data_9PNM # _entry.id 9PNM # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.409 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9PNM pdb_00009pnm 10.2210/pdb9pnm/pdb WWPDB D_1000298192 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-01-21 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9PNM _pdbx_database_status.recvd_initial_deposition_date 2025-07-21 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible N # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB . 9PMP unspecified PDB . 9PMR unspecified PDB . 9PN2 unspecified PDB . 9PN3 unspecified PDB . 9PNL unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email scohen@ucsd.edu _pdbx_contact_author.name_first Seth _pdbx_contact_author.name_last Cohen _pdbx_contact_author.name_mi M _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-5233-2280 # _audit_author.name 'Kohlbrand, A.J.' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID 0000-0003-4599-526X # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Inorg.Biochem. _citation.journal_id_ASTM JIBIDJ _citation.journal_id_CSD 0525 _citation.journal_id_ISSN 0162-0134 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 277 _citation.language ? _citation.page_first 113210 _citation.page_last 113210 _citation.title 'Substituent size versus metal binding of inhibitors with variants of influenza endonuclease.' _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.jinorgbio.2025.113210 _citation.pdbx_database_id_PubMed 41512630 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kohlbrand, A.J.' 1 ? primary 'Stokes, R.W.' 2 ? primary 'Sankaran, B.' 3 ? primary 'Cohen, S.M.' 4 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Polymerase acidic protein' 22334.426 1 3.1.-.- ? 'N-terminal domain (UNP residues 1-198)' ? 2 non-polymer syn 'MANGANESE (II) ION' 54.938 2 ? ? ? ? 3 non-polymer syn '(6M)-3-hydroxy-6-[2-(methylsulfanyl)phenyl]-4-oxo-1,4-dihydropyridine-2-carboxylic acid' 277.296 1 ? ? ? ? 4 water nat water 18.015 7 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'RNA-directed RNA polymerase subunit P2' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSGSAMEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDGGSGDPNALLKHRFEIIEGRDRIM AWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEE SRARIKTRLFTIRQEMASRSLWDSFRQSERGE ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSGSAMEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDGGSGDPNALLKHRFEIIEGRDRIM AWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEE SRARIKTRLFTIRQEMASRSLWDSFRQSERGE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'MANGANESE (II) ION' MN 3 '(6M)-3-hydroxy-6-[2-(methylsulfanyl)phenyl]-4-oxo-1,4-dihydropyridine-2-carboxylic acid' A1CI4 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 ALA n 1 7 MET n 1 8 GLU n 1 9 ASP n 1 10 PHE n 1 11 VAL n 1 12 ARG n 1 13 GLN n 1 14 CYS n 1 15 PHE n 1 16 ASN n 1 17 PRO n 1 18 MET n 1 19 ILE n 1 20 VAL n 1 21 GLU n 1 22 LEU n 1 23 ALA n 1 24 GLU n 1 25 LYS n 1 26 ALA n 1 27 MET n 1 28 LYS n 1 29 GLU n 1 30 TYR n 1 31 GLY n 1 32 GLU n 1 33 ASP n 1 34 PRO n 1 35 LYS n 1 36 ILE n 1 37 GLU n 1 38 THR n 1 39 ASN n 1 40 LYS n 1 41 PHE n 1 42 ALA n 1 43 ALA n 1 44 ILE n 1 45 CYS n 1 46 THR n 1 47 HIS n 1 48 LEU n 1 49 GLU n 1 50 VAL n 1 51 CYS n 1 52 PHE n 1 53 MET n 1 54 TYR n 1 55 SER n 1 56 ASP n 1 57 GLY n 1 58 GLY n 1 59 SER n 1 60 GLY n 1 61 ASP n 1 62 PRO n 1 63 ASN n 1 64 ALA n 1 65 LEU n 1 66 LEU n 1 67 LYS n 1 68 HIS n 1 69 ARG n 1 70 PHE n 1 71 GLU n 1 72 ILE n 1 73 ILE n 1 74 GLU n 1 75 GLY n 1 76 ARG n 1 77 ASP n 1 78 ARG n 1 79 ILE n 1 80 MET n 1 81 ALA n 1 82 TRP n 1 83 THR n 1 84 VAL n 1 85 VAL n 1 86 ASN n 1 87 SER n 1 88 ILE n 1 89 CYS n 1 90 ASN n 1 91 THR n 1 92 THR n 1 93 GLY n 1 94 VAL n 1 95 GLU n 1 96 LYS n 1 97 PRO n 1 98 LYS n 1 99 PHE n 1 100 LEU n 1 101 PRO n 1 102 ASP n 1 103 LEU n 1 104 TYR n 1 105 ASP n 1 106 TYR n 1 107 LYS n 1 108 GLU n 1 109 ASN n 1 110 ARG n 1 111 PHE n 1 112 ILE n 1 113 GLU n 1 114 ILE n 1 115 GLY n 1 116 VAL n 1 117 THR n 1 118 ARG n 1 119 ARG n 1 120 GLU n 1 121 VAL n 1 122 HIS n 1 123 ILE n 1 124 TYR n 1 125 TYR n 1 126 LEU n 1 127 GLU n 1 128 LYS n 1 129 ALA n 1 130 ASN n 1 131 LYS n 1 132 ILE n 1 133 LYS n 1 134 SER n 1 135 GLU n 1 136 LYS n 1 137 THR n 1 138 HIS n 1 139 ILE n 1 140 HIS n 1 141 ILE n 1 142 PHE n 1 143 SER n 1 144 PHE n 1 145 THR n 1 146 GLY n 1 147 GLU n 1 148 GLU n 1 149 MET n 1 150 ALA n 1 151 THR n 1 152 LYS n 1 153 ALA n 1 154 ASP n 1 155 TYR n 1 156 THR n 1 157 LEU n 1 158 ASP n 1 159 GLU n 1 160 GLU n 1 161 SER n 1 162 ARG n 1 163 ALA n 1 164 ARG n 1 165 ILE n 1 166 LYS n 1 167 THR n 1 168 ARG n 1 169 LEU n 1 170 PHE n 1 171 THR n 1 172 ILE n 1 173 ARG n 1 174 GLN n 1 175 GLU n 1 176 MET n 1 177 ALA n 1 178 SER n 1 179 ARG n 1 180 SER n 1 181 LEU n 1 182 TRP n 1 183 ASP n 1 184 SER n 1 185 PHE n 1 186 ARG n 1 187 GLN n 1 188 SER n 1 189 GLU n 1 190 ARG n 1 191 GLY n 1 192 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 192 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene PA _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Influenza A virus (A/California/04/2009(H1N1))' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 641501 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight A1CI4 non-polymer . '(6M)-3-hydroxy-6-[2-(methylsulfanyl)phenyl]-4-oxo-1,4-dihydropyridine-2-carboxylic acid' ? 'C13 H11 N O4 S' 277.296 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MN non-polymer . 'MANGANESE (II) ION' ? 'Mn 2' 54.938 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -5 ? ? ? A . n A 1 2 GLY 2 -4 ? ? ? A . n A 1 3 SER 3 -3 ? ? ? A . n A 1 4 GLY 4 -2 ? ? ? A . n A 1 5 SER 5 -1 -1 SER SER A . n A 1 6 ALA 6 0 0 ALA ALA A . n A 1 7 MET 7 1 1 MET MET A . n A 1 8 GLU 8 2 2 GLU GLU A . n A 1 9 ASP 9 3 3 ASP ASP A . n A 1 10 PHE 10 4 4 PHE PHE A . n A 1 11 VAL 11 5 5 VAL VAL A . n A 1 12 ARG 12 6 6 ARG ARG A . n A 1 13 GLN 13 7 7 GLN GLN A . n A 1 14 CYS 14 8 8 CYS CYS A . n A 1 15 PHE 15 9 9 PHE PHE A . n A 1 16 ASN 16 10 10 ASN ASN A . n A 1 17 PRO 17 11 11 PRO PRO A . n A 1 18 MET 18 12 12 MET MET A . n A 1 19 ILE 19 13 13 ILE ILE A . n A 1 20 VAL 20 14 14 VAL VAL A . n A 1 21 GLU 21 15 15 GLU GLU A . n A 1 22 LEU 22 16 16 LEU LEU A . n A 1 23 ALA 23 17 17 ALA ALA A . n A 1 24 GLU 24 18 18 GLU GLU A . n A 1 25 LYS 25 19 19 LYS LYS A . n A 1 26 ALA 26 20 20 ALA ALA A . n A 1 27 MET 27 21 21 MET MET A . n A 1 28 LYS 28 22 22 LYS LYS A . n A 1 29 GLU 29 23 23 GLU GLU A . n A 1 30 TYR 30 24 24 TYR TYR A . n A 1 31 GLY 31 25 25 GLY GLY A . n A 1 32 GLU 32 26 26 GLU GLU A . n A 1 33 ASP 33 27 27 ASP ASP A . n A 1 34 PRO 34 28 28 PRO PRO A . n A 1 35 LYS 35 29 29 LYS LYS A . n A 1 36 ILE 36 30 30 ILE ILE A . n A 1 37 GLU 37 31 31 GLU GLU A . n A 1 38 THR 38 32 32 THR THR A . n A 1 39 ASN 39 33 33 ASN ASN A . n A 1 40 LYS 40 34 34 LYS LYS A . n A 1 41 PHE 41 35 35 PHE PHE A . n A 1 42 ALA 42 36 36 ALA ALA A . n A 1 43 ALA 43 37 37 ALA ALA A . n A 1 44 ILE 44 38 38 ILE ILE A . n A 1 45 CYS 45 39 39 CYS CYS A . n A 1 46 THR 46 40 40 THR THR A . n A 1 47 HIS 47 41 41 HIS HIS A . n A 1 48 LEU 48 42 42 LEU LEU A . n A 1 49 GLU 49 43 43 GLU GLU A . n A 1 50 VAL 50 44 44 VAL VAL A . n A 1 51 CYS 51 45 45 CYS CYS A . n A 1 52 PHE 52 46 46 PHE PHE A . n A 1 53 MET 53 47 47 MET MET A . n A 1 54 TYR 54 48 48 TYR TYR A . n A 1 55 SER 55 49 49 SER SER A . n A 1 56 ASP 56 50 50 ASP ASP A . n A 1 57 GLY 57 51 51 GLY GLY A . n A 1 58 GLY 58 52 52 GLY GLY A . n A 1 59 SER 59 65 ? ? ? A . n A 1 60 GLY 60 66 ? ? ? A . n A 1 61 ASP 61 67 ? ? ? A . n A 1 62 PRO 62 68 ? ? ? A . n A 1 63 ASN 63 69 ? ? ? A . n A 1 64 ALA 64 70 ? ? ? A . n A 1 65 LEU 65 71 ? ? ? A . n A 1 66 LEU 66 72 ? ? ? A . n A 1 67 LYS 67 73 73 LYS LYS A . n A 1 68 HIS 68 74 74 HIS HIS A . n A 1 69 ARG 69 75 75 ARG ARG A . n A 1 70 PHE 70 76 76 PHE PHE A . n A 1 71 GLU 71 77 77 GLU GLU A . n A 1 72 ILE 72 78 78 ILE ILE A . n A 1 73 ILE 73 79 79 ILE ILE A . n A 1 74 GLU 74 80 80 GLU GLU A . n A 1 75 GLY 75 81 81 GLY GLY A . n A 1 76 ARG 76 82 82 ARG ARG A . n A 1 77 ASP 77 83 83 ASP ASP A . n A 1 78 ARG 78 84 84 ARG ARG A . n A 1 79 ILE 79 85 85 ILE ILE A . n A 1 80 MET 80 86 86 MET MET A . n A 1 81 ALA 81 87 87 ALA ALA A . n A 1 82 TRP 82 88 88 TRP TRP A . n A 1 83 THR 83 89 89 THR THR A . n A 1 84 VAL 84 90 90 VAL VAL A . n A 1 85 VAL 85 91 91 VAL VAL A . n A 1 86 ASN 86 92 92 ASN ASN A . n A 1 87 SER 87 93 93 SER SER A . n A 1 88 ILE 88 94 94 ILE ILE A . n A 1 89 CYS 89 95 95 CYS CYS A . n A 1 90 ASN 90 96 96 ASN ASN A . n A 1 91 THR 91 97 97 THR THR A . n A 1 92 THR 92 98 98 THR THR A . n A 1 93 GLY 93 99 99 GLY GLY A . n A 1 94 VAL 94 100 100 VAL VAL A . n A 1 95 GLU 95 101 101 GLU GLU A . n A 1 96 LYS 96 102 102 LYS LYS A . n A 1 97 PRO 97 103 103 PRO PRO A . n A 1 98 LYS 98 104 104 LYS LYS A . n A 1 99 PHE 99 105 105 PHE PHE A . n A 1 100 LEU 100 106 106 LEU LEU A . n A 1 101 PRO 101 107 107 PRO PRO A . n A 1 102 ASP 102 108 108 ASP ASP A . n A 1 103 LEU 103 109 109 LEU LEU A . n A 1 104 TYR 104 110 110 TYR TYR A . n A 1 105 ASP 105 111 111 ASP ASP A . n A 1 106 TYR 106 112 112 TYR TYR A . n A 1 107 LYS 107 113 113 LYS LYS A . n A 1 108 GLU 108 114 114 GLU GLU A . n A 1 109 ASN 109 115 115 ASN ASN A . n A 1 110 ARG 110 116 116 ARG ARG A . n A 1 111 PHE 111 117 117 PHE PHE A . n A 1 112 ILE 112 118 118 ILE ILE A . n A 1 113 GLU 113 119 119 GLU GLU A . n A 1 114 ILE 114 120 120 ILE ILE A . n A 1 115 GLY 115 121 121 GLY GLY A . n A 1 116 VAL 116 122 122 VAL VAL A . n A 1 117 THR 117 123 123 THR THR A . n A 1 118 ARG 118 124 124 ARG ARG A . n A 1 119 ARG 119 125 125 ARG ARG A . n A 1 120 GLU 120 126 126 GLU GLU A . n A 1 121 VAL 121 127 127 VAL VAL A . n A 1 122 HIS 122 128 128 HIS HIS A . n A 1 123 ILE 123 129 129 ILE ILE A . n A 1 124 TYR 124 130 130 TYR TYR A . n A 1 125 TYR 125 131 131 TYR TYR A . n A 1 126 LEU 126 132 132 LEU LEU A . n A 1 127 GLU 127 133 133 GLU GLU A . n A 1 128 LYS 128 134 134 LYS LYS A . n A 1 129 ALA 129 135 135 ALA ALA A . n A 1 130 ASN 130 136 136 ASN ASN A . n A 1 131 LYS 131 137 137 LYS LYS A . n A 1 132 ILE 132 138 138 ILE ILE A . n A 1 133 LYS 133 139 139 LYS LYS A . n A 1 134 SER 134 140 140 SER SER A . n A 1 135 GLU 135 141 141 GLU GLU A . n A 1 136 LYS 136 142 142 LYS LYS A . n A 1 137 THR 137 143 143 THR THR A . n A 1 138 HIS 138 144 144 HIS HIS A . n A 1 139 ILE 139 145 145 ILE ILE A . n A 1 140 HIS 140 146 146 HIS HIS A . n A 1 141 ILE 141 147 147 ILE ILE A . n A 1 142 PHE 142 148 148 PHE PHE A . n A 1 143 SER 143 149 149 SER SER A . n A 1 144 PHE 144 150 150 PHE PHE A . n A 1 145 THR 145 151 151 THR THR A . n A 1 146 GLY 146 152 152 GLY GLY A . n A 1 147 GLU 147 153 153 GLU GLU A . n A 1 148 GLU 148 154 154 GLU GLU A . n A 1 149 MET 149 155 155 MET MET A . n A 1 150 ALA 150 156 156 ALA ALA A . n A 1 151 THR 151 157 157 THR THR A . n A 1 152 LYS 152 158 158 LYS LYS A . n A 1 153 ALA 153 159 159 ALA ALA A . n A 1 154 ASP 154 160 160 ASP ASP A . n A 1 155 TYR 155 161 161 TYR TYR A . n A 1 156 THR 156 162 162 THR THR A . n A 1 157 LEU 157 163 163 LEU LEU A . n A 1 158 ASP 158 164 164 ASP ASP A . n A 1 159 GLU 159 165 165 GLU GLU A . n A 1 160 GLU 160 166 166 GLU GLU A . n A 1 161 SER 161 167 167 SER SER A . n A 1 162 ARG 162 168 168 ARG ARG A . n A 1 163 ALA 163 169 169 ALA ALA A . n A 1 164 ARG 164 170 170 ARG ARG A . n A 1 165 ILE 165 171 171 ILE ILE A . n A 1 166 LYS 166 172 172 LYS LYS A . n A 1 167 THR 167 173 173 THR THR A . n A 1 168 ARG 168 174 174 ARG ARG A . n A 1 169 LEU 169 175 175 LEU LEU A . n A 1 170 PHE 170 176 176 PHE PHE A . n A 1 171 THR 171 177 177 THR THR A . n A 1 172 ILE 172 178 178 ILE ILE A . n A 1 173 ARG 173 179 179 ARG ARG A . n A 1 174 GLN 174 180 180 GLN GLN A . n A 1 175 GLU 175 181 181 GLU GLU A . n A 1 176 MET 176 182 182 MET MET A . n A 1 177 ALA 177 183 183 ALA ALA A . n A 1 178 SER 178 184 184 SER SER A . n A 1 179 ARG 179 185 185 ARG ARG A . n A 1 180 SER 180 186 186 SER SER A . n A 1 181 LEU 181 187 187 LEU LEU A . n A 1 182 TRP 182 188 188 TRP TRP A . n A 1 183 ASP 183 189 189 ASP ASP A . n A 1 184 SER 184 190 190 SER SER A . n A 1 185 PHE 185 191 191 PHE PHE A . n A 1 186 ARG 186 192 192 ARG ARG A . n A 1 187 GLN 187 193 193 GLN GLN A . n A 1 188 SER 188 194 194 SER SER A . n A 1 189 GLU 189 195 195 GLU GLU A . n A 1 190 ARG 190 196 196 ARG ARG A . n A 1 191 GLY 191 197 197 GLY GLY A . n A 1 192 GLU 192 198 198 GLU GLU A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id A1CI4 _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id A1CI4 _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MN 1 301 301 MN MN A . C 2 MN 1 302 302 MN MN A . D 3 A1CI4 1 303 303 A1CI4 LIG A . E 4 HOH 1 401 3 HOH HOH A . E 4 HOH 2 402 9 HOH HOH A . E 4 HOH 3 403 1 HOH HOH A . E 4 HOH 4 404 5 HOH HOH A . E 4 HOH 5 405 7 HOH HOH A . E 4 HOH 6 406 2 HOH HOH A . E 4 HOH 7 407 8 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.21.2_5419 ? 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . ? 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . ? 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . ? 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 9PNM _cell.details ? _cell.formula_units_Z ? _cell.length_a 75.194 _cell.length_a_esd ? _cell.length_b 75.194 _cell.length_b_esd ? _cell.length_c 119.641 _cell.length_c_esd ? _cell.volume 585837.330 _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9PNM _symmetry.cell_setting ? _symmetry.Int_Tables_number 180 _symmetry.space_group_name_Hall 'P 62 2 (x,y,z+1/3)' _symmetry.space_group_name_H-M 'P 62 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9PNM _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.17 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 43.39 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '32% PEG4000, 100 mM Tris, pH 8.35, 220 mM sodium acetate' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 S 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2022-11-09 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ALS BEAMLINE 8.3.1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 8.3.1 _diffrn_source.pdbx_synchrotron_site ALS # _reflns.B_iso_Wilson_estimate 58.35 _reflns.entry_id 9PNM _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.14 _reflns.d_resolution_low 65.12 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 20857 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 18.7 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 28 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1.00 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.14 _reflns_shell.d_res_low 2.20 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1438 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.892 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 71.83 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9PNM _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.14 _refine.ls_d_res_low 65.12 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 20857 _refine.ls_number_reflns_R_free 2073 _refine.ls_number_reflns_R_work 18784 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.85 _refine.ls_percent_reflns_R_free 9.94 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2299 _refine.ls_R_factor_R_free 0.2741 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2250 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.36 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 30.5621 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3359 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.14 _refine_hist.d_res_low 65.12 _refine_hist.number_atoms_solvent 7 _refine_hist.number_atoms_total 1515 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1487 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 21 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0036 ? 1536 ? f_bond_d ? ? ? 'X-RAY DIFFRACTION' ? 0.6203 ? 2060 ? f_angle_d ? ? ? 'X-RAY DIFFRACTION' ? 0.0406 ? 215 ? f_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.0051 ? 264 ? f_plane_restr ? ? ? 'X-RAY DIFFRACTION' ? 19.6972 ? 581 ? f_dihedral_angle_d ? ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.14 2.19 . . 134 1222 99.27 . . . . 0.3350 . . . . . . . . . . . . . . . 0.3700 'X-RAY DIFFRACTION' 2.19 2.24 . . 136 1260 99.86 . . . . 0.2967 . . . . . . . . . . . . . . . 0.3621 'X-RAY DIFFRACTION' 2.24 2.31 . . 136 1261 100.00 . . . . 0.2908 . . . . . . . . . . . . . . . 0.3095 'X-RAY DIFFRACTION' 2.31 2.37 . . 137 1259 99.79 . . . . 0.2894 . . . . . . . . . . . . . . . 0.3135 'X-RAY DIFFRACTION' 2.37 2.45 . . 141 1234 99.78 . . . . 0.3102 . . . . . . . . . . . . . . . 0.2965 'X-RAY DIFFRACTION' 2.45 2.54 . . 142 1242 99.78 . . . . 0.3160 . . . . . . . . . . . . . . . 0.4041 'X-RAY DIFFRACTION' 2.54 2.64 . . 136 1265 99.79 . . . . 0.3144 . . . . . . . . . . . . . . . 0.4046 'X-RAY DIFFRACTION' 2.64 2.76 . . 143 1257 99.93 . . . . 0.2939 . . . . . . . . . . . . . . . 0.2821 'X-RAY DIFFRACTION' 2.76 2.90 . . 138 1254 99.86 . . . . 0.2645 . . . . . . . . . . . . . . . 0.3294 'X-RAY DIFFRACTION' 2.90 3.09 . . 141 1238 99.86 . . . . 0.2752 . . . . . . . . . . . . . . . 0.2996 'X-RAY DIFFRACTION' 3.09 3.32 . . 139 1257 100.00 . . . . 0.2549 . . . . . . . . . . . . . . . 0.3224 'X-RAY DIFFRACTION' 3.32 3.66 . . 140 1244 100.00 . . . . 0.2014 . . . . . . . . . . . . . . . 0.2772 'X-RAY DIFFRACTION' 3.66 4.19 . . 134 1274 100.00 . . . . 0.1888 . . . . . . . . . . . . . . . 0.2688 'X-RAY DIFFRACTION' 4.19 5.28 . . 142 1244 100.00 . . . . 0.1841 . . . . . . . . . . . . . . . 0.2083 'X-RAY DIFFRACTION' 5.28 65.12 . . 134 1273 99.86 . . . . 0.2054 . . . . . . . . . . . . . . . 0.2433 # _struct.entry_id 9PNM _struct.title ;Influenza PA-N Endonuclease I38T with compound 3 ((6M)-3-hydroxy-6-[2-(methylsulfanyl)phenyl]-4-oxo-1,4-dihydropyridine-2-carboxylic acid) ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9PNM _struct_keywords.text 'Metal binding protein, endonuclease, influenza endonuclease, LYASE' _struct_keywords.pdbx_keywords LYASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code C3W5S0_I09A0 _struct_ref.pdbx_db_accession C3W5S0 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGESIIVESGDPNALLKHRFEIIE GRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKAD YTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERGE ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9PNM _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 7 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 192 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession C3W5S0 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 198 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 198 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9PNM MET A 1 ? UNP C3W5S0 ? ? 'expression tag' -5 1 1 9PNM GLY A 2 ? UNP C3W5S0 ? ? 'expression tag' -4 2 1 9PNM SER A 3 ? UNP C3W5S0 ? ? 'expression tag' -3 3 1 9PNM GLY A 4 ? UNP C3W5S0 ? ? 'expression tag' -2 4 1 9PNM SER A 5 ? UNP C3W5S0 ? ? 'expression tag' -1 5 1 9PNM ALA A 6 ? UNP C3W5S0 ? ? 'expression tag' 0 6 1 9PNM GLY A 57 ? UNP C3W5S0 PHE 51 conflict 51 7 1 9PNM ? A ? ? UNP C3W5S0 HIS 52 deletion ? 8 1 9PNM ? A ? ? UNP C3W5S0 PHE 53 deletion ? 9 1 9PNM ? A ? ? UNP C3W5S0 ILE 54 deletion ? 10 1 9PNM ? A ? ? UNP C3W5S0 ASP 55 deletion ? 11 1 9PNM ? A ? ? UNP C3W5S0 GLU 56 deletion ? 12 1 9PNM ? A ? ? UNP C3W5S0 ARG 57 deletion ? 13 1 9PNM ? A ? ? UNP C3W5S0 GLY 58 deletion ? 14 1 9PNM ? A ? ? UNP C3W5S0 GLU 59 deletion ? 15 1 9PNM ? A ? ? UNP C3W5S0 SER 60 deletion ? 16 1 9PNM ? A ? ? UNP C3W5S0 ILE 61 deletion ? 17 1 9PNM ? A ? ? UNP C3W5S0 ILE 62 deletion ? 18 1 9PNM ? A ? ? UNP C3W5S0 VAL 63 deletion ? 19 1 9PNM GLY A 58 ? UNP C3W5S0 GLU 64 conflict 52 20 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 150 ? 1 MORE -7 ? 1 'SSA (A^2)' 9180 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 5 ? PHE A 15 ? SER A -1 PHE A 9 1 ? 11 HELX_P HELX_P2 AA2 ASN A 16 ? GLY A 31 ? ASN A 10 GLY A 25 1 ? 16 HELX_P HELX_P3 AA3 GLU A 37 ? GLY A 57 ? GLU A 31 GLY A 51 1 ? 21 HELX_P HELX_P4 AA4 ASP A 77 ? GLY A 93 ? ASP A 83 GLY A 99 1 ? 17 HELX_P HELX_P5 AA5 GLU A 120 ? LYS A 133 ? GLU A 126 LYS A 139 1 ? 14 HELX_P HELX_P6 AA6 LYS A 152 ? ASP A 154 ? LYS A 158 ASP A 160 5 ? 3 HELX_P HELX_P7 AA7 ASP A 158 ? ARG A 179 ? ASP A 164 ARG A 185 1 ? 22 HELX_P HELX_P8 AA8 LEU A 181 ? SER A 188 ? LEU A 187 SER A 194 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 47 NE2 ? ? ? 1_555 B MN . MN ? ? A HIS 41 A MN 301 1_555 ? ? ? ? ? ? ? 2.356 ? ? metalc2 metalc ? ? A GLU 74 OE1 ? ? ? 1_555 C MN . MN ? ? A GLU 80 A MN 302 1_555 ? ? ? ? ? ? ? 2.020 ? ? metalc3 metalc ? ? A ASP 102 OD2 ? ? ? 1_555 B MN . MN ? ? A ASP 108 A MN 301 1_555 ? ? ? ? ? ? ? 2.059 ? ? metalc4 metalc ? ? A ASP 102 OD1 ? ? ? 1_555 C MN . MN ? ? A ASP 108 A MN 302 1_555 ? ? ? ? ? ? ? 2.258 ? ? metalc5 metalc ? ? A GLU 113 OE2 ? ? ? 1_555 B MN . MN ? ? A GLU 119 A MN 301 1_555 ? ? ? ? ? ? ? 2.185 ? ? metalc6 metalc ? ? A ILE 114 O ? ? ? 1_555 B MN . MN ? ? A ILE 120 A MN 301 1_555 ? ? ? ? ? ? ? 2.123 ? ? metalc7 metalc ? ? B MN . MN ? ? ? 1_555 D A1CI4 . O19 ? ? A MN 301 A A1CI4 303 1_555 ? ? ? ? ? ? ? 2.308 ? ? metalc8 metalc ? ? B MN . MN ? ? ? 1_555 D A1CI4 . O01 ? ? A MN 301 A A1CI4 303 1_555 ? ? ? ? ? ? ? 2.554 ? ? metalc9 metalc ? ? C MN . MN ? ? ? 1_555 D A1CI4 . O17 ? ? A MN 302 A A1CI4 303 1_555 ? ? ? ? ? ? ? 2.289 ? ? metalc10 metalc ? ? C MN . MN ? ? ? 1_555 D A1CI4 . O19 ? ? A MN 302 A A1CI4 303 1_555 ? ? ? ? ? ? ? 2.288 ? ? metalc11 metalc ? ? C MN . MN ? ? ? 1_555 E HOH . O ? ? A MN 302 A HOH 401 1_555 ? ? ? ? ? ? ? 2.738 ? ? metalc12 metalc ? ? C MN . MN ? ? ? 1_555 E HOH . O ? ? A MN 302 A HOH 406 1_555 ? ? ? ? ? ? ? 2.274 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 47 ? A HIS 41 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 OD2 ? A ASP 102 ? A ASP 108 ? 1_555 92.8 ? 2 NE2 ? A HIS 47 ? A HIS 41 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 OE2 ? A GLU 113 ? A GLU 119 ? 1_555 170.4 ? 3 OD2 ? A ASP 102 ? A ASP 108 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 OE2 ? A GLU 113 ? A GLU 119 ? 1_555 89.8 ? 4 NE2 ? A HIS 47 ? A HIS 41 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O ? A ILE 114 ? A ILE 120 ? 1_555 84.6 ? 5 OD2 ? A ASP 102 ? A ASP 108 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O ? A ILE 114 ? A ILE 120 ? 1_555 87.8 ? 6 OE2 ? A GLU 113 ? A GLU 119 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O ? A ILE 114 ? A ILE 120 ? 1_555 86.3 ? 7 NE2 ? A HIS 47 ? A HIS 41 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O19 ? D A1CI4 . ? A A1CI4 303 ? 1_555 107.2 ? 8 OD2 ? A ASP 102 ? A ASP 108 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O19 ? D A1CI4 . ? A A1CI4 303 ? 1_555 109.7 ? 9 OE2 ? A GLU 113 ? A GLU 119 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O19 ? D A1CI4 . ? A A1CI4 303 ? 1_555 80.5 ? 10 O ? A ILE 114 ? A ILE 120 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O19 ? D A1CI4 . ? A A1CI4 303 ? 1_555 157.9 ? 11 NE2 ? A HIS 47 ? A HIS 41 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O01 ? D A1CI4 . ? A A1CI4 303 ? 1_555 85.9 ? 12 OD2 ? A ASP 102 ? A ASP 108 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O01 ? D A1CI4 . ? A A1CI4 303 ? 1_555 177.9 ? 13 OE2 ? A GLU 113 ? A GLU 119 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O01 ? D A1CI4 . ? A A1CI4 303 ? 1_555 91.8 ? 14 O ? A ILE 114 ? A ILE 120 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O01 ? D A1CI4 . ? A A1CI4 303 ? 1_555 93.7 ? 15 O19 ? D A1CI4 . ? A A1CI4 303 ? 1_555 MN ? B MN . ? A MN 301 ? 1_555 O01 ? D A1CI4 . ? A A1CI4 303 ? 1_555 69.2 ? 16 OE1 ? A GLU 74 ? A GLU 80 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 OD1 ? A ASP 102 ? A ASP 108 ? 1_555 89.0 ? 17 OE1 ? A GLU 74 ? A GLU 80 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O17 ? D A1CI4 . ? A A1CI4 303 ? 1_555 123.9 ? 18 OD1 ? A ASP 102 ? A ASP 108 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O17 ? D A1CI4 . ? A A1CI4 303 ? 1_555 146.9 ? 19 OE1 ? A GLU 74 ? A GLU 80 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O19 ? D A1CI4 . ? A A1CI4 303 ? 1_555 126.0 ? 20 OD1 ? A ASP 102 ? A ASP 108 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O19 ? D A1CI4 . ? A A1CI4 303 ? 1_555 91.0 ? 21 O17 ? D A1CI4 . ? A A1CI4 303 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O19 ? D A1CI4 . ? A A1CI4 303 ? 1_555 73.1 ? 22 OE1 ? A GLU 74 ? A GLU 80 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O ? E HOH . ? A HOH 401 ? 1_555 156.4 ? 23 OD1 ? A ASP 102 ? A ASP 108 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O ? E HOH . ? A HOH 401 ? 1_555 71.7 ? 24 O17 ? D A1CI4 . ? A A1CI4 303 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O ? E HOH . ? A HOH 401 ? 1_555 75.6 ? 25 O19 ? D A1CI4 . ? A A1CI4 303 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O ? E HOH . ? A HOH 401 ? 1_555 69.3 ? 26 OE1 ? A GLU 74 ? A GLU 80 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O ? E HOH . ? A HOH 406 ? 1_555 74.8 ? 27 OD1 ? A ASP 102 ? A ASP 108 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O ? E HOH . ? A HOH 406 ? 1_555 82.8 ? 28 O17 ? D A1CI4 . ? A A1CI4 303 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O ? E HOH . ? A HOH 406 ? 1_555 101.2 ? 29 O19 ? D A1CI4 . ? A A1CI4 303 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O ? E HOH . ? A HOH 406 ? 1_555 158.3 ? 30 O ? E HOH . ? A HOH 401 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O ? E HOH . ? A HOH 406 ? 1_555 89.0 ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel AA1 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 70 ? ILE A 72 ? PHE A 76 ILE A 78 AA1 2 LEU A 103 ? ASP A 105 ? LEU A 109 ASP A 111 AA1 3 ARG A 110 ? THR A 117 ? ARG A 116 THR A 123 AA1 4 HIS A 138 ? SER A 143 ? HIS A 144 SER A 149 AA1 5 GLU A 148 ? ALA A 150 ? GLU A 154 ALA A 156 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLU A 71 ? N GLU A 77 O TYR A 104 ? O TYR A 110 AA1 2 3 N ASP A 105 ? N ASP A 111 O ARG A 110 ? O ARG A 116 AA1 3 4 N GLY A 115 ? N GLY A 121 O PHE A 142 ? O PHE A 148 AA1 4 5 N ILE A 141 ? N ILE A 147 O MET A 149 ? O MET A 155 # _pdbx_entry_details.entry_id 9PNM _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification N # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OE1 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 GLU _pdbx_validate_close_contact.auth_seq_id_1 119 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 401 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.97 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 125 ? ? -104.08 -158.93 2 1 LYS A 139 ? ? 32.45 38.21 3 1 LYS A 158 ? ? 55.42 18.28 4 1 THR A 162 ? ? 68.18 -57.12 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x-y,x,z+1/3 3 y,-x+y,z+2/3 4 -y,x-y,z+2/3 5 -x+y,-x,z+1/3 6 x-y,-y,-z 7 -x,-x+y,-z+1/3 8 -x,-y,z 9 y,x,-z+2/3 10 -y,-x,-z+2/3 11 -x+y,y,-z 12 x,x-y,-z+1/3 # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 29.4102339697 7.35694218052 -20.5645119002 0.65230960401 ? -0.0137303947933 ? 0.0756957666787 ? 0.451035674729 ? -0.183076792155 ? 0.598345099578 ? 7.09579982245 ? 3.04877395956 ? -1.177283666 ? 5.48597171816 ? -1.5979751614 ? 8.53500398741 ? -0.219262217896 ? 0.930542998903 ? -0.818497490032 ? -0.0329364833192 ? 0.320725076832 ? 0.0857721624469 ? 0.301439794457 ? -0.287639987892 ? -0.224182694153 ? 2 'X-RAY DIFFRACTION' ? refined 14.9129219581 12.7109811756 -8.39344231276 0.709799563873 ? -0.0003900331714 ? 0.0352874566685 ? 0.428320760878 ? 0.0021086773504 ? 0.486919085236 ? 8.02943409202 ? 0.0884764856991 ? -1.04643166368 ? 1.90269934311 ? -0.774925150604 ? 1.01083728847 ? 0.0032516141867 ? -0.423370047324 ? -0.661217146169 ? 0.161097805987 ? 0.00459470290339 ? 0.193067058343 ? -0.00319669908986 ? -0.0797820465145 ? 0.00632618052368 ? 3 'X-RAY DIFFRACTION' ? refined 27.445286865 19.4703827717 -5.50471823415 0.665916268426 ? -0.0383982050431 ? 0.0477306527699 ? 0.309464564429 ? -0.0406349071466 ? 0.419679359557 ? 6.94392604384 ? 0.19925984313 ? -0.228259855867 ? 1.37522901054 ? -0.830153253262 ? 2.08792019619 ? 0.0641259197572 ? -0.00622365704814 ? 0.365270174766 ? 0.161790002434 ? -0.00182740357964 ? 0.150506233165 ? -0.0586795686693 ? -0.114654241952 ? -0.0487428149199 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 A 1 A -1 ? A 33 A 31 ? ? ;chain 'A' and (resid -1 through 31 ) ; 2 'X-RAY DIFFRACTION' 2 A 34 A 32 ? A 108 A 126 ? ? ;chain 'A' and (resid 32 through 126 ) ; 3 'X-RAY DIFFRACTION' 3 A 109 A 127 ? A 180 A 198 ? ? ;chain 'A' and (resid 127 through 198 ) ; # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -5 ? A MET 1 2 1 Y 1 A GLY -4 ? A GLY 2 3 1 Y 1 A SER -3 ? A SER 3 4 1 Y 1 A GLY -2 ? A GLY 4 5 1 Y 1 A SER 65 ? A SER 59 6 1 Y 1 A GLY 66 ? A GLY 60 7 1 Y 1 A ASP 67 ? A ASP 61 8 1 Y 1 A PRO 68 ? A PRO 62 9 1 Y 1 A ASN 69 ? A ASN 63 10 1 Y 1 A ALA 70 ? A ALA 64 11 1 Y 1 A LEU 71 ? A LEU 65 12 1 Y 1 A LEU 72 ? A LEU 66 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal A1CI4 C10 C Y N 1 A1CI4 C15 C N N 2 A1CI4 C02 C N N 3 A1CI4 C03 C N N 4 A1CI4 C04 C N N 5 A1CI4 C05 C Y N 6 A1CI4 C06 C Y N 7 A1CI4 C07 C Y N 8 A1CI4 C08 C Y N 9 A1CI4 C09 C Y N 10 A1CI4 C12 C N N 11 A1CI4 C14 C N N 12 A1CI4 C18 C N N 13 A1CI4 N13 N N N 14 A1CI4 O01 O N N 15 A1CI4 O16 O N N 16 A1CI4 O17 O N N 17 A1CI4 O19 O N N 18 A1CI4 S11 S N N 19 A1CI4 H031 H N N 20 A1CI4 H061 H N N 21 A1CI4 H071 H N N 22 A1CI4 H081 H N N 23 A1CI4 H091 H N N 24 A1CI4 H123 H N N 25 A1CI4 H122 H N N 26 A1CI4 H121 H N N 27 A1CI4 H131 H N N 28 A1CI4 H1 H N N 29 A1CI4 H191 H N N 30 ALA N N N N 31 ALA CA C N S 32 ALA C C N N 33 ALA O O N N 34 ALA CB C N N 35 ALA OXT O N N 36 ALA H H N N 37 ALA H2 H N N 38 ALA HA H N N 39 ALA HB1 H N N 40 ALA HB2 H N N 41 ALA HB3 H N N 42 ALA HXT H N N 43 ARG N N N N 44 ARG CA C N S 45 ARG C C N N 46 ARG O O N N 47 ARG CB C N N 48 ARG CG C N N 49 ARG CD C N N 50 ARG NE N N N 51 ARG CZ C N N 52 ARG NH1 N N N 53 ARG NH2 N N N 54 ARG OXT O N N 55 ARG H H N N 56 ARG H2 H N N 57 ARG HA H N N 58 ARG HB2 H N N 59 ARG HB3 H N N 60 ARG HG2 H N N 61 ARG HG3 H N N 62 ARG HD2 H N N 63 ARG HD3 H N N 64 ARG HE H N N 65 ARG HH11 H N N 66 ARG HH12 H N N 67 ARG HH21 H N N 68 ARG HH22 H N N 69 ARG HXT H N N 70 ASN N N N N 71 ASN CA C N S 72 ASN C C N N 73 ASN O O N N 74 ASN CB C N N 75 ASN CG C N N 76 ASN OD1 O N N 77 ASN ND2 N N N 78 ASN OXT O N N 79 ASN H H N N 80 ASN H2 H N N 81 ASN HA H N N 82 ASN HB2 H N N 83 ASN HB3 H N N 84 ASN HD21 H N N 85 ASN HD22 H N N 86 ASN HXT H N N 87 ASP N N N N 88 ASP CA C N S 89 ASP C C N N 90 ASP O O N N 91 ASP CB C N N 92 ASP CG C N N 93 ASP OD1 O N N 94 ASP OD2 O N N 95 ASP OXT O N N 96 ASP H H N N 97 ASP H2 H N N 98 ASP HA H N N 99 ASP HB2 H N N 100 ASP HB3 H N N 101 ASP HD2 H N N 102 ASP HXT H N N 103 CYS N N N N 104 CYS CA C N R 105 CYS C C N N 106 CYS O O N N 107 CYS CB C N N 108 CYS SG S N N 109 CYS OXT O N N 110 CYS H H N N 111 CYS H2 H N N 112 CYS HA H N N 113 CYS HB2 H N N 114 CYS HB3 H N N 115 CYS HG H N N 116 CYS HXT H N N 117 GLN N N N N 118 GLN CA C N S 119 GLN C C N N 120 GLN O O N N 121 GLN CB C N N 122 GLN CG C N N 123 GLN CD C N N 124 GLN OE1 O N N 125 GLN NE2 N N N 126 GLN OXT O N N 127 GLN H H N N 128 GLN H2 H N N 129 GLN HA H N N 130 GLN HB2 H N N 131 GLN HB3 H N N 132 GLN HG2 H N N 133 GLN HG3 H N N 134 GLN HE21 H N N 135 GLN HE22 H N N 136 GLN HXT H N N 137 GLU N N N N 138 GLU CA C N S 139 GLU C C N N 140 GLU O O N N 141 GLU CB C N N 142 GLU CG C N N 143 GLU CD C N N 144 GLU OE1 O N N 145 GLU OE2 O N N 146 GLU OXT O N N 147 GLU H H N N 148 GLU H2 H N N 149 GLU HA H N N 150 GLU HB2 H N N 151 GLU HB3 H N N 152 GLU HG2 H N N 153 GLU HG3 H N N 154 GLU HE2 H N N 155 GLU HXT H N N 156 GLY N N N N 157 GLY CA C N N 158 GLY C C N N 159 GLY O O N N 160 GLY OXT O N N 161 GLY H H N N 162 GLY H2 H N N 163 GLY HA2 H N N 164 GLY HA3 H N N 165 GLY HXT H N N 166 HIS N N N N 167 HIS CA C N S 168 HIS C C N N 169 HIS O O N N 170 HIS CB C N N 171 HIS CG C Y N 172 HIS ND1 N Y N 173 HIS CD2 C Y N 174 HIS CE1 C Y N 175 HIS NE2 N Y N 176 HIS OXT O N N 177 HIS H H N N 178 HIS H2 H N N 179 HIS HA H N N 180 HIS HB2 H N N 181 HIS HB3 H N N 182 HIS HD1 H N N 183 HIS HD2 H N N 184 HIS HE1 H N N 185 HIS HE2 H N N 186 HIS HXT H N N 187 HOH O O N N 188 HOH H1 H N N 189 HOH H2 H N N 190 ILE N N N N 191 ILE CA C N S 192 ILE C C N N 193 ILE O O N N 194 ILE CB C N S 195 ILE CG1 C N N 196 ILE CG2 C N N 197 ILE CD1 C N N 198 ILE OXT O N N 199 ILE H H N N 200 ILE H2 H N N 201 ILE HA H N N 202 ILE HB H N N 203 ILE HG12 H N N 204 ILE HG13 H N N 205 ILE HG21 H N N 206 ILE HG22 H N N 207 ILE HG23 H N N 208 ILE HD11 H N N 209 ILE HD12 H N N 210 ILE HD13 H N N 211 ILE HXT H N N 212 LEU N N N N 213 LEU CA C N S 214 LEU C C N N 215 LEU O O N N 216 LEU CB C N N 217 LEU CG C N N 218 LEU CD1 C N N 219 LEU CD2 C N N 220 LEU OXT O N N 221 LEU H H N N 222 LEU H2 H N N 223 LEU HA H N N 224 LEU HB2 H N N 225 LEU HB3 H N N 226 LEU HG H N N 227 LEU HD11 H N N 228 LEU HD12 H N N 229 LEU HD13 H N N 230 LEU HD21 H N N 231 LEU HD22 H N N 232 LEU HD23 H N N 233 LEU HXT H N N 234 LYS N N N N 235 LYS CA C N S 236 LYS C C N N 237 LYS O O N N 238 LYS CB C N N 239 LYS CG C N N 240 LYS CD C N N 241 LYS CE C N N 242 LYS NZ N N N 243 LYS OXT O N N 244 LYS H H N N 245 LYS H2 H N N 246 LYS HA H N N 247 LYS HB2 H N N 248 LYS HB3 H N N 249 LYS HG2 H N N 250 LYS HG3 H N N 251 LYS HD2 H N N 252 LYS HD3 H N N 253 LYS HE2 H N N 254 LYS HE3 H N N 255 LYS HZ1 H N N 256 LYS HZ2 H N N 257 LYS HZ3 H N N 258 LYS HXT H N N 259 MET N N N N 260 MET CA C N S 261 MET C C N N 262 MET O O N N 263 MET CB C N N 264 MET CG C N N 265 MET SD S N N 266 MET CE C N N 267 MET OXT O N N 268 MET H H N N 269 MET H2 H N N 270 MET HA H N N 271 MET HB2 H N N 272 MET HB3 H N N 273 MET HG2 H N N 274 MET HG3 H N N 275 MET HE1 H N N 276 MET HE2 H N N 277 MET HE3 H N N 278 MET HXT H N N 279 MN MN MN N N 280 PHE N N N N 281 PHE CA C N S 282 PHE C C N N 283 PHE O O N N 284 PHE CB C N N 285 PHE CG C Y N 286 PHE CD1 C Y N 287 PHE CD2 C Y N 288 PHE CE1 C Y N 289 PHE CE2 C Y N 290 PHE CZ C Y N 291 PHE OXT O N N 292 PHE H H N N 293 PHE H2 H N N 294 PHE HA H N N 295 PHE HB2 H N N 296 PHE HB3 H N N 297 PHE HD1 H N N 298 PHE HD2 H N N 299 PHE HE1 H N N 300 PHE HE2 H N N 301 PHE HZ H N N 302 PHE HXT H N N 303 PRO N N N N 304 PRO CA C N S 305 PRO C C N N 306 PRO O O N N 307 PRO CB C N N 308 PRO CG C N N 309 PRO CD C N N 310 PRO OXT O N N 311 PRO H H N N 312 PRO HA H N N 313 PRO HB2 H N N 314 PRO HB3 H N N 315 PRO HG2 H N N 316 PRO HG3 H N N 317 PRO HD2 H N N 318 PRO HD3 H N N 319 PRO HXT H N N 320 SER N N N N 321 SER CA C N S 322 SER C C N N 323 SER O O N N 324 SER CB C N N 325 SER OG O N N 326 SER OXT O N N 327 SER H H N N 328 SER H2 H N N 329 SER HA H N N 330 SER HB2 H N N 331 SER HB3 H N N 332 SER HG H N N 333 SER HXT H N N 334 THR N N N N 335 THR CA C N S 336 THR C C N N 337 THR O O N N 338 THR CB C N R 339 THR OG1 O N N 340 THR CG2 C N N 341 THR OXT O N N 342 THR H H N N 343 THR H2 H N N 344 THR HA H N N 345 THR HB H N N 346 THR HG1 H N N 347 THR HG21 H N N 348 THR HG22 H N N 349 THR HG23 H N N 350 THR HXT H N N 351 TRP N N N N 352 TRP CA C N S 353 TRP C C N N 354 TRP O O N N 355 TRP CB C N N 356 TRP CG C Y N 357 TRP CD1 C Y N 358 TRP CD2 C Y N 359 TRP NE1 N Y N 360 TRP CE2 C Y N 361 TRP CE3 C Y N 362 TRP CZ2 C Y N 363 TRP CZ3 C Y N 364 TRP CH2 C Y N 365 TRP OXT O N N 366 TRP H H N N 367 TRP H2 H N N 368 TRP HA H N N 369 TRP HB2 H N N 370 TRP HB3 H N N 371 TRP HD1 H N N 372 TRP HE1 H N N 373 TRP HE3 H N N 374 TRP HZ2 H N N 375 TRP HZ3 H N N 376 TRP HH2 H N N 377 TRP HXT H N N 378 TYR N N N N 379 TYR CA C N S 380 TYR C C N N 381 TYR O O N N 382 TYR CB C N N 383 TYR CG C Y N 384 TYR CD1 C Y N 385 TYR CD2 C Y N 386 TYR CE1 C Y N 387 TYR CE2 C Y N 388 TYR CZ C Y N 389 TYR OH O N N 390 TYR OXT O N N 391 TYR H H N N 392 TYR H2 H N N 393 TYR HA H N N 394 TYR HB2 H N N 395 TYR HB3 H N N 396 TYR HD1 H N N 397 TYR HD2 H N N 398 TYR HE1 H N N 399 TYR HE2 H N N 400 TYR HH H N N 401 TYR HXT H N N 402 VAL N N N N 403 VAL CA C N S 404 VAL C C N N 405 VAL O O N N 406 VAL CB C N N 407 VAL CG1 C N N 408 VAL CG2 C N N 409 VAL OXT O N N 410 VAL H H N N 411 VAL H2 H N N 412 VAL HA H N N 413 VAL HB H N N 414 VAL HG11 H N N 415 VAL HG12 H N N 416 VAL HG13 H N N 417 VAL HG21 H N N 418 VAL HG22 H N N 419 VAL HG23 H N N 420 VAL HXT H N N 421 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal A1CI4 C02 O01 doub N N 1 A1CI4 C03 C02 sing N N 2 A1CI4 C04 C03 doub N N 3 A1CI4 C06 C05 doub Y N 4 A1CI4 C07 C06 sing Y N 5 A1CI4 C08 C07 doub Y N 6 A1CI4 C09 C08 sing Y N 7 A1CI4 C10 C09 doub Y N 8 A1CI4 S11 C10 sing N N 9 A1CI4 C12 S11 sing N N 10 A1CI4 C05 C04 sing N N 11 A1CI4 N13 C04 sing N N 12 A1CI4 C14 N13 sing N N 13 A1CI4 O16 C15 sing N N 14 A1CI4 O17 C15 doub N N 15 A1CI4 C15 C14 sing N N 16 A1CI4 C18 C14 doub N N 17 A1CI4 O19 C18 sing N N 18 A1CI4 C02 C18 sing N N 19 A1CI4 C05 C10 sing Y N 20 A1CI4 C03 H031 sing N N 21 A1CI4 C06 H061 sing N N 22 A1CI4 C07 H071 sing N N 23 A1CI4 C08 H081 sing N N 24 A1CI4 C09 H091 sing N N 25 A1CI4 C12 H123 sing N N 26 A1CI4 C12 H122 sing N N 27 A1CI4 C12 H121 sing N N 28 A1CI4 N13 H131 sing N N 29 A1CI4 O16 H1 sing N N 30 A1CI4 O19 H191 sing N N 31 ALA N CA sing N N 32 ALA N H sing N N 33 ALA N H2 sing N N 34 ALA CA C sing N N 35 ALA CA CB sing N N 36 ALA CA HA sing N N 37 ALA C O doub N N 38 ALA C OXT sing N N 39 ALA CB HB1 sing N N 40 ALA CB HB2 sing N N 41 ALA CB HB3 sing N N 42 ALA OXT HXT sing N N 43 ARG N CA sing N N 44 ARG N H sing N N 45 ARG N H2 sing N N 46 ARG CA C sing N N 47 ARG CA CB sing N N 48 ARG CA HA sing N N 49 ARG C O doub N N 50 ARG C OXT sing N N 51 ARG CB CG sing N N 52 ARG CB HB2 sing N N 53 ARG CB HB3 sing N N 54 ARG CG CD sing N N 55 ARG CG HG2 sing N N 56 ARG CG HG3 sing N N 57 ARG CD NE sing N N 58 ARG CD HD2 sing N N 59 ARG CD HD3 sing N N 60 ARG NE CZ sing N N 61 ARG NE HE sing N N 62 ARG CZ NH1 sing N N 63 ARG CZ NH2 doub N N 64 ARG NH1 HH11 sing N N 65 ARG NH1 HH12 sing N N 66 ARG NH2 HH21 sing N N 67 ARG NH2 HH22 sing N N 68 ARG OXT HXT sing N N 69 ASN N CA sing N N 70 ASN N H sing N N 71 ASN N H2 sing N N 72 ASN CA C sing N N 73 ASN CA CB sing N N 74 ASN CA HA sing N N 75 ASN C O doub N N 76 ASN C OXT sing N N 77 ASN CB CG sing N N 78 ASN CB HB2 sing N N 79 ASN CB HB3 sing N N 80 ASN CG OD1 doub N N 81 ASN CG ND2 sing N N 82 ASN ND2 HD21 sing N N 83 ASN ND2 HD22 sing N N 84 ASN OXT HXT sing N N 85 ASP N CA sing N N 86 ASP N H sing N N 87 ASP N H2 sing N N 88 ASP CA C sing N N 89 ASP CA CB sing N N 90 ASP CA HA sing N N 91 ASP C O doub N N 92 ASP C OXT sing N N 93 ASP CB CG sing N N 94 ASP CB HB2 sing N N 95 ASP CB HB3 sing N N 96 ASP CG OD1 doub N N 97 ASP CG OD2 sing N N 98 ASP OD2 HD2 sing N N 99 ASP OXT HXT sing N N 100 CYS N CA sing N N 101 CYS N H sing N N 102 CYS N H2 sing N N 103 CYS CA C sing N N 104 CYS CA CB sing N N 105 CYS CA HA sing N N 106 CYS C O doub N N 107 CYS C OXT sing N N 108 CYS CB SG sing N N 109 CYS CB HB2 sing N N 110 CYS CB HB3 sing N N 111 CYS SG HG sing N N 112 CYS OXT HXT sing N N 113 GLN N CA sing N N 114 GLN N H sing N N 115 GLN N H2 sing N N 116 GLN CA C sing N N 117 GLN CA CB sing N N 118 GLN CA HA sing N N 119 GLN C O doub N N 120 GLN C OXT sing N N 121 GLN CB CG sing N N 122 GLN CB HB2 sing N N 123 GLN CB HB3 sing N N 124 GLN CG CD sing N N 125 GLN CG HG2 sing N N 126 GLN CG HG3 sing N N 127 GLN CD OE1 doub N N 128 GLN CD NE2 sing N N 129 GLN NE2 HE21 sing N N 130 GLN NE2 HE22 sing N N 131 GLN OXT HXT sing N N 132 GLU N CA sing N N 133 GLU N H sing N N 134 GLU N H2 sing N N 135 GLU CA C sing N N 136 GLU CA CB sing N N 137 GLU CA HA sing N N 138 GLU C O doub N N 139 GLU C OXT sing N N 140 GLU CB CG sing N N 141 GLU CB HB2 sing N N 142 GLU CB HB3 sing N N 143 GLU CG CD sing N N 144 GLU CG HG2 sing N N 145 GLU CG HG3 sing N N 146 GLU CD OE1 doub N N 147 GLU CD OE2 sing N N 148 GLU OE2 HE2 sing N N 149 GLU OXT HXT sing N N 150 GLY N CA sing N N 151 GLY N H sing N N 152 GLY N H2 sing N N 153 GLY CA C sing N N 154 GLY CA HA2 sing N N 155 GLY CA HA3 sing N N 156 GLY C O doub N N 157 GLY C OXT sing N N 158 GLY OXT HXT sing N N 159 HIS N CA sing N N 160 HIS N H sing N N 161 HIS N H2 sing N N 162 HIS CA C sing N N 163 HIS CA CB sing N N 164 HIS CA HA sing N N 165 HIS C O doub N N 166 HIS C OXT sing N N 167 HIS CB CG sing N N 168 HIS CB HB2 sing N N 169 HIS CB HB3 sing N N 170 HIS CG ND1 sing Y N 171 HIS CG CD2 doub Y N 172 HIS ND1 CE1 doub Y N 173 HIS ND1 HD1 sing N N 174 HIS CD2 NE2 sing Y N 175 HIS CD2 HD2 sing N N 176 HIS CE1 NE2 sing Y N 177 HIS CE1 HE1 sing N N 178 HIS NE2 HE2 sing N N 179 HIS OXT HXT sing N N 180 HOH O H1 sing N N 181 HOH O H2 sing N N 182 ILE N CA sing N N 183 ILE N H sing N N 184 ILE N H2 sing N N 185 ILE CA C sing N N 186 ILE CA CB sing N N 187 ILE CA HA sing N N 188 ILE C O doub N N 189 ILE C OXT sing N N 190 ILE CB CG1 sing N N 191 ILE CB CG2 sing N N 192 ILE CB HB sing N N 193 ILE CG1 CD1 sing N N 194 ILE CG1 HG12 sing N N 195 ILE CG1 HG13 sing N N 196 ILE CG2 HG21 sing N N 197 ILE CG2 HG22 sing N N 198 ILE CG2 HG23 sing N N 199 ILE CD1 HD11 sing N N 200 ILE CD1 HD12 sing N N 201 ILE CD1 HD13 sing N N 202 ILE OXT HXT sing N N 203 LEU N CA sing N N 204 LEU N H sing N N 205 LEU N H2 sing N N 206 LEU CA C sing N N 207 LEU CA CB sing N N 208 LEU CA HA sing N N 209 LEU C O doub N N 210 LEU C OXT sing N N 211 LEU CB CG sing N N 212 LEU CB HB2 sing N N 213 LEU CB HB3 sing N N 214 LEU CG CD1 sing N N 215 LEU CG CD2 sing N N 216 LEU CG HG sing N N 217 LEU CD1 HD11 sing N N 218 LEU CD1 HD12 sing N N 219 LEU CD1 HD13 sing N N 220 LEU CD2 HD21 sing N N 221 LEU CD2 HD22 sing N N 222 LEU CD2 HD23 sing N N 223 LEU OXT HXT sing N N 224 LYS N CA sing N N 225 LYS N H sing N N 226 LYS N H2 sing N N 227 LYS CA C sing N N 228 LYS CA CB sing N N 229 LYS CA HA sing N N 230 LYS C O doub N N 231 LYS C OXT sing N N 232 LYS CB CG sing N N 233 LYS CB HB2 sing N N 234 LYS CB HB3 sing N N 235 LYS CG CD sing N N 236 LYS CG HG2 sing N N 237 LYS CG HG3 sing N N 238 LYS CD CE sing N N 239 LYS CD HD2 sing N N 240 LYS CD HD3 sing N N 241 LYS CE NZ sing N N 242 LYS CE HE2 sing N N 243 LYS CE HE3 sing N N 244 LYS NZ HZ1 sing N N 245 LYS NZ HZ2 sing N N 246 LYS NZ HZ3 sing N N 247 LYS OXT HXT sing N N 248 MET N CA sing N N 249 MET N H sing N N 250 MET N H2 sing N N 251 MET CA C sing N N 252 MET CA CB sing N N 253 MET CA HA sing N N 254 MET C O doub N N 255 MET C OXT sing N N 256 MET CB CG sing N N 257 MET CB HB2 sing N N 258 MET CB HB3 sing N N 259 MET CG SD sing N N 260 MET CG HG2 sing N N 261 MET CG HG3 sing N N 262 MET SD CE sing N N 263 MET CE HE1 sing N N 264 MET CE HE2 sing N N 265 MET CE HE3 sing N N 266 MET OXT HXT sing N N 267 PHE N CA sing N N 268 PHE N H sing N N 269 PHE N H2 sing N N 270 PHE CA C sing N N 271 PHE CA CB sing N N 272 PHE CA HA sing N N 273 PHE C O doub N N 274 PHE C OXT sing N N 275 PHE CB CG sing N N 276 PHE CB HB2 sing N N 277 PHE CB HB3 sing N N 278 PHE CG CD1 doub Y N 279 PHE CG CD2 sing Y N 280 PHE CD1 CE1 sing Y N 281 PHE CD1 HD1 sing N N 282 PHE CD2 CE2 doub Y N 283 PHE CD2 HD2 sing N N 284 PHE CE1 CZ doub Y N 285 PHE CE1 HE1 sing N N 286 PHE CE2 CZ sing Y N 287 PHE CE2 HE2 sing N N 288 PHE CZ HZ sing N N 289 PHE OXT HXT sing N N 290 PRO N CA sing N N 291 PRO N CD sing N N 292 PRO N H sing N N 293 PRO CA C sing N N 294 PRO CA CB sing N N 295 PRO CA HA sing N N 296 PRO C O doub N N 297 PRO C OXT sing N N 298 PRO CB CG sing N N 299 PRO CB HB2 sing N N 300 PRO CB HB3 sing N N 301 PRO CG CD sing N N 302 PRO CG HG2 sing N N 303 PRO CG HG3 sing N N 304 PRO CD HD2 sing N N 305 PRO CD HD3 sing N N 306 PRO OXT HXT sing N N 307 SER N CA sing N N 308 SER N H sing N N 309 SER N H2 sing N N 310 SER CA C sing N N 311 SER CA CB sing N N 312 SER CA HA sing N N 313 SER C O doub N N 314 SER C OXT sing N N 315 SER CB OG sing N N 316 SER CB HB2 sing N N 317 SER CB HB3 sing N N 318 SER OG HG sing N N 319 SER OXT HXT sing N N 320 THR N CA sing N N 321 THR N H sing N N 322 THR N H2 sing N N 323 THR CA C sing N N 324 THR CA CB sing N N 325 THR CA HA sing N N 326 THR C O doub N N 327 THR C OXT sing N N 328 THR CB OG1 sing N N 329 THR CB CG2 sing N N 330 THR CB HB sing N N 331 THR OG1 HG1 sing N N 332 THR CG2 HG21 sing N N 333 THR CG2 HG22 sing N N 334 THR CG2 HG23 sing N N 335 THR OXT HXT sing N N 336 TRP N CA sing N N 337 TRP N H sing N N 338 TRP N H2 sing N N 339 TRP CA C sing N N 340 TRP CA CB sing N N 341 TRP CA HA sing N N 342 TRP C O doub N N 343 TRP C OXT sing N N 344 TRP CB CG sing N N 345 TRP CB HB2 sing N N 346 TRP CB HB3 sing N N 347 TRP CG CD1 doub Y N 348 TRP CG CD2 sing Y N 349 TRP CD1 NE1 sing Y N 350 TRP CD1 HD1 sing N N 351 TRP CD2 CE2 doub Y N 352 TRP CD2 CE3 sing Y N 353 TRP NE1 CE2 sing Y N 354 TRP NE1 HE1 sing N N 355 TRP CE2 CZ2 sing Y N 356 TRP CE3 CZ3 doub Y N 357 TRP CE3 HE3 sing N N 358 TRP CZ2 CH2 doub Y N 359 TRP CZ2 HZ2 sing N N 360 TRP CZ3 CH2 sing Y N 361 TRP CZ3 HZ3 sing N N 362 TRP CH2 HH2 sing N N 363 TRP OXT HXT sing N N 364 TYR N CA sing N N 365 TYR N H sing N N 366 TYR N H2 sing N N 367 TYR CA C sing N N 368 TYR CA CB sing N N 369 TYR CA HA sing N N 370 TYR C O doub N N 371 TYR C OXT sing N N 372 TYR CB CG sing N N 373 TYR CB HB2 sing N N 374 TYR CB HB3 sing N N 375 TYR CG CD1 doub Y N 376 TYR CG CD2 sing Y N 377 TYR CD1 CE1 sing Y N 378 TYR CD1 HD1 sing N N 379 TYR CD2 CE2 doub Y N 380 TYR CD2 HD2 sing N N 381 TYR CE1 CZ doub Y N 382 TYR CE1 HE1 sing N N 383 TYR CE2 CZ sing Y N 384 TYR CE2 HE2 sing N N 385 TYR CZ OH sing N N 386 TYR OH HH sing N N 387 TYR OXT HXT sing N N 388 VAL N CA sing N N 389 VAL N H sing N N 390 VAL N H2 sing N N 391 VAL CA C sing N N 392 VAL CA CB sing N N 393 VAL CA HA sing N N 394 VAL C O doub N N 395 VAL C OXT sing N N 396 VAL CB CG1 sing N N 397 VAL CB CG2 sing N N 398 VAL CB HB sing N N 399 VAL CG1 HG11 sing N N 400 VAL CG1 HG12 sing N N 401 VAL CG1 HG13 sing N N 402 VAL CG2 HG21 sing N N 403 VAL CG2 HG22 sing N N 404 VAL CG2 HG23 sing N N 405 VAL OXT HXT sing N N 406 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number 'R01 AI149444' _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 8T5Z _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'P 62 2 2' _space_group.name_Hall 'P 62 2 (x,y,z+1/3)' _space_group.IT_number 180 _space_group.crystal_system hexagonal _space_group.id 1 # _atom_sites.entry_id 9PNM _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.013299 _atom_sites.fract_transf_matrix[1][2] 0.007678 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015356 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008358 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? 0.51345 0.48472 ? ? 24.73122 6.32584 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? MN ? ? 20.23591 4.67902 ? ? 2.76514 44.01191 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O1- ? ? 5.12366 3.84317 ? ? 3.49406 27.47979 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ # loop_ #