data_9QAD # _entry.id 9QAD # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.404 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9QAD pdb_00009qad 10.2210/pdb9qad/pdb WWPDB D_1292140647 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2025-05-14 ? 2 'Structure model' 1 1 2025-05-21 ? 3 'Structure model' 1 2 2025-06-04 ? 4 'Structure model' 1 3 2025-07-02 ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Derived calculations' 3 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' pdbx_struct_assembly 4 3 'Structure model' pdbx_struct_assembly_gen 5 3 'Structure model' pdbx_struct_assembly_prop 6 4 'Structure model' citation # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.pdbx_database_id_DOI' 6 2 'Structure model' '_citation.title' 7 2 'Structure model' '_citation.year' 8 4 'Structure model' '_citation.journal_volume' 9 4 'Structure model' '_citation.page_first' 10 4 'Structure model' '_citation.page_last' 11 4 'Structure model' '_citation.pdbx_database_id_PubMed' 12 4 'Structure model' '_citation.title' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9QAD _pdbx_database_status.recvd_initial_deposition_date 2025-02-28 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible N # _pdbx_contact_author.id 2 _pdbx_contact_author.email marianne.schimpl@astrazeneca.com _pdbx_contact_author.name_first Marianne _pdbx_contact_author.name_last Schimpl _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-2284-5250 # _audit_author.name 'Schimpl, M.' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acs Med.Chem.Lett.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1948-5875 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 16 _citation.language ? _citation.page_first 1073 _citation.page_last 1079 _citation.title 'Discovery of Pyrimidoindolones as Novel Family VIII Bromodomain Binders.' _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acsmedchemlett.5c00120 _citation.pdbx_database_id_PubMed 40529061 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Boerth, J.A.' 1 ? primary 'Schimpl, M.' 2 ? primary 'Lucas, S.C.C.' 3 ? primary 'Zhang, J.' 4 ? primary 'Code, E.L.' 5 ? primary 'Embrey, K.J.' 6 ? primary 'Rawlins, P.B.' 7 ? primary 'Wang, H.' 8 ? primary 'Storer, R.I.' 9 ? primary 'Di Fruscia, P.' 10 ? primary 'Nelson, J.E.' 11 ? primary 'Milbradt, A.G.' 12 ? primary 'Borjesson, U.' 13 ? primary 'Gohlke, A.' 14 ? primary 'Korboukh, V.' 15 ? primary 'Gopalsamy, A.' 16 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Probable global transcription activator SNF2L2' 14380.542 3 3.6.4.- ? ? ? 2 non-polymer syn '5-oxidanyl-2-(phenylmethyl)-1,9-dihydropyrimido[4,5-b]indol-4-one' 291.304 3 ? ? ? ? 3 non-polymer syn 'ZINC ION' 65.409 3 ? ? ? ? 4 water nat water 18.015 40 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;ATP-dependent helicase SMARCA2,BRG1-associated factor 190B,BAF190B,Protein brahma homolog,hBRM,SNF2-alpha,SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 2 ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SMAEKLSPNPPKLTKQMNAIIDTVINYKDSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLGDLE KDVMLLCHNAQTFNLEGSQIYEDSIVLQSVFKSARQKIAKEEE ; _entity_poly.pdbx_seq_one_letter_code_can ;SMAEKLSPNPPKLTKQMNAIIDTVINYKDSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLGDLE KDVMLLCHNAQTFNLEGSQIYEDSIVLQSVFKSARQKIAKEEE ; _entity_poly.pdbx_strand_id A,B,C _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '5-oxidanyl-2-(phenylmethyl)-1,9-dihydropyrimido[4,5-b]indol-4-one' A1I45 3 'ZINC ION' ZN 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 MET n 1 3 ALA n 1 4 GLU n 1 5 LYS n 1 6 LEU n 1 7 SER n 1 8 PRO n 1 9 ASN n 1 10 PRO n 1 11 PRO n 1 12 LYS n 1 13 LEU n 1 14 THR n 1 15 LYS n 1 16 GLN n 1 17 MET n 1 18 ASN n 1 19 ALA n 1 20 ILE n 1 21 ILE n 1 22 ASP n 1 23 THR n 1 24 VAL n 1 25 ILE n 1 26 ASN n 1 27 TYR n 1 28 LYS n 1 29 ASP n 1 30 SER n 1 31 SER n 1 32 GLY n 1 33 ARG n 1 34 GLN n 1 35 LEU n 1 36 SER n 1 37 GLU n 1 38 VAL n 1 39 PHE n 1 40 ILE n 1 41 GLN n 1 42 LEU n 1 43 PRO n 1 44 SER n 1 45 ARG n 1 46 LYS n 1 47 GLU n 1 48 LEU n 1 49 PRO n 1 50 GLU n 1 51 TYR n 1 52 TYR n 1 53 GLU n 1 54 LEU n 1 55 ILE n 1 56 ARG n 1 57 LYS n 1 58 PRO n 1 59 VAL n 1 60 ASP n 1 61 PHE n 1 62 LYS n 1 63 LYS n 1 64 ILE n 1 65 LYS n 1 66 GLU n 1 67 ARG n 1 68 ILE n 1 69 ARG n 1 70 ASN n 1 71 HIS n 1 72 LYS n 1 73 TYR n 1 74 ARG n 1 75 SER n 1 76 LEU n 1 77 GLY n 1 78 ASP n 1 79 LEU n 1 80 GLU n 1 81 LYS n 1 82 ASP n 1 83 VAL n 1 84 MET n 1 85 LEU n 1 86 LEU n 1 87 CYS n 1 88 HIS n 1 89 ASN n 1 90 ALA n 1 91 GLN n 1 92 THR n 1 93 PHE n 1 94 ASN n 1 95 LEU n 1 96 GLU n 1 97 GLY n 1 98 SER n 1 99 GLN n 1 100 ILE n 1 101 TYR n 1 102 GLU n 1 103 ASP n 1 104 SER n 1 105 ILE n 1 106 VAL n 1 107 LEU n 1 108 GLN n 1 109 SER n 1 110 VAL n 1 111 PHE n 1 112 LYS n 1 113 SER n 1 114 ALA n 1 115 ARG n 1 116 GLN n 1 117 LYS n 1 118 ILE n 1 119 ALA n 1 120 LYS n 1 121 GLU n 1 122 GLU n 1 123 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 123 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'SMARCA2, BAF190B, BRM, SNF2A, SNF2L2' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight A1I45 non-polymer . '5-oxidanyl-2-(phenylmethyl)-1,9-dihydropyrimido[4,5-b]indol-4-one' ? 'C17 H13 N3 O2' 291.304 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1371 ? ? ? A . n A 1 2 MET 2 1372 ? ? ? A . n A 1 3 ALA 3 1373 ? ? ? A . n A 1 4 GLU 4 1374 ? ? ? A . n A 1 5 LYS 5 1375 ? ? ? A . n A 1 6 LEU 6 1376 1376 LEU LEU A . n A 1 7 SER 7 1377 1377 SER SER A . n A 1 8 PRO 8 1378 1378 PRO PRO A . n A 1 9 ASN 9 1379 1379 ASN ASN A . n A 1 10 PRO 10 1380 1380 PRO PRO A . n A 1 11 PRO 11 1381 1381 PRO PRO A . n A 1 12 LYS 12 1382 1382 LYS LYS A . n A 1 13 LEU 13 1383 1383 LEU LEU A . n A 1 14 THR 14 1384 1384 THR THR A . n A 1 15 LYS 15 1385 1385 LYS LYS A . n A 1 16 GLN 16 1386 1386 GLN GLN A . n A 1 17 MET 17 1387 1387 MET MET A . n A 1 18 ASN 18 1388 1388 ASN ASN A . n A 1 19 ALA 19 1389 1389 ALA ALA A . n A 1 20 ILE 20 1390 1390 ILE ILE A . n A 1 21 ILE 21 1391 1391 ILE ILE A . n A 1 22 ASP 22 1392 1392 ASP ASP A . n A 1 23 THR 23 1393 1393 THR THR A . n A 1 24 VAL 24 1394 1394 VAL VAL A . n A 1 25 ILE 25 1395 1395 ILE ILE A . n A 1 26 ASN 26 1396 1396 ASN ASN A . n A 1 27 TYR 27 1397 1397 TYR TYR A . n A 1 28 LYS 28 1398 1398 LYS LYS A . n A 1 29 ASP 29 1399 1399 ASP ASP A . n A 1 30 SER 30 1418 1418 SER SER A . n A 1 31 SER 31 1419 1419 SER SER A . n A 1 32 GLY 32 1420 1420 