE CB HB3 sing N N 261 PHE CG CD1 doub Y N 262 PHE CG CD2 sing Y N 263 PHE CD1 CE1 sing Y N 264 PHE CD1 HD1 sing N N 265 PHE CD2 CE2 doub Y N 266 PHE CD2 HD2 sing N N 267 PHE CE1 CZ doub Y N 268 PHE CE1 HE1 sing N N 269 PHE CE2 CZ sing Y N 270 PHE CE2 HE2 sing N N 271 PHE CZ HZ sing N N 272 PHE OXT HXT sing N N 273 PRO N CA sing N N 274 PRO N CD sing N N 275 PRO N H sing N N 276 PRO CA C sing N N 277 PRO CA CB sing N N 278 PRO CA HA sing N N 279 PRO C O doub N N 280 PRO C OXT sing N N 281 PRO CB CG sing N N 282 PRO CB HB2 sing N N 283 PRO CB HB3 sing N N 284 PRO CG CD sing N N 285 PRO CG HG2 sing N N 286 PRO CG HG3 sing N N 287 PRO CD HD2 sing N N 288 PRO CD HD3 sing N N 289 PRO OXT HXT sing N N 290 SER N CA sing N N 291 SER N H sing N N 292 SER N H2 sing N N 293 SER CA C sing N N 294 SER CA CB sing N N 295 SER CA HA sing N N 296 SER C O doub N N 297 SER C OXT sing N N 298 SER CB OG sing N N 299 SER CB HB2 sing N N 300 SER CB HB3 sing N N 301 SER OG HG sing N N 302 SER OXT HXT sing N N 303 SO4 S O1 doub N N 304 SO4 S O2 doub N N 305 SO4 S O3 sing N N 306 SO4 S O4 sing N N 307 THR N CA sing N N 308 THR N H sing N N 309 THR N H2 sing N N 310 THR CA C sing N N 311 THR CA CB sing N N 312 THR CA HA sing N N 313 THR C O doub N N 314 THR C OXT sing N N 315 THR CB OG1 sing N N 316 THR CB CG2 sing N N 317 THR CB HB sing N N 318 THR OG1 HG1 sing N N 319 THR CG2 HG21 sing N N 320 THR CG2 HG22 sing N N 321 THR CG2 HG23 sing N N 322 THR OXT HXT sing N N 323 TRP N CA sing N N 324 TRP N H sing N N 325 TRP N H2 sing N N 326 TRP CA C sing N N 327 TRP CA CB sing N N 328 TRP CA HA sing N N 329 TRP C O doub N N 330 TRP C OXT sing N N 331 TRP CB CG sing N N 332 TRP CB HB2 sing N N 333 TRP CB HB3 sing N N 334 TRP CG CD1 doub Y N 335 TRP CG CD2 sing Y N 336 TRP CD1 NE1 sing Y N 337 TRP CD1 HD1 sing N N 338 TRP CD2 CE2 doub Y N 339 TRP CD2 CE3 sing Y N 340 TRP NE1 CE2 sing Y N 341 TRP NE1 HE1 sing N N 342 TRP CE2 CZ2 sing Y N 343 TRP CE3 CZ3 doub Y N 344 TRP CE3 HE3 sing N N 345 TRP CZ2 CH2 doub Y N 346 TRP CZ2 HZ2 sing N N 347 TRP CZ3 CH2 sing Y N 348 TRP CZ3 HZ3 sing N N 349 TRP CH2 HH2 sing N N 350 TRP OXT HXT sing N N 351 TYR N CA sing N N 352 TYR N H sing N N 353 TYR N H2 sing N N 354 TYR CA C sing N N 355 TYR CA CB sing N N 356 TYR CA HA sing N N 357 TYR C O doub N N 358 TYR C OXT sing N N 359 TYR CB CG sing N N 360 TYR CB HB2 sing N N 361 TYR CB HB3 sing N N 362 TYR CG CD1 doub Y N 363 TYR CG CD2 sing Y N 364 TYR CD1 CE1 sing Y N 365 TYR CD1 HD1 sing N N 366 TYR CD2 CE2 doub Y N 367 TYR CD2 HD2 sing N N 368 TYR CE1 CZ doub Y N 369 TYR CE1 HE1 sing N N 370 TYR CE2 CZ sing Y N 371 TYR CE2 HE2 sing N N 372 TYR CZ OH sing N N 373 TYR OH HH sing N N 374 TYR OXT HXT sing N N 375 VAL N CA sing N N 376 VAL N H sing N N 377 VAL N H2 sing N N 378 VAL CA C sing N N 379 VAL CA CB sing N N 380 VAL CA HA sing N N 381 VAL C O doub N N 382 VAL C OXT sing N N 383 VAL CB CG1 sing N N 384 VAL CB CG2 sing N N 385 VAL CB HB sing N N 386 VAL CG1 HG11 sing N N 387 VAL CG1 HG12 sing N N 388 VAL CG1 HG13 sing N N 389 VAL CG2 HG21 sing N N 390 VAL CG2 HG22 sing N N 391 VAL CG2 HG23 sing N N 392 VAL OXT HXT sing N N 393 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number GM135315 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 9O8A _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'C 1 2 1' _space_group.name_Hall 'C 2y' _space_group.IT_number 5 _space_group.crystal_system monoclinic _space_group.id 1 # _atom_sites.entry_id 9PJ4 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.009300 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.005450 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.026869 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.014295 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? FE ? ? 20.90327 4.99816 ? ? 2.55100 38.46870 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ #