data_9QAL # _entry.id 9QAL # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.410 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9QAL pdb_00009qal 10.2210/pdb9qal/pdb WWPDB D_1292145549 ? ? BMRB 34984 ? 10.13018/BMR34984 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-03-11 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _database_PDB_caveat.id _database_PDB_caveat.text 1 'LYS A 1 HAS WRONG CHIRALITY AT ATOM CA' 2 'LYS A 3 HAS WRONG CHIRALITY AT ATOM CA' 3 'ASP A 5 HAS WRONG CHIRALITY AT ATOM CA' 4 'SER A 10 HAS WRONG CHIRALITY AT ATOM CA' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr . _pdbx_database_status.entry_id 9QAL _pdbx_database_status.recvd_initial_deposition_date 2025-02-28 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs . _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Solution NMR strucure of Arkadia 2 RING domain' _pdbx_database_related.db_id 34984 _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email g.a.spyroulias@upatras.gr _pdbx_contact_author.name_first Georgios _pdbx_contact_author.name_last Spyroulias _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-1799-3312 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Marousis, K.D.' 1 ? 'Giannari, D.' 2 ? 'Seliami, A.' 3 ? 'Politi, M.' 4 ? 'Birkou, M.' 5 ? 'Bentrop, D.' 6 ? 'Episkopou, V.' 7 ? 'Spyroulias, G.A.' 8 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Mechanistic insights into the Auto-ubiquitiniation of ARKADIA 2C RING domain' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Marousis, K.D.' 1 ? primary 'Politi, M.D.' 2 ? primary 'Giannari, D.' 3 ? primary 'Seliami, A.' 4 ? primary 'Birkou, M.' 5 ? primary 'Bentrop, D.' 6 ? primary 'Episkopou, V.' 7 ? primary 'Spyroulias, G.A.' 8 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'E3 ubiquitin-protein ligase ARK2C' 7740.865 1 2.3.2.27 ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'RING finger protein 165,RNF165' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code KGKKDEGEESDTDEKCTICLSMLEDGEDVRRLPCMHLFHQLCVDQWLAMSKKCPICRVDIETQLGADS _entity_poly.pdbx_seq_one_letter_code_can KGKKDEGEESDTDEKCTICLSMLEDGEDVRRLPCMHLFHQLCVDQWLAMSKKCPICRVDIETQLGADS _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LYS n 1 2 GLY n 1 3 LYS n 1 4 LYS n 1 5 ASP n 1 6 GLU n 1 7 GLY n 1 8 GLU n 1 9 GLU n 1 10 SER n 1 11 ASP n 1 12 THR n 1 13 ASP n 1 14 GLU n 1 15 LYS n 1 16 CYS n 1 17 THR n 1 18 ILE n 1 19 CYS n 1 20 LEU n 1 21 SER n 1 22 MET n 1 23 LEU n 1 24 GLU n 1 25 ASP n 1 26 GLY n 1 27 GLU n 1 28 ASP n 1 29 VAL n 1 30 ARG n 1 31 ARG n 1 32 LEU n 1 33 PRO n 1 34 CYS n 1 35 MET n 1 36 HIS n 1 37 LEU n 1 38 PHE n 1 39 HIS n 1 40 GLN n 1 41 LEU n 1 42 CYS n 1 43 VAL n 1 44 ASP n 1 45 GLN n 1 46 TRP n 1 47 LEU n 1 48 ALA n 1 49 MET n 1 50 SER n 1 51 LYS n 1 52 LYS n 1 53 CYS n 1 54 PRO n 1 55 ILE n 1 56 CYS n 1 57 ARG n 1 58 VAL n 1 59 ASP n 1 60 ILE n 1 61 GLU n 1 62 THR n 1 63 GLN n 1 64 LEU n 1 65 GLY n 1 66 ALA n 1 67 ASP n 1 68 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 68 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'ARK2C, RNF165' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pGex-47-1 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LYS 1 1 1 LYS LYS A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 ASP 5 5 5 ASP ASP A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 CYS 16 16 16 CYS CYS A . n A 1 17 THR 17 17 17 THR THR A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 CYS 19 19 19 CYS CYS A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 MET 22 22 22 MET MET A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 ARG 30 30 30 ARG ARG A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 PRO 33 33 33 PRO PRO A . n A 1 34 CYS 34 34 34 CYS CYS A . n A 1 35 MET 35 35 35 MET MET A . n A 1 36 HIS 36 36 36 HIS HIS A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 PHE 38 38 38 PHE PHE A . n A 1 39 HIS 39 39 39 HIS HIS A . n A 1 40 GLN 40 40 40 GLN GLN A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 CYS 42 42 42 CYS CYS A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 GLN 45 45 45 GLN GLN A . n A 1 46 TRP 46 46 46 TRP TRP A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 MET 49 49 49 MET MET A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 CYS 53 53 53 CYS CYS A . n A 1 54 PRO 54 54 54 PRO PRO A . n A 1 55 ILE 55 55 55 ILE ILE A . n A 1 56 CYS 56 56 56 CYS CYS A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 THR 62 62 62 THR THR A . n A 1 63 GLN 63 63 63 GLN GLN A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 SER 68 68 68 SER SER A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 101 69 ZN ZN A . C 2 ZN 1 102 70 ZN ZN A . # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9QAL _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 9QAL _struct.title 'Solution NMR structure of Arkadia 2 RING domain' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9QAL _struct_keywords.text 'Arkadia 2, Arkadia, RNF165, E3 Ub ligase, RING domain, E2 enzyme, TGF-b pathway, UbcH5b, LIGASE' _struct_keywords.pdbx_keywords LIGASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ARK2C_HUMAN _struct_ref.pdbx_db_accession Q6ZSG1 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code KGKKDEGEESDTDEKCTICLSMLEDGEDVRRLPCMHLFHQLCVDQWLAMSKKCPICRVDIETQLGADS _struct_ref.pdbx_align_begin 279 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9QAL _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 68 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q6ZSG1 _struct_ref_seq.db_align_beg 279 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 346 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 68 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'NMR Distance Restraints' _pdbx_struct_assembly_auth_evidence.details 'not applicable' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0 _pdbx_struct_oper_list.matrix[1][2] 0.0 _pdbx_struct_oper_list.matrix[1][3] 0.0 _pdbx_struct_oper_list.vector[1] 0.0 _pdbx_struct_oper_list.matrix[2][1] 0.0 _pdbx_struct_oper_list.matrix[2][2] 1.0 _pdbx_struct_oper_list.matrix[2][3] 0.0 _pdbx_struct_oper_list.vector[2] 0.0 _pdbx_struct_oper_list.matrix[3][1] 0.0 _pdbx_struct_oper_list.matrix[3][2] 0.0 _pdbx_struct_oper_list.matrix[3][3] 1.0 _pdbx_struct_oper_list.vector[3] 0.0 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id GLN _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 40 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id SER _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 50 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id GLN _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 40 _struct_conf.end_auth_comp_id SER _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 50 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 16 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 16 A ZN 101 1_555 ? ? ? ? ? ? ? 2.133 ? ? metalc2 metalc ? ? A CYS 19 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 19 A ZN 101 1_555 ? ? ? ? ? ? ? 2.131 ? ? metalc3 metalc ? ? A CYS 34 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 34 A ZN 102 1_555 ? ? ? ? ? ? ? 2.098 ? ? metalc4 metalc ? ? A HIS 36 ND1 ? ? ? 1_555 C ZN . ZN ? ? A HIS 36 A ZN 102 1_555 ? ? ? ? ? ? ? 2.154 ? ? metalc5 metalc ? ? A HIS 39 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 39 A ZN 101 1_555 ? ? ? ? ? ? ? 2.110 ? ? metalc6 metalc ? ? A CYS 42 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 42 A ZN 101 1_555 ? ? ? ? ? ? ? 2.021 ? ? metalc7 metalc ? ? A CYS 53 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 53 A ZN 102 1_555 ? ? ? ? ? ? ? 2.175 ? ? metalc8 metalc ? ? A CYS 56 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 56 A ZN 102 1_555 ? ? ? ? ? ? ? 2.123 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 16 ? A CYS 16 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 SG ? A CYS 19 ? A CYS 19 ? 1_555 78.6 ? 2 SG ? A CYS 16 ? A CYS 16 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 ND1 ? A HIS 39 ? A HIS 39 ? 1_555 105.6 ? 3 SG ? A CYS 19 ? A CYS 19 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 ND1 ? A HIS 39 ? A HIS 39 ? 1_555 122.7 ? 4 SG ? A CYS 16 ? A CYS 16 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 SG ? A CYS 42 ? A CYS 42 ? 1_555 112.8 ? 5 SG ? A CYS 19 ? A CYS 19 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 SG ? A CYS 42 ? A CYS 42 ? 1_555 122.5 ? 6 ND1 ? A HIS 39 ? A HIS 39 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 SG ? A CYS 42 ? A CYS 42 ? 1_555 108.5 ? 7 SG ? A CYS 34 ? A CYS 34 ? 1_555 ZN ? C ZN . ? A ZN 102 ? 1_555 ND1 ? A HIS 36 ? A HIS 36 ? 1_555 113.6 ? 8 SG ? A CYS 34 ? A CYS 34 ? 1_555 ZN ? C ZN . ? A ZN 102 ? 1_555 SG ? A CYS 53 ? A CYS 53 ? 1_555 110.2 ? 9 ND1 ? A HIS 36 ? A HIS 36 ? 1_555 ZN ? C ZN . ? A ZN 102 ? 1_555 SG ? A CYS 53 ? A CYS 53 ? 1_555 118.1 ? 10 SG ? A CYS 34 ? A CYS 34 ? 1_555 ZN ? C ZN . ? A ZN 102 ? 1_555 SG ? A CYS 56 ? A CYS 56 ? 1_555 107.4 ? 11 ND1 ? A HIS 36 ? A HIS 36 ? 1_555 ZN ? C ZN . ? A ZN 102 ? 1_555 SG ? A CYS 56 ? A CYS 56 ? 1_555 95.0 ? 12 SG ? A CYS 53 ? A CYS 53 ? 1_555 ZN ? C ZN . ? A ZN 102 ? 1_555 SG ? A CYS 56 ? A CYS 56 ? 1_555 111.1 ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id LYS _struct_mon_prot_cis.label_seq_id 4 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id LYS _struct_mon_prot_cis.auth_seq_id 4 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 ASP _struct_mon_prot_cis.pdbx_label_seq_id_2 5 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 ASP _struct_mon_prot_cis.pdbx_auth_seq_id_2 5 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -16.98 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 29 ? ARG A 30 ? VAL A 29 ARG A 30 AA1 2 PHE A 38 ? HIS A 39 ? PHE A 38 HIS A 39 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id ARG _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 30 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id ARG _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 30 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id PHE _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 38 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id PHE _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 38 # _pdbx_entry_details.entry_id 9QAL _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 3 ? ? 92.99 108.29 2 1 LYS A 4 ? ? 100.38 128.70 3 1 ASP A 5 ? ? 106.83 -174.31 4 1 GLU A 6 ? ? 31.16 -170.77 5 1 GLU A 9 ? ? -24.20 60.31 6 1 ASP A 11 ? ? -151.62 83.30 7 1 THR A 12 ? ? -60.47 73.11 8 1 ASP A 13 ? ? -152.91 78.35 9 1 GLU A 14 ? ? 178.51 -34.69 10 1 LYS A 15 ? ? 52.64 18.82 11 1 CYS A 16 ? ? 44.03 74.69 12 1 LEU A 20 ? ? 35.89 52.81 13 1 SER A 21 ? ? -131.22 -103.38 14 1 ASP A 25 ? ? -152.90 36.44 15 1 GLU A 27 ? ? -126.80 -68.68 16 1 ASP A 28 ? ? -177.47 135.47 17 1 ARG A 31 ? ? -144.12 31.10 18 1 LEU A 32 ? ? 46.70 -159.23 19 1 MET A 35 ? ? 148.39 -30.84 20 1 LYS A 51 ? ? -143.26 40.83 21 1 LYS A 52 ? ? -160.68 114.39 22 1 CYS A 53 ? ? -37.69 115.10 23 1 ARG A 57 ? ? 61.72 -6.62 24 1 ILE A 60 ? ? 37.69 -97.87 25 1 GLU A 61 ? ? 160.56 -64.41 26 1 THR A 62 ? ? -141.78 22.65 27 1 GLN A 63 ? ? 50.46 -83.84 28 2 LYS A 3 ? ? -140.57 -70.75 29 2 GLU A 14 ? ? -168.79 -30.92 30 2 LYS A 15 ? ? 69.13 -0.56 31 2 CYS A 16 ? ? 57.14 77.65 32 2 LEU A 20 ? ? 91.08 32.63 33 2 MET A 22 ? ? 43.14 100.58 34 2 ASP A 25 ? ? -159.07 30.94 35 2 GLU A 27 ? ? -105.74 -64.89 36 2 ASP A 28 ? ? 178.91 136.17 37 2 ARG A 31 ? ? -147.21 29.23 38 2 LEU A 32 ? ? 48.10 -161.19 39 2 MET A 35 ? ? 151.94 -36.29 40 2 SER A 50 ? ? -154.64 89.54 41 2 LYS A 52 ? ? -165.83 118.27 42 2 ILE A 60 ? ? 37.70 -99.63 43 2 GLU A 61 ? ? 169.84 -52.13 44 2 GLN A 63 ? ? 63.24 -81.34 45 3 LYS A 4 ? ? 68.69 -8.16 46 3 ASP A 5 ? ? -127.93 -100.81 47 3 GLU A 6 ? ? -140.09 28.03 48 3 SER A 10 ? ? 76.72 158.15 49 3 ASP A 13 ? ? -141.63 32.81 50 3 GLU A 14 ? ? -141.63 -30.56 51 3 CYS A 16 ? ? 52.25 73.85 52 3 LEU A 20 ? ? 62.38 63.79 53 3 SER A 21 ? ? -134.56 -120.18 54 3 ASP A 25 ? ? -145.06 30.25 55 3 ASP A 28 ? ? 178.01 136.32 56 3 ARG A 31 ? ? -147.77 32.77 57 3 LEU A 32 ? ? 45.60 -154.58 58 3 MET A 35 ? ? 144.79 -29.94 59 3 ILE A 60 ? ? 37.75 -97.32 60 3 GLU A 61 ? ? 168.86 -58.90 61 3 GLN A 63 ? ? 62.31 -78.77 62 3 ALA A 66 ? ? -64.55 91.71 63 3 ASP A 67 ? ? -147.87 -81.23 64 4 LYS A 4 ? ? 68.14 -8.17 65 4 ASP A 5 ? ? -128.07 -100.92 66 4 GLU A 6 ? ? -140.05 28.39 67 4 SER A 10 ? ? 76.49 157.98 68 4 ASP A 13 ? ? -141.29 33.41 69 4 GLU A 14 ? ? -142.03 -30.18 70 4 CYS A 16 ? ? 52.43 73.48 71 4 LEU A 20 ? ? 61.86 63.97 72 4 SER A 21 ? ? -134.38 -119.80 73 4 ASP A 25 ? ? -145.40 30.60 74 4 ASP A 28 ? ? 177.56 136.31 75 4 ARG A 31 ? ? -147.89 32.56 76 4 LEU A 32 ? ? 45.89 -154.42 77 4 MET A 35 ? ? 144.38 -30.02 78 4 ILE A 60 ? ? 38.26 -97.90 79 4 GLU A 61 ? ? 169.34 -59.12 80 4 GLN A 63 ? ? 62.46 -78.78 81 4 ALA A 66 ? ? -64.32 91.66 82 4 ASP A 67 ? ? -147.97 -81.58 83 5 ASP A 5 ? ? 51.63 -150.61 84 5 SER A 10 ? ? -152.43 67.48 85 5 ASP A 13 ? ? -157.57 86.69 86 5 GLU A 14 ? ? -161.51 -40.35 87 5 CYS A 16 ? ? 55.74 82.69 88 5 LEU A 20 ? ? 71.20 66.72 89 5 SER A 21 ? ? -138.26 -109.05 90 5 ASP A 25 ? ? -141.28 24.57 91 5 GLU A 27 ? ? -81.10 -74.99 92 5 ASP A 28 ? ? 178.16 136.70 93 5 ARG A 31 ? ? -144.47 30.08 94 5 LEU A 32 ? ? 48.81 -161.00 95 5 MET A 35 ? ? 150.87 -34.34 96 5 SER A 50 ? ? -134.84 -66.57 97 5 ILE A 60 ? ? 38.41 -95.85 98 5 GLU A 61 ? ? 159.24 -56.39 99 5 GLN A 63 ? ? 58.52 -79.39 100 6 GLU A 6 ? ? 63.34 86.84 101 6 GLU A 8 ? ? -154.09 36.13 102 6 GLU A 9 ? ? -96.38 48.08 103 6 ASP A 11 ? ? -104.72 74.85 104 6 ASP A 13 ? ? -156.18 76.68 105 6 GLU A 14 ? ? -171.40 -34.53 106 6 CYS A 16 ? ? 51.42 75.07 107 6 LEU A 20 ? ? 72.64 63.78 108 6 SER A 21 ? ? -134.88 -116.53 109 6 ASP A 28 ? ? 179.68 121.23 110 6 MET A 35 ? ? 151.39 -37.35 111 6 ILE A 55 ? ? -79.09 -70.27 112 6 ILE A 60 ? ? 39.43 -97.88 113 6 GLU A 61 ? ? 163.17 -52.56 114 6 GLN A 63 ? ? 55.43 -84.84 115 6 LEU A 64 ? ? -76.17 -82.55 116 6 ASP A 67 ? ? 63.51 128.40 117 7 LYS A 3 ? ? 27.22 -103.75 118 7 LYS A 4 ? ? 114.22 147.87 119 7 ASP A 5 ? ? 40.75 -125.76 120 7 ASP A 13 ? ? -153.03 62.51 121 7 GLU A 14 ? ? -149.30 -36.46 122 7 LYS A 15 ? ? 75.57 -2.10 123 7 CYS A 16 ? ? 58.25 77.05 124 7 LEU A 20 ? ? 81.04 54.42 125 7 MET A 22 ? ? 36.38 98.23 126 7 GLU A 27 ? ? -123.44 -70.87 127 7 ASP A 28 ? ? -177.86 131.78 128 7 ARG A 31 ? ? -146.10 28.44 129 7 LEU A 32 ? ? 47.94 -161.02 130 7 MET A 35 ? ? 150.68 -35.57 131 7 LYS A 51 ? ? -100.45 54.47 132 7 ILE A 60 ? ? 38.08 -97.17 133 7 GLU A 61 ? ? 168.06 -60.30 134 7 THR A 62 ? ? -141.53 18.22 135 7 GLN A 63 ? ? 60.99 -81.60 136 8 LYS A 3 ? ? 52.47 -156.81 137 8 LYS A 4 ? ? -163.02 35.03 138 8 GLU A 6 ? ? 62.33 -170.76 139 8 GLU A 8 ? ? 67.96 109.27 140 8 GLU A 14 ? ? -170.23 -34.71 141 8 CYS A 16 ? ? 53.81 75.42 142 8 LEU A 20 ? ? 73.51 63.21 143 8 SER A 21 ? ? -135.85 -111.51 144 8 ASP A 25 ? ? -155.42 55.44 145 8 GLU A 27 ? ? -111.60 -70.10 146 8 ASP A 28 ? ? -177.01 125.54 147 8 ARG A 31 ? ? -145.85 30.86 148 8 LEU A 32 ? ? 46.57 -165.01 149 8 CYS A 34 ? ? -70.74 -72.69 150 8 MET A 35 ? ? 154.71 -36.53 151 8 LYS A 51 ? ? -151.05 48.80 152 8 LYS A 52 ? ? -168.40 110.19 153 8 CYS A 53 ? ? -34.70 118.15 154 8 ILE A 55 ? ? -93.10 -68.26 155 8 ILE A 60 ? ? 38.96 -99.51 156 8 GLU A 61 ? ? 163.49 -54.52 157 8 THR A 62 ? ? -140.25 18.37 158 8 GLN A 63 ? ? 47.54 -86.30 159 8 ASP A 67 ? ? -157.03 -62.95 160 9 LYS A 4 ? ? -174.91 44.09 161 9 ASP A 5 ? ? -162.36 83.69 162 9 GLU A 6 ? ? 38.27 -135.35 163 9 GLU A 8 ? ? 28.88 76.94 164 9 SER A 10 ? ? 64.51 -151.67 165 9 GLU A 14 ? ? 179.05 -53.70 166 9 LYS A 15 ? ? 89.59 2.22 167 9 CYS A 16 ? ? 56.78 77.05 168 9 LEU A 20 ? ? 80.63 58.32 169 9 SER A 21 ? ? -128.47 -106.63 170 9 ASP A 25 ? ? -150.83 21.20 171 9 GLU A 27 ? ? -109.16 -66.55 172 9 ASP A 28 ? ? -178.26 125.78 173 9 ARG A 31 ? ? -147.34 28.08 174 9 LEU A 32 ? ? 46.18 -166.80 175 9 MET A 35 ? ? 150.33 -32.85 176 9 LYS A 51 ? ? -147.91 45.19 177 9 LYS A 52 ? ? -165.99 110.32 178 9 CYS A 53 ? ? -34.18 118.75 179 9 ILE A 55 ? ? -97.96 -68.47 180 9 ILE A 60 ? ? 37.87 -98.96 181 9 GLU A 61 ? ? 164.89 -51.41 182 9 THR A 62 ? ? -140.45 14.37 183 9 GLN A 63 ? ? 51.41 -83.38 184 10 LYS A 3 ? ? 171.54 -60.79 185 10 GLU A 8 ? ? 44.98 95.11 186 10 GLU A 14 ? ? -165.10 -35.33 187 10 CYS A 16 ? ? 53.37 76.93 188 10 LEU A 20 ? ? 68.58 69.04 189 10 SER A 21 ? ? -139.30 -106.09 190 10 ASP A 25 ? ? -166.34 20.85 191 10 GLU A 27 ? ? -125.78 -64.21 192 10 ASP A 28 ? ? 175.09 138.22 193 10 ARG A 31 ? ? -145.89 31.22 194 10 LEU A 32 ? ? 46.90 -161.42 195 10 MET A 35 ? ? 149.54 -34.40 196 10 LYS A 51 ? ? -164.73 36.16 197 10 LYS A 52 ? ? -163.34 112.79 198 10 CYS A 53 ? ? -34.89 118.15 199 10 ILE A 55 ? ? -82.47 -71.24 200 10 ILE A 60 ? ? 37.81 -96.91 201 10 GLU A 61 ? ? 160.65 -50.73 202 10 GLN A 63 ? ? 50.19 -84.69 203 11 LYS A 3 ? ? 174.28 161.74 204 11 LYS A 4 ? ? 57.72 19.90 205 11 SER A 10 ? ? -159.55 78.60 206 11 ASP A 13 ? ? -142.66 37.78 207 11 GLU A 14 ? ? -155.98 -32.82 208 11 CYS A 16 ? ? 54.71 77.34 209 11 LEU A 20 ? ? 73.02 68.89 210 11 SER A 21 ? ? -140.17 -105.10 211 11 ASP A 25 ? ? -146.93 29.64 212 11 GLU A 27 ? ? -100.67 -65.11 213 11 ASP A 28 ? ? 176.54 135.69 214 11 ARG A 31 ? ? -145.42 32.77 215 11 LEU A 32 ? ? 44.99 -163.25 216 11 MET A 35 ? ? 150.50 -35.98 217 11 LYS A 51 ? ? -156.78 39.04 218 11 LYS A 52 ? ? -170.40 111.47 219 11 CYS A 53 ? ? -34.46 118.84 220 11 ILE A 55 ? ? -87.12 -71.63 221 11 ARG A 57 ? ? 66.45 -1.19 222 11 ILE A 60 ? ? 38.72 -98.16 223 11 GLU A 61 ? ? 161.12 -55.90 224 11 GLN A 63 ? ? 53.59 -85.32 225 12 LYS A 4 ? ? -149.60 28.57 226 12 GLU A 6 ? ? 38.52 -149.46 227 12 SER A 10 ? ? 67.57 175.55 228 12 ASP A 13 ? ? -146.70 58.33 229 12 GLU A 14 ? ? -158.37 -37.09 230 12 CYS A 16 ? ? 53.06 76.25 231 12 LEU A 20 ? ? 77.81 64.22 232 12 SER A 21 ? ? -137.03 -115.55 233 12 ASP A 25 ? ? -152.06 52.88 234 12 GLU A 27 ? ? -121.71 -61.81 235 12 ASP A 28 ? ? 172.87 125.86 236 12 ARG A 31 ? ? -144.62 31.24 237 12 LEU A 32 ? ? 46.13 -165.55 238 12 CYS A 34 ? ? -67.37 -72.74 239 12 MET A 35 ? ? 150.49 -33.91 240 12 LYS A 51 ? ? -146.43 51.11 241 12 LYS A 52 ? ? -171.99 109.89 242 12 CYS A 53 ? ? -32.35 119.31 243 12 ILE A 55 ? ? -100.42 -68.58 244 12 ILE A 60 ? ? 38.46 -97.14 245 12 GLU A 61 ? ? 156.64 -46.91 246 12 GLN A 63 ? ? 50.18 -81.07 247 13 GLU A 8 ? ? 41.12 75.03 248 13 GLU A 9 ? ? -91.35 57.48 249 13 SER A 10 ? ? 169.21 59.90 250 13 THR A 12 ? ? 57.62 -171.84 251 13 ASP A 13 ? ? -158.72 40.20 252 13 GLU A 14 ? ? -145.30 -48.27 253 13 CYS A 16 ? ? 51.38 75.56 254 13 LEU A 20 ? ? 73.29 60.65 255 13 SER A 21 ? ? -134.33 -128.11 256 13 ASP A 25 ? ? -153.33 31.50 257 13 GLU A 27 ? ? -107.28 -68.50 258 13 ASP A 28 ? ? -176.50 135.74 259 13 ARG A 31 ? ? -146.62 32.50 260 13 LEU A 32 ? ? 46.97 -162.86 261 13 CYS A 34 ? ? -67.99 -71.00 262 13 MET A 35 ? ? 152.30 -36.25 263 13 LYS A 51 ? ? -148.42 51.03 264 13 LYS A 52 ? ? -168.99 111.23 265 13 CYS A 53 ? ? -34.15 118.61 266 13 ILE A 55 ? ? -97.30 -69.47 267 13 ILE A 60 ? ? 37.31 -99.28 268 13 GLU A 61 ? ? 163.44 -53.07 269 13 GLN A 63 ? ? 51.16 -82.39 270 14 LYS A 3 ? ? 56.28 -160.23 271 14 GLU A 6 ? ? 54.45 74.07 272 14 GLU A 9 ? ? -151.46 70.62 273 14 GLU A 14 ? ? -141.31 -19.97 274 14 CYS A 16 ? ? 55.27 77.60 275 14 LEU A 20 ? ? 67.86 68.61 276 14 SER A 21 ? ? -140.83 -95.40 277 14 ASP A 25 ? ? -155.98 70.70 278 14 ASP A 28 ? ? -179.13 127.85 279 14 ARG A 31 ? ? -146.80 33.40 280 14 LEU A 32 ? ? 45.79 -162.78 281 14 MET A 35 ? ? 153.96 -36.92 282 14 LYS A 51 ? ? -150.22 43.77 283 14 LYS A 52 ? ? -165.60 112.54 284 14 CYS A 53 ? ? -34.51 117.78 285 14 ILE A 55 ? ? -93.20 -68.87 286 14 ARG A 57 ? ? 58.25 5.41 287 14 ILE A 60 ? ? 37.76 -97.27 288 14 GLU A 61 ? ? 158.70 -55.27 289 14 GLN A 63 ? ? 54.83 -83.38 290 14 ALA A 66 ? ? 34.56 82.30 291 15 LYS A 3 ? ? 56.15 -171.85 292 15 GLU A 8 ? ? 11.50 63.21 293 15 GLU A 9 ? ? 39.18 57.09 294 15 ASP A 11 ? ? 34.85 55.06 295 15 GLU A 14 ? ? -167.54 -50.99 296 15 LYS A 15 ? ? 91.76 0.17 297 15 CYS A 16 ? ? 56.93 77.98 298 15 SER A 21 ? ? -137.41 -103.33 299 15 ASP A 25 ? ? -151.82 25.20 300 15 GLU A 27 ? ? -103.87 -72.85 301 15 ASP A 28 ? ? -177.61 129.04 302 15 ARG A 31 ? ? -148.37 29.43 303 15 LEU A 32 ? ? 48.79 -163.34 304 15 CYS A 34 ? ? -59.59 -70.59 305 15 MET A 35 ? ? 155.94 -31.61 306 15 ILE A 60 ? ? 38.86 -95.55 307 15 GLU A 61 ? ? 163.68 -62.39 308 15 GLN A 63 ? ? 52.49 -90.24 309 16 LYS A 3 ? ? -155.98 -66.02 310 16 LYS A 4 ? ? 46.27 -127.33 311 16 GLU A 6 ? ? 41.50 -123.60 312 16 SER A 10 ? ? -147.83 32.76 313 16 GLU A 14 ? ? 162.83 -39.20 314 16 CYS A 16 ? ? 51.70 77.62 315 16 SER A 21 ? ? -126.33 -113.98 316 16 ASP A 25 ? ? -161.33 55.07 317 16 GLU A 27 ? ? -120.02 -65.42 318 16 ASP A 28 ? ? -178.66 128.47 319 16 ARG A 31 ? ? -146.28 36.75 320 16 LEU A 32 ? ? 46.66 -147.34 321 16 MET A 35 ? ? 147.39 -30.08 322 16 LYS A 51 ? ? -145.11 46.53 323 16 LYS A 52 ? ? -167.14 109.92 324 16 CYS A 53 ? ? -34.96 119.97 325 16 ILE A 55 ? ? -95.69 -65.42 326 16 ILE A 60 ? ? 37.75 -97.63 327 16 GLU A 61 ? ? 161.82 -54.15 328 16 GLN A 63 ? ? 55.65 -80.55 329 17 LYS A 3 ? ? 47.58 -107.63 330 17 GLU A 6 ? ? 72.06 177.08 331 17 THR A 12 ? ? 69.75 158.39 332 17 GLU A 14 ? ? -151.23 -26.46 333 17 LYS A 15 ? ? 59.87 6.61 334 17 CYS A 16 ? ? 51.34 75.31 335 17 LEU A 20 ? ? 69.41 63.41 336 17 SER A 21 ? ? -137.21 -112.87 337 17 ASP A 25 ? ? -148.82 31.70 338 17 GLU A 27 ? ? -105.10 -70.48 339 17 ASP A 28 ? ? -178.56 136.82 340 17 ARG A 31 ? ? -146.08 29.89 341 17 LEU A 32 ? ? 