GLY GLY A . n A 1 33 ARG 33 1421 1421 ARG ARG A . n A 1 34 GLN 34 1422 1422 GLN GLN A . n A 1 35 LEU 35 1423 1423 LEU LEU A . n A 1 36 SER 36 1424 1424 SER SER A . n A 1 37 GLU 37 1425 1425 GLU GLU A . n A 1 38 VAL 38 1426 1426 VAL VAL A . n A 1 39 PHE 39 1427 1427 PHE PHE A . n A 1 40 ILE 40 1428 1428 ILE ILE A . n A 1 41 GLN 41 1429 1429 GLN GLN A . n A 1 42 LEU 42 1430 1430 LEU LEU A . n A 1 43 PRO 43 1431 1431 PRO PRO A . n A 1 44 SER 44 1432 1432 SER SER A . n A 1 45 ARG 45 1433 1433 ARG ARG A . n A 1 46 LYS 46 1434 1434 LYS LYS A . n A 1 47 GLU 47 1435 1435 GLU GLU A . n A 1 48 LEU 48 1436 1436 LEU LEU A . n A 1 49 PRO 49 1437 1437 PRO PRO A . n A 1 50 GLU 50 1438 1438 GLU GLU A . n A 1 51 TYR 51 1439 1439 TYR TYR A . n A 1 52 TYR 52 1440 1440 TYR TYR A . n A 1 53 GLU 53 1441 1441 GLU GLU A . n A 1 54 LEU 54 1442 1442 LEU LEU A . n A 1 55 ILE 55 1443 1443 ILE ILE A . n A 1 56 ARG 56 1444 1444 ARG ARG A . n A 1 57 LYS 57 1445 1445 LYS LYS A . n A 1 58 PRO 58 1446 1446 PRO PRO A . n A 1 59 VAL 59 1447 1447 VAL VAL A . n A 1 60 ASP 60 1448 1448 ASP ASP A . n A 1 61 PHE 61 1449 1449 PHE PHE A . n A 1 62 LYS 62 1450 1450 LYS LYS A . n A 1 63 LYS 63 1451 1451 LYS LYS A . n A 1 64 ILE 64 1452 1452 ILE ILE A . n A 1 65 LYS 65 1453 1453 LYS LYS A . n A 1 66 GLU 66 1454 1454 GLU GLU A . n A 1 67 ARG 67 1455 1455 ARG ARG A . n A 1 68 ILE 68 1456 1456 ILE ILE A . n A 1 69 ARG 69 1457 1457 ARG ARG A . n A 1 70 ASN 70 1458 1458 ASN ASN A . n A 1 71 HIS 71 1459 1459 HIS HIS A . n A 1 72 LYS 72 1460 1460 LYS LYS A . n A 1 73 TYR 73 1461 1461 TYR TYR A . n A 1 74 ARG 74 1462 1462 ARG ARG A . n A 1 75 SER 75 1463 1463 SER SER A . n A 1 76 LEU 76 1464 1464 LEU LEU A . n A 1 77 GLY 77 1465 1465 GLY GLY A . n A 1 78 ASP 78 1466 1466 ASP ASP A . n A 1 79 LEU 79 1467 1467 LEU LEU A . n A 1 80 GLU 80 1468 1468 GLU GLU A . n A 1 81 LYS 81 1469 1469 LYS LYS A . n A 1 82 ASP 82 1470 1470 ASP ASP A . n A 1 83 VAL 83 1471 1471 VAL VAL A . n A 1 84 MET 84 1472 1472 MET MET A . n A 1 85 LEU 85 1473 1473 LEU LEU A . n A 1 86 LEU 86 1474 1474 LEU LEU A . n A 1 87 CYS 87 1475 1475 CYS CYS A . n A 1 88 HIS 88 1476 1476 HIS HIS A . n A 1 89 ASN 89 1477 1477 ASN ASN A . n A 1 90 ALA 90 1478 1478 ALA ALA A . n A 1 91 GLN 91 1479 1479 GLN GLN A . n A 1 92 THR 92 1480 1480 THR THR A . n A 1 93 PHE 93 1481 1481 PHE PHE A . n A 1 94 ASN 94 1482 1482 ASN ASN A . n A 1 95 LEU 95 1483 1483 LEU LEU A . n A 1 96 GLU 96 1484 1484 GLU GLU A . n A 1 97 GLY 97 1485 1485 GLY GLY A . n A 1 98 SER 98 1486 1486 SER SER A . n A 1 99 GLN 99 1487 1487 GLN GLN A . n A 1 100 ILE 100 1488 1488 ILE ILE A . n A 1 101 TYR 101 1489 1489 TYR TYR A . n A 1 102 GLU 102 1490 1490 GLU GLU A . n A 1 103 ASP 103 1491 1491 ASP ASP A . n A 1 104 SER 104 1492 1492 SER SER A . n A 1 105 ILE 105 1493 1493 ILE ILE A . n A 1 106 VAL 106 1494 1494 VAL VAL A . n A 1 107 LEU 107 1495 1495 LEU LEU A . n A 1 108 GLN 108 1496 1496 GLN GLN A . n A 1 109 SER 109 1497 1497 SER SER A . n A 1 110 VAL 110 1498 1498 VAL VAL A . n A 1 111 PHE 111 1499 1499 PHE PHE A . n A 1 112 LYS 112 1500 1500 LYS LYS A . n A 1 113 SER 113 1501 1501 SER SER A . n A 1 114 ALA 114 1502 1502 ALA ALA A . n A 1 115 ARG 115 1503 1503 ARG ARG A . n A 1 116 GLN 116 1504 1504 GLN GLN A . n A 1 117 LYS 117 1505 1505 LYS LYS A . n A 1 118 ILE 118 1506 1506 ILE ILE A . n A 1 119 ALA 119 1507 1507 ALA ALA A . n A 1 120 LYS 120 1508 ? ? ? A . n A 1 121 GLU 121 1509 ? ? ? A . n A 1 122 GLU 122 1510 ? ? ? A . n A 1 123 GLU 123 1511 ? ? ? A . n B 1 1 SER 1 1371 ? ? ? B . n B 1 2 MET 2 1372 ? ? ? B . n B 1 3 ALA 3 1373 ? ? ? B . n B 1 4 GLU 4 1374 ? ? ? B . n B 1 5 LYS 5 1375 ? ? ? B . n B 1 6 LEU 6 1376 ? ? ? B . n B 1 7 SER 7 1377 ? ? ? B . n B 1 8 PRO 8 1378 ? ? ? B . n B 1 9 ASN 9 1379 1379 ASN ASN B . n B 1 10 PRO 10 1380 1380 PRO PRO B . n B 1 11 PRO 11 1381 1381 PRO PRO B . n B 1 12 LYS 12 1382 1382 LYS LYS B . n B 1 13 LEU 13 1383 1383 LEU LEU B . n B 1 14 THR 14 1384 1384 THR THR B . n B 1 15 LYS 15 1385 1385 LYS LYS B . n B 1 16 GLN 16 1386 1386 GLN GLN B . n B 1 17 MET 17 1387 1387 MET MET B . n B 1 18 ASN 18 1388 1388 ASN ASN B . n B 1 19 ALA 19 1389 1389 ALA ALA B . n B 1 20 ILE 20 1390 1390 ILE ILE B . n B 1 21 ILE 21 1391 1391 ILE ILE B . n B 1 22 ASP 22 1392 1392 ASP ASP B . n B 1 23 THR 23 1393 1393 THR THR B . n B 1 24 VAL 24 1394 1394 VAL VAL B . n B 1 25 ILE 25 1395 1395 ILE ILE B . n B 1 26 ASN 26 1396 1396 ASN ASN B . n B 1 27 TYR 27 1397 1397 TYR TYR B . n B 1 28 LYS 28 1398 1398 LYS LYS B . n B 1 29 ASP 29 1399 1399 ASP ASP B . n B 1 30 SER 30 1418 1418 SER SER B . n B 1 31 SER 31 1419 1419 SER SER B . n B 1 32 GLY 32 1420 1420 GLY GLY B . n B 1 33 ARG 33 1421 1421 ARG ARG B . n B 1 34 GLN 34 1422 1422 GLN GLN B . n B 1 35 LEU 35 1423 1423 LEU LEU B . n B 1 36 SER 36 1424 1424 SER SER B . n B 1 37 GLU 37 1425 1425 GLU GLU B . n B 1 38 VAL 38 1426 1426 VAL VAL B . n B 1 39 PHE 39 1427 1427 PHE PHE B . n B 1 40 ILE 40 1428 1428 ILE ILE B . n B 1 41 GLN 41 1429 1429 GLN GLN B . n B 1 42 LEU 42 1430 1430 LEU LEU B . n B 1 43 PRO 43 1431 1431 PRO PRO B . n B 1 44 SER 44 1432 1432 SER SER B . n B 1 45 ARG 45 1433 1433 ARG ARG B . n B 1 46 LYS 46 1434 1434 LYS LYS B . n B 1 47 GLU 47 1435 1435 GLU GLU B . n B 1 48 LEU 48 1436 1436 LEU LEU B . n B 1 49 PRO 49 1437 1437 PRO PRO B . n B 1 50 GLU 50 1438 1438 GLU GLU B . n B 1 51 TYR 51 1439 1439 TYR TYR B . n B 1 52 TYR 52 1440 1440 TYR TYR B . n B 1 53 GLU 53 1441 1441 GLU GLU B . n B 1 54 LEU 54 1442 1442 LEU LEU B . n B 1 55 ILE 55 1443 1443 ILE ILE B . n B 1 56 ARG 56 1444 1444 ARG ARG B . n B 1 57 LYS 57 1445 1445 LYS LYS B . n B 1 58 PRO 58 1446 1446 PRO PRO B . n B 1 59 VAL 59 1447 1447 VAL VAL B . n B 1 60 ASP 60 1448 1448 ASP ASP B . n B 1 61 PHE 61 1449 1449 PHE PHE B . n B 1 62 LYS 62 1450 1450 LYS LYS B . n B 1 63 LYS 63 1451 1451 LYS LYS B . n B 1 64 ILE 64 1452 1452 ILE ILE B . n B 1 65 LYS 65 1453 1453 LYS LYS B . n B 1 66 GLU 66 1454 1454 GLU GLU B . n B 1 67 ARG 67 1455 1455 ARG ARG B . n B 1 68 ILE 68 1456 1456 ILE ILE B . n B 1 69 ARG 69 1457 1457 ARG ARG B . n B 1 70 ASN 70 1458 1458 ASN ASN B . n B 1 71 HIS 71 1459 1459 HIS HIS B . n B 1 72 LYS 72 1460 1460 LYS LYS B . n B 1 73 TYR 73 1461 1461 TYR TYR B . n B 1 74 ARG 74 1462 1462 ARG ARG B . n B 1 75 SER 75 1463 1463 SER SER B . n B 1 76 LEU 76 1464 1464 LEU LEU B . n B 1 77 GLY 77 1465 1465 GLY GLY B . n B 1 78 ASP 78 1466 1466 ASP ASP B . n B 1 79 LEU 79 1467 1467 LEU LEU B . n B 1 80 GLU 80 1468 1468 GLU GLU B . n B 1 81 LYS 81 1469 1469 LYS LYS B . n B 1 82 ASP 82 1470 1470 ASP ASP B . n B 1 83 VAL 83 1471 1471 VAL VAL B . n B 1 84 MET 84 1472 1472 MET MET B . n B 1 85 LEU 85 1473 1473 LEU LEU B . n B 1 86 LEU 86 1474 1474 LEU LEU B . n B 1 87 CYS 87 1475 1475 CYS CYS B . n B 1 88 HIS 88 1476 1476 HIS HIS B . n B 1 89 ASN 89 1477 1477 ASN ASN B . n B 1 90 ALA 90 1478 1478 ALA ALA B . n B 1 91 GLN 91 1479 1479 GLN GLN B . n B 1 92 THR 92 1480 1480 THR THR B . n B 1 93 PHE 93 1481 1481 PHE PHE B . n B 1 94 ASN 94 1482 1482 ASN ASN B . n B 1 95 LEU 95 1483 1483 LEU LEU B . n B 1 96 GLU 96 1484 1484 GLU GLU B . n B 1 97 GLY 97 1485 1485 GLY GLY B . n B 1 98 SER 98 1486 1486 SER SER B . n B 1 99 GLN 99 1487 1487 GLN GLN B . n B 1 100 ILE 100 1488 1488 ILE ILE B . n B 1 101 TYR 101 1489 1489 TYR TYR B . n B 1 102 GLU 102 1490 1490 GLU GLU B . n B 1 103 ASP 103 1491 1491 ASP ASP B . n B 1 104 SER 104 1492 1492 SER SER B . n B 1 105 ILE 105 1493 1493 ILE ILE B . n B 1 106 VAL 106 1494 1494 VAL VAL B . n B 1 107 LEU 107 1495 1495 LEU LEU B . n B 1 108 GLN 108 1496 1496 GLN GLN B . n B 1 109 SER 109 1497 1497 SER SER B . n B 1 110 VAL 110 1498 1498 VAL VAL B . n B 1 111 PHE 111 1499 1499 PHE PHE B . n B 1 112 LYS 112 1500 1500 LYS LYS B . n B 1 113 SER 113 1501 1501 SER SER B . n B 1 114 ALA 114 1502 1502 ALA ALA B . n B 1 115 ARG 115 1503 1503 ARG ARG B . n B 1 116 GLN 116 1504 1504 GLN GLN B . n B 1 117 LYS 117 1505 1505 LYS LYS B . n B 1 118 ILE 118 1506 1506 ILE ILE B . n B 1 119 ALA 119 1507 1507 ALA ALA B . n B 1 120 LYS 120 1508 1508 LYS LYS B . n B 1 121 GLU 121 1509 1509 GLU GLU B . n B 1 122 GLU 122 1510 ? ? ? B . n B 1 123 GLU 123 1511 ? ? ? B . n C 1 1 SER 1 1371 ? ? ? C . n C 1 2 MET 2 1372 ? ? ? C . n C 1 3 ALA 3 1373 ? ? ? C . n C 1 4 GLU 4 1374 ? ? ? C . n C 1 5 LYS 5 1375 ? ? ? C . n C 1 6 LEU 6 1376 1376 LEU LEU C . n C 1 7 SER 7 1377 1377 SER SER C . n C 1 8 PRO 8 1378 1378 PRO PRO C . n C 1 9 ASN 9 1379 1379 ASN ASN C . n C 1 10 PRO 10 1380 1380 PRO PRO C . n C 1 11 PRO 11 1381 1381 PRO PRO C . n C 1 12 LYS 12 1382 1382 LYS LYS C . n C 1 13 LEU 13 1383 1383 LEU LEU C . n C 1 14 THR 14 1384 1384 THR THR C . n C 1 15 LYS 15 1385 1385 LYS LYS C . n C 1 16 GLN 16 1386 1386 GLN GLN C . n C 1 17 MET 17 1387 1387 MET MET C . n C 1 18 ASN 18 1388 1388 ASN ASN C . n C 1 19 ALA 19 1389 1389 ALA ALA C . n C 1 20 ILE 20 1390 1390 ILE ILE C . n C 1 21 ILE 21 1391 1391 ILE ILE C . n C 1 22 ASP 22 1392 1392 ASP ASP C . n C 1 23 THR 23 1393 1393 THR THR C . n C 1 24 VAL 24 1394 1394 VAL VAL C . n C 1 25 ILE 25 1395 1395 ILE ILE C . n C 1 26 ASN 26 1396 1396 ASN ASN C . n C 1 27 TYR 27 1397 1397 TYR TYR C . n C 1 28 LYS 28 1398 1398 LYS LYS C . n C 1 29 ASP 29 1399 1399 ASP ASP C . n C 1 30 SER 30 1418 1418 SER SER C . n C 1 31 SER 31 1419 1419 SER SER C . n C 1 32 GLY 32 1420 1420 GLY GLY C . n C 1 33 ARG 33 1421 1421 ARG ARG C . n C 1 34 GLN 34 1422 1422 GLN GLN C . n C 1 35 LEU 35 1423 1423 LEU LEU C . n C 1 36 SER 36 1424 1424 SER SER C . n C 1 37 GLU 37 1425 1425 GLU GLU C . n C 1 38 VAL 38 1426 1426 VAL VAL C . n C 1 39 PHE 39 1427 1427 PHE PHE C . n C 1 40 ILE 40 1428 1428 ILE ILE C . n C 1 41 GLN 41 1429 1429 GLN GLN C . n C 1 42 LEU 42 1430 1430 LEU LEU C . n C 1 43 PRO 43 1431 1431 PRO PRO C . n C 1 44 SER 44 1432 1432 SER SER C . n C 1 45 ARG 45 1433 1433 ARG ARG C . n C 1 46 LYS 46 1434 1434 LYS LYS C . n C 1 47 GLU 47 1435 1435 GLU GLU C . n C 1 48 LEU 48 1436 1436 LEU LEU C . n C 1 49 PRO 49 1437 1437 PRO PRO C . n C 1 50 GLU 50 1438 1438 GLU GLU C . n C 1 51 TYR 51 1439 1439 TYR TYR C . n C 1 52 TYR 52 1440 1440 TYR TYR C . n C 1 53 GLU 53 1441 1441 GLU GLU C . n C 1 54 LEU 54 1442 1442 LEU LEU C . n C 1 55 ILE 55 1443 1443 ILE ILE C . n C 1 56 ARG 56 1444 1444 ARG ARG C . n C 1 57 LYS 57 1445 1445 LYS LYS C . n C 1 58 PRO 58 1446 1446 PRO PRO C . n C 1 59 VAL 59 1447 1447 VAL VAL C . n C 1 60 ASP 60 1448 1448 ASP ASP C . n C 1 61 PHE 61 1449 1449 PHE PHE C . n C 1 62 LYS 62 1450 1450 LYS LYS C . n C 1 63 LYS 63 1451 1451 LYS LYS C . n C 1 64 ILE 64 1452 1452 ILE ILE C . n C 1 65 LYS 65 1453 1453 LYS LYS C . n C 1 66 GLU 66 1454 1454 GLU GLU C . n C 1 67 ARG 67 1455 1455 ARG ARG C . n C 1 68 ILE 68 1456 1456 ILE ILE C . n C 1 69 ARG 69 1457 1457 ARG ARG C . n C 1 70 ASN 70 1458 1458 ASN ASN C . n C 1 71 HIS 71 1459 1459 HIS HIS C . n C 1 72 LYS 72 1460 1460 LYS LYS C . n C 1 73 TYR 73 1461 1461 TYR TYR C . n C 1 74 ARG 74 1462 1462 ARG ARG C . n C 1 75 SER 75 1463 1463 SER SER C . n C 1 76 LEU 76 1464 1464 LEU LEU C . n C 1 77 GLY 77 1465 1465 GLY GLY C . n C 1 78 ASP 78 1466 1466 ASP ASP C . n C 1 79 LEU 79 1467 1467 LEU LEU C . n C 1 80 GLU 80 1468 1468 GLU GLU C . n C 1 81 LYS 81 1469 1469 LYS LYS C . n C 1 82 ASP 82 1470 1470 ASP ASP C . n C 1 83 VAL 83 1471 1471 VAL VAL C . n C 1 84 MET 84 1472 1472 MET MET C . n C 1 85 LEU 85 1473 1473 LEU LEU C . n C 1 86 LEU 86 1474 1474 LEU LEU C . n C 1 87 CYS 87 1475 1475 CYS CYS C . n C 1 88 HIS 88 1476 1476 HIS HIS C . n C 1 89 ASN 89 1477 1477 ASN ASN C . n C 1 90 ALA 90 1478 1478 ALA ALA C . n C 1 91 GLN 91 1479 1479 GLN GLN C . n C 1 92 THR 92 1480 1480 THR THR C . n C 1 93 PHE 93 1481 1481 PHE PHE C . n C 1 94 ASN 94 1482 1482 ASN ASN C . n C 1 95 LEU 95 1483 1483 LEU LEU C . n C 1 96 GLU 96 1484 1484 GLU GLU C . n C 1 97 GLY 97 1485 1485 GLY GLY C . n C 1 98 SER 98 1486 1486 SER SER C . n C 1 99 GLN 99 1487 1487 GLN GLN C . n C 1 100 ILE 100 1488 1488 ILE ILE C . n C 1 101 TYR 101 1489 1489 TYR TYR C . n C 1 102 GLU 102 1490 1490 GLU GLU C . n C 1 103 ASP 103 1491 1491 ASP ASP C . n C 1 104 SER 104 1492 1492 SER SER C . n C 1 105 ILE 105 1493 1493 ILE ILE C . n C 1 106 VAL 106 1494 1494 VAL VAL C . n C 1 107 LEU 107 1495 1495 LEU LEU C . n C 1 108 GLN 108 1496 1496 GLN GLN C . n C 1 109 SER 109 1497 1497 SER SER C . n C 1 110 VAL 110 1498 1498 VAL VAL C . n C 1 111 PHE 111 1499 1499 PHE PHE C . n C 1 112 LYS 112 1500 1500 LYS LYS C . n C 1 113 SER 113 1501 1501 SER SER C . n C 1 114 ALA 114 1502 1502 ALA ALA C . n C 1 115 ARG 115 1503 1503 ARG ARG C . n C 1 116 GLN 116 1504 1504 GLN GLN C . n C 1 117 LYS 117 1505 1505 LYS LYS C . n C 1 118 ILE 118 1506 1506 ILE ILE C . n C 1 119 ALA 119 1507 1507 ALA ALA C . n C 1 120 LYS 120 1508 1508 LYS LYS C . n C 1 121 GLU 121 1509 ? ? ? C . n C 1 122 GLU 122 1510 ? ? ? C . n C 1 123 GLU 123 1511 ? ? ? C . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id A1I45 _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id A1I45 _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code D 2 A1I45 1 1601 1 A1I45 INH A . E 3 ZN 1 1602 1 ZN ZN A . F 2 A1I45 1 1601 2 A1I45 INH B . G 3 ZN 1 1602 2 ZN ZN B . H 2 A1I45 1 1601 3 A1I45 INH C . I 3 ZN 1 1602 3 ZN ZN C . J 4 HOH 1 1701 9 HOH HOH A . J 4 HOH 2 1702 39 HOH HOH A . J 4 HOH 3 1703 24 HOH HOH A . J 4 HOH 4 1704 36 HOH HOH A . J 4 HOH 5 1705 5 HOH HOH A . J 4 HOH 6 1706 12 HOH HOH A . J 4 HOH 7 1707 3 HOH HOH A . J 4 HOH 8 1708 7 HOH HOH A . J 4 HOH 9 1709 31 HOH HOH A . J 4 HOH 10 1710 40 HOH HOH A . J 4 HOH 11 1711 35 HOH HOH A . J 4 HOH 12 1712 17 HOH HOH A . J 4 HOH 13 1713 22 HOH HOH A . J 4 HOH 14 1714 15 HOH HOH A . J 4 HOH 15 1715 30 HOH HOH A . K 4 HOH 1 1701 10 HOH HOH B . K 4 HOH 2 1702 34 HOH HOH B . K 4 HOH 3 1703 13 HOH HOH B . K 4 HOH 4 1704 11 HOH HOH B . K 4 HOH 5 1705 16 HOH HOH B . K 4 HOH 6 1706 32 HOH HOH B . K 4 HOH 7 1707 33 HOH HOH B . K 4 HOH 8 1708 38 HOH HOH B . K 4 HOH 9 1709 4 HOH HOH B . K 4 HOH 10 1710 14 HOH HOH B . K 4 HOH 11 1711 19 HOH HOH B . K 4 HOH 12 1712 21 HOH HOH B . K 4 HOH 13 1713 28 HOH HOH B . K 4 HOH 14 1714 1 HOH HOH B . L 4 HOH 1 1701 8 HOH HOH C . L 4 HOH 2 1702 26 HOH HOH C . L 4 HOH 3 1703 23 HOH HOH C . L 4 HOH 4 1704 20 HOH HOH C . L 4 HOH 5 1705 25 HOH HOH C . L 4 HOH 6 1706 18 HOH HOH C . L 4 HOH 7 1707 37 HOH HOH C . L 4 HOH 8 1708 2 HOH HOH C . L 4 HOH 9 1709 6 HOH HOH C . L 4 HOH 10 1710 29 HOH HOH C . L 4 HOH 11 1711 27 HOH HOH C . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LEU 1376 ? CG ? A LEU 6 CG 2 1 Y 1 A LEU 1376 ? CD1 ? A LEU 6 CD1 3 1 Y 1 A LEU 1376 ? CD2 ? A LEU 6 CD2 4 1 Y 1 B ARG 1444 ? CG ? B ARG 56 CG 5 1 Y 1 B ARG 1444 ? CD ? B ARG 56 CD 6 1 Y 1 B ARG 1444 ? NE ? B ARG 56 NE 7 1 Y 1 B ARG 1444 ? CZ ? B ARG 56 CZ 8 1 Y 1 B ARG 1444 ? NH1 ? B ARG 56 NH1 9 1 Y 1 B ARG 1444 ? NH2 ? B ARG 56 NH2 10 1 Y 1 C LYS 1508 ? CG ? C LYS 120 CG 11 1 Y 1 C LYS 1508 ? CD ? C LYS 120 CD 12 1 Y 1 C LYS 1508 ? CE ? C LYS 120 CE 13 1 Y 1 C LYS 1508 ? NZ ? C LYS 120 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? BUSTER ? ? ? 2.11.7 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? MOSFLM ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? AMoRE ? ? ? . 5 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 9QAD _cell.details ? _cell.formula_units_Z ? _cell.length_a 64.023 _cell.length_a_esd ? _cell.length_b 64.023 _cell.length_b_esd ? _cell.length_c 88.985 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 9 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9QAD _symmetry.cell_setting ? _symmetry.Int_Tables_number 144 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 31' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9QAD _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.44 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 49.60 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.01 M ZnCl2, 12 % EG, 17 % PEG6000, 0.1 M Hepes pH 7' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 277 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-04-26 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97623 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I03' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97623 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I03 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 9QAD _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.077 _reflns.d_resolution_low 47.058 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 12801 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 52.0 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.2 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 13.4 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.074 _reflns.pdbx_Rpim_I_all 0.032 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 66212 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.066 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.077 _reflns_shell.d_res_low 2.367 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all 3182 _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 638 _reflns_shell.percent_possible_obs 8.0 _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 5.0 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs 1.8 _reflns_shell.pdbx_Rrim_I_all 1.028 _reflns_shell.pdbx_Rpim_I_all 0.456 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.919 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] 4.96110 _refine.aniso_B[1][2] 0.00000 _refine.aniso_B[1][3] 0.00000 _refine.aniso_B[2][2] 4.96110 _refine.aniso_B[2][3] 0.00000 _refine.aniso_B[3][3] -9.92210 _refine.B_iso_max ? _refine.B_iso_mean 62.29 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.931 _refine.correlation_coeff_Fo_to_Fc_free 0.910 _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9QAD _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.08 _refine.ls_d_res_low 34.70 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 12694 _refine.ls_number_reflns_R_free 620 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 51.7 _refine.ls_percent_reflns_R_free 4.880 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.198 _refine.ls_R_factor_R_free 0.245 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.196 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI 0.303 _refine.pdbx_overall_SU_R_free_Blow_DPI 0.290 _refine.pdbx_overall_SU_R_Blow_DPI 0.634 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI 0.837 _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_analyze.entry_id 9QAD _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_coordinate_error_obs 0.36 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_sigma_a_free_details ? _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_sigma_a_obs_details ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.RG_d_res_high ? _refine_analyze.RG_d_res_low ? _refine_analyze.RG_free ? _refine_analyze.RG_work ? _refine_analyze.RG_free_work_ratio ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.08 _refine_hist.d_res_low 34.70 _refine_hist.number_atoms_solvent 40 _refine_hist.number_atoms_total 2907 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2798 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 69 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.010 ? 2920 ? t_bond_d 2.00 HARMONIC 'X-RAY DIFFRACTION' ? 1.04 ? 3930 ? t_angle_deg 2.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 1074 ? t_dihedral_angle_d 2.00 SINUSOIDAL 'X-RAY DIFFRACTION' ? ? ? ? ? t_incorr_chiral_ct ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_pseud_angle ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_trig_c_planes ? ? 'X-RAY DIFFRACTION' ? ? ? 480 ? t_gen_planes 5.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 2920 ? t_it 20.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 2 ? t_nbd 5.00 SEMIHARMONIC 'X-RAY DIFFRACTION' ? 2.40 ? ? ? t_omega_torsion ? ? 'X-RAY DIFFRACTION' ? 18.71 ? ? ? t_other_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_improper_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? 372 ? t_chiral_improper_torsion 5.00 SEMIHARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_sum_occupancies ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_distance ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_angle ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? 3288 ? t_ideal_dist_contact 4.00 SEMIHARMONIC # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.08 _refine_ls_shell.d_res_low 2.31 _refine_ls_shell.number_reflns_all 410 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free ? _refine_ls_shell.number_reflns_R_work 389 _refine_ls_shell.percent_reflns_obs 6.20 _refine_ls_shell.percent_reflns_R_free 5.12 _refine_ls_shell.R_factor_all 0.2152 _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.2117 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.correlation_coeff_Fo_to_Fc ? _refine_ls_shell.correlation_coeff_Fo_to_Fc_free ? _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work ? _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free ? _refine_ls_shell.pdbx_total_number_of_bins_used 31 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? _refine_ls_shell.R_factor_R_free 0.2738 # _struct.entry_id 9QAD _struct.title 'Crystal structure of the SMARCA2 bromodomain bound to a tricyclic pyrimidoindolone inhibitor (compound 17)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9QAD _struct_keywords.text 'bromodomain, fragment screening, structure-based inhibitor design, GENE REGULATION' _struct_keywords.pdbx_keywords 'GENE REGULATION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 1 ? D N N 2 ? E N N 3 ? F N N 2 ? G N N 3 ? H N N 2 ? I N N 3 ? J N N 4 ? K N N 4 ? L N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SMCA2_HUMAN _struct_ref.pdbx_db_accession P51531 _struct_ref.pdbx_db_isoform P51531-2 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;AEKLSPNPPKLTKQMNAIIDTVINYKDSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLGDLEKD VMLLCHNAQTFNLEGSQIYEDSIVLQSVFKSARQKIAKEEE ; _struct_ref.pdbx_align_begin 1373 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 9QAD A 3 ? 123 ? P51531 1373 ? 1493 ? 1373 1511 2 1 9QAD B 3 ? 123 ? P51531 1373 ? 1493 ? 1373 1511 3 1 9QAD C 3 ? 123 ? P51531 1373 ? 1493 ? 1373 1511 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9QAD SER A 1 ? UNP P51531 ? ? 'expression tag' 1371 1 1 9QAD MET A 2 ? UNP P51531 ? ? 'expression tag' 1372 2 2 9QAD SER B 1 ? UNP P51531 ? ? 'expression tag' 1371 3 2 9QAD MET B 2 ? UNP P51531 ? ? 'expression tag' 1372 4 3 9QAD SER C 1 ? UNP P51531 ? ? 'expression tag' 1371 5 3 9QAD MET C 2 ? UNP P51531 ? ? 'expression tag' 1372 6 # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? monomeric 1 2 author_defined_assembly ? monomeric 1 3 author_defined_assembly ? monomeric 1 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,D,E,J 2 1 B,F,G,K 3 1 C,H,I,L # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 10 ? TYR A 27 ? PRO A 1380 TYR A 1397 1 ? 18 HELX_P HELX_P2 AA2 GLN A 34 ? PHE A 39 ? GLN A 1422 PHE A 1427 5 ? 6 HELX_P HELX_P3 AA3 LEU A 48 ? ILE A 55 ? LEU A 1436 ILE A 1443 1 ? 8 HELX_P HELX_P4 AA4 ASP A 60 ? ASN A 70 ? ASP A 1448 ASN A 1458 1 ? 11 HELX_P HELX_P5 AA5 SER A 75 ? ASN A 94 ? SER A 1463 ASN A 1482 1 ? 20 HELX_P HELX_P6 AA6 SER A 98 ? ALA A 119 ? SER A 1486 ALA A 1507 1 ? 22 HELX_P HELX_P7 AA7 PRO B 10 ? TYR B 27 ? PRO B 1380 TYR B 1397 1 ? 18 HELX_P HELX_P8 AA8 GLN B 34 ? ILE B 40 ? GLN B 1422 ILE B 1428 5 ? 7 HELX_P HELX_P9 AA9 LEU B 48 ? ILE B 55 ? LEU B 1436 ILE B 1443 1 ? 8 HELX_P HELX_P10 AB1 ASP B 60 ? ASN B 70 ? ASP B 1448 ASN B 1458 1 ? 11 HELX_P HELX_P11 AB2 SER B 75 ? ASN B 94 ? SER B 1463 ASN B 1482 1 ? 20 HELX_P HELX_P12 AB3 SER B 98 ? LYS B 120 ? SER B 1486 LYS B 1508 1 ? 23 HELX_P HELX_P13 AB4 PRO C 10 ? TYR C 27 ? PRO C 1380 TYR C 1397 1 ? 18 HELX_P HELX_P14 AB5 GLN C 34 ? PHE C 39 ? GLN C 1422 PHE C 1427 5 ? 6 HELX_P HELX_P15 AB6 LEU C 48 ? ILE C 55 ? LEU C 1436 ILE C 1443 1 ? 8 HELX_P HELX_P16 AB7 ASP C 60 ? ASN C 70 ? ASP C 1448 ASN C 1458 1 ? 11 HELX_P HELX_P17 AB8 SER C 75 ? ASN C 94 ? SER C 1463 ASN C 1482 1 ? 20 HELX_P HELX_P18 AB9 SER C 98 ? ALA C 119 ? SER C 1486 ALA C 1507 1 ? 22 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 71 NE2 ? ? ? 1_555 E ZN . ZN ? ? A HIS 1459 A ZN 1602 2_665 ? ? ? ? ? ? ? 1.910 ? ? metalc2 metalc ? ? A HIS 88 NE2 ? ? ? 1_555 E ZN . ZN ? ? A HIS 1476 A ZN 1602 1_555 ? ? ? ? ? ? ? 1.923 ? ? metalc3 metalc ? ? E ZN . ZN ? ? ? 1_555 J HOH . O ? ? A ZN 1602 A HOH 1715 3_564 ? ? ? ? ? ? ? 2.101 ? ? metalc4 metalc ? ? B HIS 71 NE2 ? ? ? 1_555 G ZN . ZN ? ? B HIS 1459 B ZN 1602 2_555 ? ? ? ? ? ? ? 2.024 ? ? metalc5 metalc ? ? B HIS 88 NE2 ? ? ? 1_555 G ZN . ZN ? ? B HIS 1476 B ZN 1602 1_555 ? ? ? ? ? ? ? 2.074 ? ? metalc6 metalc ? ? G ZN . ZN ? ? ? 1_555 K HOH . O ? ? B ZN 1602 B HOH 1703 1_555 ? ? ? ? ? ? ? 2.339 ? ? metalc7 metalc ? ? C HIS 71 NE2 ? ? ? 1_555 I ZN . ZN ? ? C HIS 1459 C ZN 1602 2_565 ? ? ? ? ? ? ? 2.127 ? ? metalc8 metalc ? ? C HIS 88 NE2 ? ? ? 1_555 I ZN . ZN ? ? C HIS 1476 C ZN 1602 1_555 ? ? ? ? ? ? ? 1.988 ? ? metalc9 metalc ? ? I ZN . ZN ? ? ? 1_555 L HOH . O ? ? C ZN 1602 C HOH 1703 1_555 ? ? ? ? ? ? ? 2.130 ? ? metalc10 metalc ? ? I ZN . ZN ? ? ? 1_555 L HOH . O ? ? C ZN 1602 C HOH 1708 1_555 ? ? ? ? ? ? ? 2.438 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 71 ? A HIS 1459 ? 1_555 ZN ? E ZN . ? A ZN 1602 ? 2_665 NE2 ? A HIS 88 ? A HIS 1476 ? 1_555 33.8 ? 2 NE2 ? A HIS 71 ? A HIS 1459 ? 1_555 ZN ? E ZN . ? A ZN 1602 ? 2_665 O ? J HOH . ? A HOH 1715 ? 3_564 31.0 ? 3 NE2 ? A HIS 88 ? A HIS 1476 ? 1_555 ZN ? E ZN . ? A ZN 1602 ? 2_665 O ? J HOH . ? A HOH 1715 ? 3_564 6.9 ? 4 NE2 ? B HIS 71 ? B HIS 1459 ? 1_555 ZN ? G ZN . ? B ZN 1602 ? 2_555 NE2 ? B HIS 88 ? B HIS 1476 ? 1_555 18.3 ? 5 NE2 ? B HIS 71 ? B HIS 1459 ? 1_555 ZN ? G ZN . ? B ZN 1602 ? 2_555 O ? K HOH . ? B HOH 1703 ? 1_555 16.1 ? 6 NE2 ? B HIS 88 ? B HIS 1476 ? 1_555 ZN ? G ZN . ? B ZN 1602 ? 2_555 O ? K HOH . ? B HOH 1703 ? 1_555 4.9 ? 7 NE2 ? C HIS 71 ? C HIS 1459 ? 1_555 ZN ? I ZN . ? C ZN 1602 ? 2_565 NE2 ? C HIS 88 ? C HIS 1476 ? 1_555 34.2 ? 8 NE2 ? C HIS 71 ? C HIS 1459 ? 1_555 ZN ? I ZN . ? C ZN 1602 ? 2_565 O ? L HOH . ? C HOH 1703 ? 1_555 30.2 ? 9 NE2 ? C HIS 88 ? C HIS 1476 ? 1_555 ZN ? I ZN . ? C ZN 1602 ? 2_565 O ? L HOH . ? C HOH 1703 ? 1_555 4.0 ? 10 NE2 ? C HIS 71 ? C HIS 1459 ? 1_555 ZN ? I ZN . ? C ZN 1602 ? 2_565 O ? L HOH . ? C HOH 1708 ? 1_555 37.2 ? 11 NE2 ? C HIS 88 ? C HIS 1476 ? 1_555 ZN ? I ZN . ? C ZN 1602 ? 2_565 O ? L HOH . ? C HOH 1708 ? 1_555 5.6 ? 12 O ? L HOH . ? C HOH 1703 ? 1_555 ZN ? I ZN . ? C ZN 1602 ? 2_565 O ? L HOH . ? C HOH 1708 ? 1_555 7.9 ? # _pdbx_entry_details.entry_id 9QAD _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 1445 ? ? -115.56 79.37 2 1 LYS B 1445 ? ? -115.61 78.44 3 1 LYS C 1445 ? ? -115.47 79.50 # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined -3.2081 31.6279 12.5806 -0.2195 ? -0.0934 ? -0.0605 ? 0.2073 ? 0.0538 ? -0.2290 ? 3.2026 ? -0.3806 ? 0.2382 ? 3.8487 ? -0.9693 ? 5.8580 ? -0.0944 ? 0.0251 ? -0.2181 ? -0.1051 ? 0.3602 ? 0.3010 ? 0.2659 ? -0.1758 ? -0.2659 ? 2 'X-RAY DIFFRACTION' ? refined -1.2339 4.7294 -10.2340 0.1000 ? -0.1355 ? 0.1158 ? -0.0064 ? 0.0092 ? -0.2547 ? 3.0040 ? 0.0829 ? 0.2766 ? 2.2834 ? -1.3274 ? 6.4950 ? 0.1836 ? -0.1074 ? 0.0343 ? -0.1633 ? -0.2517 ? -0.1394 ? -0.0663 ? 0.2614 ? 0.0681 ? 3 'X-RAY DIFFRACTION' ? refined -28.1689 19.9280 -2.3465 0.0038 ? -0.1469 ? 0.0560 ? 0.0117 ? -0.0969 ? -0.2384 ? 3.2636 ? -0.1071 ? -0.3163 ? 3.0433 ? 0.1033 ? 4.9570 ? -0.0742 ? -0.1695 ? -0.0139 ? -0.0224 ? 0.0109 ? 0.2121 ? -0.1277 ? 0.2476 ? 0.0634 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? ? ? ? ? ? ? '{ A|* }' 2 'X-RAY DIFFRACTION' 2 ? ? ? ? ? ? ? ? ? ? ? '{ B|* }' 3 'X-RAY DIFFRACTION' 3 ? ? ? ? ? ? ? ? ? ? ? '{ C|* }' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 1371 ? A SER 1 2 1 Y 1 A MET 1372 ? A MET 2 3 1 Y 1 A ALA 1373 ? A ALA 3 4 1 Y 1 A GLU 1374 ? A GLU 4 5 1 Y 1 A LYS 1375 ? A LYS 5 6 1 Y 1 A LYS 1508 ? A LYS 120 7 1 Y 1 A GLU 1509 ? A GLU 121 8 1 Y 1 A GLU 1510 ? A GLU 122 9 1 Y 1 A GLU 1511 ? A GLU 123 10 1 Y 1 B SER 1371 ? B SER 1 11 1 Y 1 B MET 1372 ? B MET 2 12 1 Y 1 B ALA 1373 ? B ALA 3 13 1 Y 1 B GLU 1374 ? B GLU 4 14 1 Y 1 B LYS 1375 ? B LYS 5 15 1 Y 1 B LEU 1376 ? B LEU 6 16 1 Y 1 B SER 1377 ? B SER 7 17 1 Y 1 B PRO 1378 ? B PRO 8 18 1 Y 1 B GLU 1510 ? B GLU 122 19 1 Y 1 B GLU 1511 ? B GLU 123 20 1 Y 1 C SER 1371 ? C SER 1 21 1 Y 1 C MET 1372 ? C MET 2 22 1 Y 1 C ALA 1373 ? C ALA 3 23 1 Y 1 C GLU 1374 ? C GLU 4 24 1 Y 1 C LYS 1375 ? C LYS 5 25 1 Y 1 C GLU 1509 ? C GLU 121 26 1 Y 1 C GLU 1510 ? C GLU 122 27 1 Y 1 C GLU 1511 ? C GLU 123 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal A1I45 C1 C Y N 1 A1I45 C2 C Y N 2 A1I45 C3 C Y N 3 A1I45 C7 C N N 4 A1I45 C8 C Y N 5 A1I45 C9 C Y N 6 A1I45 C10 C Y N 7 A1I45 C11 C Y N 8 A1I45 C12 C Y N 9 A1I45 C13 C Y N 10 A1I45 C14 C N N 11 A1I45 C15 C Y N 12 A1I45 C16 C Y N 13 A1I45 O1 O N N 14 A1I45 C5 C Y N 15 A1I45 N N Y N 16 A1I45 C4 C Y N 17 A1I45 C C Y N 18 A1I45 O O N N 19 A1I45 N2 N N N 20 A1I45 C6 C N N 21 A1I45 N1 N N N 22 A1I45 H1 H N N 23 A1I45 H2 H N N 24 A1I45 H3 H N N 25 A1I45 H4 H N N 26 A1I45 H5 H N N 27 A1I45 H6 H N N 28 A1I45 H7 H N N 29 A1I45 H8 H N N 30 A1I45 H9 H N N 31 A1I45 H10 H N N 32 A1I45 H11 H N N 33 A1I45 H12 H N N 34 A1I45 H13 H N N 35 ALA N N N N 36 ALA CA C N S 37 ALA C C N N 38 ALA O O N N 39 ALA CB C N N 40 ALA OXT O N N 41 ALA H H N N 42 ALA H2 H N N 43 ALA HA H N N 44 ALA HB1 H N N 45 ALA HB2 H N N 46 ALA HB3 H N N 47 ALA HXT H N N 48 ARG N N N N 49 ARG CA C N S 50 ARG C C N N 51 ARG O O N N 52 ARG CB C N N 53 ARG CG C N N 54 ARG CD C N N 55 ARG NE N N N 56 ARG CZ C N N 57 ARG NH1 N N N 58 ARG NH2 N N N 59 ARG OXT O N N 60 ARG H H N N 61 ARG H2 H N N 62 ARG HA H N N 63 ARG HB2 H N N 64 ARG HB3 H N N 65 ARG HG2 H N N 66 ARG HG3 H N N 67 ARG HD2 H N N 68 ARG HD3 H N N 69 ARG HE H N N 70 ARG HH11 H N N 71 ARG HH12 H N N 72 ARG HH21 H N N 73 ARG HH22 H N N 74 ARG HXT H N N 75 ASN N N N N 76 ASN CA C N S 77 ASN C C N N 78 ASN O O N N 79 ASN CB C N N 80 ASN CG C N N 81 ASN OD1 O N N 82 ASN ND2 N N N 83 ASN OXT O N N 84 ASN H H N N 85 ASN H2 H N N 86 ASN HA H N N 87 ASN HB2 H N N 88 ASN HB3 H N N 89 ASN HD21 H N N 90 ASN HD22 H N N 91 ASN HXT H N N 92 ASP N N N N 93 ASP CA C N S 94 ASP C C N N 95 ASP O O N N 96 ASP CB C N N 97 ASP CG C N N 98 ASP OD1 O N N 99 ASP OD2 O N N 100 ASP OXT O N N 101 ASP H H N N 102 ASP H2 H N N 103 ASP HA H N N 104 ASP HB2 H N N 105 ASP HB3 H N N 106 ASP HD2 H N N 107 ASP HXT H N N 108 CYS N N N N 109 CYS CA C N R 110 CYS C C N N 111 CYS O O N N 112 CYS CB C N N 113 CYS SG S N N 114 CYS OXT O N N 115 CYS H H N N 116 CYS H2 H N N 117 CYS HA H N N 118 CYS HB2 H N N 119 CYS HB3 H N N 120 CYS HG H N N 121 CYS HXT H N N 122 GLN N N N N 123 GLN CA C N S 124 GLN C C N N 125 GLN O O N N 126 GLN CB C N N 127 GLN CG C N N 128 GLN CD C N N 129 GLN OE1 O N N 130 GLN NE2 N N N 131 GLN OXT O N N 132 GLN H H N N 133 GLN H2 H N N 134 GLN HA H N N 135 GLN HB2 H N N 136 GLN HB3 H N N 137 GLN HG2 H N N 138 GLN HG3 H N N 139 GLN HE21 H N N 140 GLN HE22 H N N 141 GLN HXT H N N 142 GLU N N N N 143 GLU CA C N S 144 GLU C C N N 145 GLU O O N N 146 GLU CB C N N 147 GLU CG C N N 148 GLU CD C N N 149 GLU OE1 O N N 150 GLU OE2 O N N 151 GLU OXT O N N 152 GLU H H N N 153 GLU H2 H N N 154 GLU HA H N N 155 GLU HB2 H N N 156 GLU HB3 H N N 157 GLU HG2 H N N 158 GLU HG3 H N N 159 GLU HE2 H N N 160 GLU HXT H N N 161 GLY N N N N 162 GLY CA C N N 163 GLY C C N N 164 GLY O O N N 165 GLY OXT O N N 166 GLY H H N N 167 GLY H2 H N N 168 GLY HA2 H N N 169 GLY HA3 H N N 170 GLY HXT H N N 171 HIS N N N N 172 HIS CA C N S 173 HIS C C N N 174 HIS O O N N 175 HIS CB C N N 176 HIS CG C Y N 177 HIS ND1 N Y N 178 HIS CD2 C Y N 179 HIS CE1 C Y N 180 HIS NE2 N Y N 181 HIS OXT O N N 182 HIS H H N N 183 HIS H2 H N N 184 HIS HA H N N 185 HIS HB2 H N N 186 HIS HB3 H N N 187 HIS HD1 H N N 188 HIS HD2 H N N 189 HIS HE1 H N N 190 HIS HE2 H N N 191 HIS HXT H N N 192 HOH O O N N 193 HOH H1 H N N 194 HOH H2 H N N 195 ILE N N N N 196 ILE CA C N S 197 ILE C C N N 198 ILE O O N N 199 ILE CB C N S 200 ILE CG1 C N N 201 ILE CG2 C N N 202 ILE CD1 C N N 203 ILE OXT O N N 204 ILE H H N N 205 ILE H2 H N N 206 ILE HA H N N 207 ILE HB H N N 208 ILE HG12 H N N 209 ILE HG13 H N N 210 ILE HG21 H N N 211 ILE HG22 H N N 212 ILE HG23 H N N 213 ILE HD11 H N N 214 ILE HD12 H N N 215 ILE HD13 H N N 216 ILE HXT H N N 217 LEU N N N N 218 LEU CA C N S 219 LEU C C N N 220 LEU O O N N 221 LEU CB C N N 222 LEU CG C N N 223 LEU CD1 C N N 224 LEU CD2 C N N 225 LEU OXT O N N 226 LEU H H N N 227 LEU H2 H N N 228 LEU HA H N N 229 LEU HB2 H N N 230 LEU HB3 H N N 231 LEU HG H N N 232 LEU HD11 H N N 233 LEU HD12 H N N 234 LEU HD13 H N N 235 LEU HD21 H N N 236 LEU HD22 H N N 237 LEU HD23 H N N 238 LEU HXT H N N 239 LYS N N N N 240 LYS CA C N S 241 LYS C C N N 242 LYS O O N N 243 LYS CB C N N 244 LYS CG C N N 245 LYS CD C N N 246 LYS CE C N N 247 LYS NZ N N N 248 LYS OXT O N N 249 LYS H H N N 250 LYS H2 H N N 251 LYS HA H N N 252 LYS HB2 H N N 253 LYS HB3 H N N 254 LYS HG2 H N N 255 LYS HG3 H N N 256 LYS HD2 H N N 257 LYS HD3 H N N 258 LYS HE2 H N N 259 LYS HE3 H N N 260 LYS HZ1 H N N 261 LYS HZ2 H N N 262 LYS HZ3 H N N 263 LYS HXT H N N 264 MET N N N N 265 MET CA C N S 266 MET C C N N 267 MET O O N N 268 MET CB C N N 269 MET CG C N N 270 MET SD S N N 271 MET CE C N N 272 MET OXT O N N 273 MET H H N N 274 MET H2 H N N 275 MET HA H N N 276 MET HB2 H N N 277 MET HB3 H N N 278 MET HG2 H N N 279 MET HG3 H N N 280 MET HE1 H N N 281 MET HE2 H N N 282 MET HE3 H N N 283 MET HXT H N N 284 PHE N N N N 285 PHE CA C N S 286 PHE C C N N 287 PHE O O N N 288 PHE CB C N N 289 PHE CG C Y N 290 PHE CD1 C Y N 291 PHE CD2 C Y N 292 PHE CE1 C Y N 293 PHE CE2 C Y N 294 PHE CZ C Y N 295 PHE OXT O N N 296 PHE H H N N 297 PHE H2 H N N 298 PHE HA H N N 299 PHE HB2 H N N 300 PHE HB3 H N N 301 PHE HD1 H N N 302 PHE HD2 H N N 303 PHE HE1 H N N 304 PHE HE2 H N N 305 PHE HZ H N N 306 PHE HXT H N N 307 PRO N N N N 308 PRO CA C N S 309 PRO C C N N 310 PRO O O N N 311 PRO CB C N N 312 PRO CG C N N 313 PRO CD C N N 314 PRO OXT O N N 315 PRO H H N N 316 PRO HA H N N 317 PRO HB2 H N N 318 PRO HB3 H N N 319 PRO HG2 H N N 320 PRO HG3 H N N 321 PRO HD2 H N N 322 PRO HD3 H N N 323 PRO HXT H N N 324 SER N N N N 325 SER CA C N S 326 SER C C N N 327 SER O O N N 328 SER CB C N N 329 SER OG O N N 330 SER OXT O N N 331 SER H H N N 332 SER H2 H N N 333 SER HA H N N 334 SER HB2 H N N 335 SER HB3 H N N 336 SER HG H N N 337 SER HXT H N N 338 THR N N N N 339 THR CA C N S 340 THR C C N N 341 THR O O N N 342 THR CB C N R 343 THR OG1 O N N 344 THR CG2 C N N 345 THR OXT O N N 346 THR H H N N 347 THR H2 H N N 348 THR HA H N N 349 THR HB H N N 350 THR HG1 H N N 351 THR HG21 H N N 352 THR HG22 H N N 353 THR HG23 H N N 354 THR HXT H N N 355 TYR N N N N 356 TYR CA C N S 357 TYR C C N N 358 TYR O O N N 359 TYR CB C N N 360 TYR CG C Y N 361 TYR CD1 C Y N 362 TYR CD2 C Y N 363 TYR CE1 C Y N 364 TYR CE2 C Y N 365 TYR CZ C Y N 366 TYR OH O N N 367 TYR OXT O N N 368 TYR H H N N 369 TYR H2 H N N 370 TYR HA H N N 371 TYR HB2 H N N 372 TYR HB3 H N N 373 TYR HD1 H N N 374 TYR HD2 H N N 375 TYR HE1 H N N 376 TYR HE2 H N N 377 TYR HH H N N 378 TYR HXT H N N 379 VAL N N N N 380 VAL CA C N S 381 VAL C C N N 382 VAL O O N N 383 VAL CB C N N 384 VAL CG1 C N N 385 VAL CG2 C N N 386 VAL OXT O N N 387 VAL H H N N 388 VAL H2 H N N 389 VAL HA H N N 390 VAL HB H N N 391 VAL HG11 H N N 392 VAL HG12 H N N 393 VAL HG13 H N N 394 VAL HG21 H N N 395 VAL HG22 H N N 396 VAL HG23 H N N 397 VAL HXT H N N 398 ZN ZN ZN N N 399 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal A1I45 C7 C8 sing N N 1 A1I45 C7 C6 sing N N 2 A1I45 O1 C14 doub N N 3 A1I45 N2 C14 sing N N 4 A1I45 N2 C6 doub N N 5 A1I45 C13 C8 doub Y N 6 A1I45 C13 C12 sing Y N 7 A1I45 C8 C9 sing Y N 8 A1I45 C14 C15 sing N N 9 A1I45 C6 N1 sing N N 10 A1I45 C12 C11 doub Y N 11 A1I45 C9 C10 doub Y N 12 A1I45 C11 C10 sing Y N 13 A1I45 O C sing N N 14 A1I45 C15 C5 doub Y N 15 A1I45 C15 C16 sing Y N 16 A1I45 N1 C5 sing N N 17 A1I45 C5 N sing Y N 18 A1I45 C16 C doub Y N 19 A1I45 C16 C4 sing Y N 20 A1I45 C C1 sing Y N 21 A1I45 N C4 sing Y N 22 A1I45 C4 C3 doub Y N 23 A1I45 C1 C2 doub Y N 24 A1I45 C3 C2 sing Y N 25 A1I45 C1 H1 sing N N 26 A1I45 C2 H2 sing N N 27 A1I45 C3 H3 sing N N 28 A1I45 C7 H4 sing N N 29 A1I45 C7 H5 sing N N 30 A1I45 C9 H6 sing N N 31 A1I45 C10 H7 sing N N 32 A1I45 C11 H8 sing N N 33 A1I45 C12 H9 sing N N 34 A1I45 C13 H10 sing N N 35 A1I45 N H11 sing N N 36 A1I45 O H12 sing N N 37 A1I45 N1 H13 sing N N 38 ALA N CA sing N N 39 ALA N H sing N N 40 ALA N H2 sing N N 41 ALA CA C sing N N 42 ALA CA CB sing N N 43 ALA CA HA sing N N 44 ALA C O doub N N 45 ALA C OXT sing N N 46 ALA CB HB1 sing N N 47 ALA CB HB2 sing N N 48 ALA CB HB3 sing N N 49 ALA OXT HXT sing N N 50 ARG N CA sing N N 51 ARG N H sing N N 52 ARG N H2 sing N N 53 ARG CA C sing N N 54 ARG CA CB sing N N 55 ARG CA HA sing N N 56 ARG C O doub N N 57 ARG C OXT sing N N 58 ARG CB CG sing N N 59 ARG CB HB2 sing N N 60 ARG CB HB3 sing N N 61 ARG CG CD sing N N 62 ARG CG HG2 sing N N 63 ARG CG HG3 sing N N 64 ARG CD NE sing N N 65 ARG CD HD2 sing N N 66 ARG CD HD3 sing N N 67 ARG NE CZ sing N N 68 ARG NE HE sing N N 69 ARG CZ NH1 sing N N 70 ARG CZ NH2 doub N N 71 ARG NH1 HH11 sing N N 72 ARG NH1 HH12 sing N N 73 ARG NH2 HH21 sing N N 74 ARG NH2 HH22 sing N N 75 ARG OXT HXT sing N N 76 ASN N CA sing N N 77 ASN N H sing N N 78 ASN N H2 sing N N 79 ASN CA C sing N N 80 ASN CA CB sing N N 81 ASN CA HA sing N N 82 ASN C O doub N N 83 ASN C OXT sing N N 84 ASN CB CG sing N N 85 ASN CB HB2 sing N N 86 ASN CB HB3 sing N N 87 ASN CG OD1 doub N N 88 ASN CG ND2 sing N N 89 ASN ND2 HD21 sing N N 90 ASN ND2 HD22 sing N N 91 ASN OXT HXT sing N N 92 ASP N CA sing N N 93 ASP N H sing N N 94 ASP N H2 sing N N 95 ASP CA C sing N N 96 ASP CA CB sing N N 97 ASP CA HA sing N N 98 ASP C O doub N N 99 ASP C OXT sing N N 100 ASP CB CG sing N N 101 ASP CB HB2 sing N N 102 ASP CB HB3 sing N N 103 ASP CG OD1 doub N N 104 ASP CG OD2 sing N N 105 ASP OD2 HD2 sing N N 106 ASP OXT HXT sing N N 107 CYS N CA sing N N 108 CYS N H sing N N 109 CYS N H2 sing N N 110 CYS CA C sing N N 111 CYS CA CB sing N N 112 CYS CA HA sing N N 113 CYS C O doub N N 114 CYS C OXT sing N N 115 CYS CB SG sing N N 116 CYS CB HB2 sing N N 117 CYS CB HB3 sing N N 118 CYS SG HG sing N N 119 CYS OXT HXT sing N N 120 GLN N CA sing N N 121 GLN N H sing N N 122 GLN N H2 sing N N 123 GLN CA C sing N N 124 GLN CA CB sing N N 125 GLN CA HA sing N N 126 GLN C O doub N N 127 GLN C OXT sing N N 128 GLN CB CG sing N N 129 GLN CB HB2 sing N N 130 GLN CB HB3 sing N N 131 GLN CG CD sing N N 132 GLN CG HG2 sing N N 133 GLN CG HG3 sing N N 134 GLN CD OE1 doub N N 135 GLN CD NE2 sing N N 136 GLN NE2 HE21 sing N N 137 GLN NE2 HE22 sing N N 138 GLN OXT HXT sing N N 139 GLU N CA sing N N 140 GLU N H sing N N 141 GLU N H2 sing N N 142 GLU CA C sing N N 143 GLU CA CB sing N N 144 GLU CA HA sing N N 145 GLU C O doub N N 146 GLU C OXT sing N N 147 GLU CB CG sing N N 148 GLU CB HB2 sing N N 149 GLU CB HB3 sing N N 150 GLU CG CD sing N N 151 GLU CG HG2 sing N N 152 GLU CG HG3 sing N N 153 GLU CD OE1 doub N N 154 GLU CD OE2 sing N N 155 GLU OE2 HE2 sing N N 156 GLU OXT HXT sing N N 157 GLY N CA sing N N 158 GLY N H sing N N 159 GLY N H2 sing N N 160 GLY CA C sing N N 161 GLY CA HA2 sing N N 162 GLY CA HA3 sing N N 163 GLY C O doub N N 164 GLY C OXT sing N N 165 GLY OXT HXT sing N N 166 HIS N CA sing N N 167 HIS N H sing N N 168 HIS N H2 sing N N 169 HIS CA C sing N N 170 HIS CA CB sing N N 171 HIS CA HA sing N N 172 HIS C O doub N N 173 HIS C OXT sing N N 174 HIS CB CG sing N N 175 HIS CB HB2 sing N N 176 HIS CB HB3 sing N N 177 HIS CG ND1 sing Y N 178 HIS CG CD2 doub Y N 179 HIS ND1 CE1 doub Y N 180 HIS ND1 HD1 sing N N 181 HIS CD2 NE2 sing Y N 182 HIS CD2 HD2 sing N N 183 HIS CE1 NE2 sing Y N 184 HIS CE1 HE1 sing N N 185 HIS NE2 HE2 sing N N 186 HIS OXT HXT sing N N 187 HOH O H1 sing N N 188 HOH O H2 sing N N 189 ILE N CA sing N N 190 ILE N H sing N N 191 ILE N H2 sing N N 192 ILE CA C sing N N 193 ILE CA CB sing N N 194 ILE CA HA sing N N 195 ILE C O doub N N 196 ILE C OXT sing N N 197 ILE CB CG1 sing N N 198 ILE CB CG2 sing N N 199 ILE CB HB sing N N 200 ILE CG1 CD1 sing N N 201 ILE CG1 HG12 sing N N 202 ILE CG1 HG13 sing N N 203 ILE CG2 HG21 sing N N 204 ILE CG2 HG22 sing N N 205 ILE CG2 HG23 sing N N 206 ILE CD1 HD11 sing N N 207 ILE CD1 HD12 sing N N 208 ILE CD1 HD13 sing N N 209 ILE OXT HXT sing N N 210 LEU N CA sing N N 211 LEU N H sing N N 212 LEU N H2 sing N N 213 LEU CA C sing N N 214 LEU CA CB sing N N 215 LEU CA HA sing N N 216 LEU C O doub N N 217 LEU C OXT sing N N 218 LEU CB CG sing N N 219 LEU CB HB2 sing N N 220 LEU CB HB3 sing N N 221 LEU CG CD1 sing N N 222 LEU CG CD2 sing N N 223 LEU CG HG sing N N 224 LEU CD1 HD11 sing N N 225 LEU CD1 HD12 sing N N 226 LEU CD1 HD13 sing N N 227 LEU CD2 HD21 sing N N 228 LEU CD2 HD22 sing N N 229 LEU CD2 HD23 sing N N 230 LEU OXT HXT sing N N 231 LYS N CA sing N N 232 LYS N H sing N N 233 LYS N H2 sing N N 234 LYS CA C sing N N 235 LYS CA CB sing N N 236 LYS CA HA sing N N 237 LYS C O doub N N 238 LYS C OXT sing N N 239 LYS CB CG sing N N 240 LYS CB HB2 sing N N 241 LYS CB HB3 sing N N 242 LYS CG CD sing N N 243 LYS CG HG2 sing N N 244 LYS CG HG3 sing N N 245 LYS CD CE sing N N 246 LYS CD HD2 sing N N 247 LYS CD HD3 sing N N 248 LYS CE NZ sing N N 249 LYS CE HE2 sing N N 250 LYS CE HE3 sing N N 251 LYS NZ HZ1 sing N N 252 LYS NZ HZ2 sing N N 253 LYS NZ HZ3 sing N N 254 LYS OXT HXT sing N N 255 MET N CA sing N N 256 MET N H sing N N 257 MET N H2 sing N N 258 MET CA C sing N N 259 MET CA CB sing N N 260 MET CA HA sing N N 261 MET C O doub N N 262 MET C OXT sing N N 263 MET CB CG sing N N 264 MET CB HB2 sing N N 265 MET CB HB3 sing N N 266 MET CG SD sing N N 267 MET CG HG2 sing N N 268 MET CG HG3 sing N N 269 MET SD CE sing N N 270 MET CE HE1 sing N N 271 MET CE HE2 sing N N 272 MET CE HE3 sing N N 273 MET OXT HXT sing N N 274 PHE N CA sing N N 275 PHE N H sing N N 276 PHE N H2 sing N N 277 PHE CA C sing N N 278 PHE CA CB sing N N 279 PHE CA HA sing N N 280 PHE C O doub N N 281 PHE C OXT sing N N 282 PHE CB CG sing N N 283 PHE CB HB2 sing N N 284 PHE CB HB3 sing N N 285 PHE CG CD1 doub Y N 286 PHE CG CD2 sing Y N 287 PHE CD1 CE1 sing Y N 288 PHE CD1 HD1 sing N N 289 PHE CD2 CE2 doub Y N 290 PHE CD2 HD2 sing N N 291 PHE CE1 CZ doub Y N 292 PHE CE1 HE1 sing N N 293 PHE CE2 CZ sing Y N 294 PHE CE2 HE2 sing N N 295 PHE CZ HZ sing N N 296 PHE OXT HXT sing N N 297 PRO N CA sing N N 298 PRO N CD sing N N 299 PRO N H sing N N 300 PRO CA C sing N N 301 PRO CA CB sing N N 302 PRO CA HA sing N N 303 PRO C O doub N N 304 PRO C OXT sing N N 305 PRO CB CG sing N N 306 PRO CB HB2 sing N N 307 PRO CB HB3 sing N N 308 PRO CG CD sing N N 309 PRO CG HG2 sing N N 310 PRO CG HG3 sing N N 311 PRO CD HD2 sing N N 312 PRO CD HD3 sing N N 313 PRO OXT HXT sing N N 314 SER N CA sing N N 315 SER N H sing N N 316 SER N H2 sing N N 317 SER CA C sing N N 318 SER CA CB sing N N 319 SER CA HA sing N N 320 SER C O doub N N 321 SER C OXT sing N N 322 SER CB OG sing N N 323 SER CB HB2 sing N N 324 SER CB HB3 sing N N 325 SER OG HG sing N N 326 SER OXT HXT sing N N 327 THR N CA sing N N 328 THR N H sing N N 329 THR N H2 sing N N 330 THR CA C sing N N 331 THR CA CB sing N N 332 THR CA HA sing N N 333 THR C O doub N N 334 THR C OXT sing N N 335 THR CB OG1 sing N N 336 THR CB CG2 sing N N 337 THR CB HB sing N N 338 THR OG1 HG1 sing N N 339 THR CG2 HG21 sing N N 340 THR CG2 HG22 sing N N 341 THR CG2 HG23 sing N N 342 THR OXT HXT sing N N 343 TYR N CA sing N N 344 TYR N H sing N N 345 TYR N H2 sing N N 346 TYR CA C sing N N 347 TYR CA CB sing N N 348 TYR CA HA sing N N 349 TYR C O doub N N 350 TYR C OXT sing N N 351 TYR CB CG sing N N 352 TYR CB HB2 sing N N 353 TYR CB HB3 sing N N 354 TYR CG CD1 doub Y N 355 TYR CG CD2 sing Y N 356 TYR CD1 CE1 sing Y N 357 TYR CD1 HD1 sing N N 358 TYR CD2 CE2 doub Y N 359 TYR CD2 HD2 sing N N 360 TYR CE1 CZ doub Y N 361 TYR CE1 HE1 sing N N 362 TYR CE2 CZ sing Y N 363 TYR CE2 HE2 sing N N 364 TYR CZ OH sing N N 365 TYR OH HH sing N N 366 TYR OXT HXT sing N N 367 VAL N CA sing N N 368 VAL N H sing N N 369 VAL N H2 sing N N 370 VAL CA C sing N N 371 VAL CA CB sing N N 372 VAL CA HA sing N N 373 VAL C O doub N N 374 VAL C OXT sing N N 375 VAL CB CG1 sing N N 376 VAL CB CG2 sing N N 377 VAL CB HB sing N N 378 VAL CG1 HG11 sing N N 379 VAL CG1 HG12 sing N N 380 VAL CG1 HG13 sing N N 381 VAL CG2 HG21 sing N N 382 VAL CG2 HG22 sing N N 383 VAL CG2 HG23 sing N N 384 VAL OXT HXT sing N N 385 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name Other _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.details 'internal model' # _atom_sites.entry_id 9QAD _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.015619 _atom_sites.fract_transf_matrix[1][2] 0.009018 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.018036 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011238 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S ZN # loop_ # loop_ #