47.46 -160.86 342 17 CYS A 34 ? ? -58.87 -72.61 343 17 MET A 35 ? ? 151.51 -34.59 344 17 LYS A 51 ? ? -141.85 56.02 345 17 LYS A 52 ? ? -170.61 112.45 346 17 CYS A 53 ? ? -35.81 117.71 347 17 ARG A 57 ? ? 56.44 14.38 348 17 ILE A 60 ? ? 40.35 -96.60 349 17 GLU A 61 ? ? 162.09 -49.14 350 17 THR A 62 ? ? -141.28 16.04 351 17 GLN A 63 ? ? 56.29 -80.17 352 17 ASP A 67 ? ? -121.13 -59.68 353 18 GLU A 6 ? ? 47.23 -165.73 354 18 GLU A 8 ? ? 59.05 113.27 355 18 SER A 10 ? ? -156.73 -57.31 356 18 THR A 12 ? ? 61.68 -166.85 357 18 ASP A 13 ? ? 58.61 169.45 358 18 GLU A 14 ? ? 150.82 -36.39 359 18 CYS A 16 ? ? 51.60 76.53 360 18 LEU A 20 ? ? 75.80 63.08 361 18 SER A 21 ? ? -132.57 -115.90 362 18 ASP A 25 ? ? -151.06 26.08 363 18 ASP A 28 ? ? -179.37 136.43 364 18 ARG A 31 ? ? -145.32 35.37 365 18 LEU A 32 ? ? 46.26 -161.43 366 18 MET A 35 ? ? 150.27 -36.53 367 18 LYS A 51 ? ? -147.30 47.76 368 18 LYS A 52 ? ? -167.98 114.39 369 18 CYS A 53 ? ? -35.44 118.60 370 18 ILE A 55 ? ? -91.83 -68.09 371 18 ILE A 60 ? ? 38.00 -96.90 372 18 GLU A 61 ? ? 159.60 -55.42 373 18 GLN A 63 ? ? 55.38 -77.37 374 18 ASP A 67 ? ? -80.34 -70.99 375 19 SER A 10 ? ? -145.37 40.59 376 19 GLU A 14 ? ? 172.13 -38.62 377 19 LYS A 15 ? ? 85.94 5.25 378 19 CYS A 16 ? ? 54.31 80.16 379 19 SER A 21 ? ? -131.60 -105.97 380 19 ASP A 25 ? ? -156.42 72.50 381 19 GLU A 27 ? ? -133.52 -72.60 382 19 ASP A 28 ? ? 174.91 136.68 383 19 ARG A 31 ? ? -145.36 27.80 384 19 LEU A 32 ? ? 48.29 -162.94 385 19 MET A 35 ? ? 146.43 -26.99 386 19 LYS A 51 ? ? -149.06 33.64 387 19 LYS A 52 ? ? -164.38 113.23 388 19 CYS A 53 ? ? -35.66 120.21 389 19 ILE A 60 ? ? 36.12 -98.29 390 19 GLU A 61 ? ? 164.33 -57.94 391 19 GLN A 63 ? ? 54.18 -80.61 392 20 LYS A 3 ? ? -62.69 -71.48 393 20 GLU A 6 ? ? 65.04 -174.02 394 20 SER A 10 ? ? 64.91 84.39 395 20 ASP A 13 ? ? -141.75 41.99 396 20 GLU A 14 ? ? -155.54 -41.79 397 20 CYS A 16 ? ? 47.25 72.21 398 20 MET A 22 ? ? -17.90 109.91 399 20 ASP A 25 ? ? -155.95 28.65 400 20 GLU A 27 ? ? -95.42 -68.43 401 20 ASP A 28 ? ? 178.38 137.11 402 20 ARG A 31 ? ? -144.81 30.24 403 20 LEU A 32 ? ? 47.95 -163.84 404 20 MET A 35 ? ? 152.12 -36.11 405 20 LYS A 51 ? ? -170.58 38.25 406 20 LYS A 52 ? ? -167.63 111.85 407 20 CYS A 53 ? ? -34.65 119.69 408 20 ILE A 55 ? ? -98.72 -68.58 409 20 ARG A 57 ? ? 65.47 -4.65 410 20 ILE A 60 ? ? 39.06 -97.27 411 20 GLU A 61 ? ? 157.76 -53.14 412 20 GLN A 63 ? ? 55.57 -82.14 413 21 LYS A 3 ? ? -143.22 -51.80 414 21 LYS A 4 ? ? 46.86 -155.02 415 21 ASP A 5 ? ? 29.18 77.58 416 21 GLU A 6 ? ? 49.64 -129.62 417 21 SER A 10 ? ? -141.73 58.53 418 21 ASP A 13 ? ? -144.56 10.01 419 21 LYS A 15 ? ? 59.50 -2.25 420 21 CYS A 16 ? ? 57.43 77.14 421 21 LEU A 20 ? ? 84.16 31.38 422 21 MET A 22 ? ? 53.15 94.79 423 21 ASP A 25 ? ? -155.21 59.55 424 21 ASP A 28 ? ? 173.20 125.91 425 21 ARG A 31 ? ? -145.38 28.82 426 21 LEU A 32 ? ? 49.23 -162.94 427 21 CYS A 34 ? ? -63.44 -72.80 428 21 MET A 35 ? ? 150.82 -36.87 429 21 LYS A 51 ? ? -145.08 55.54 430 21 LYS A 52 ? ? -171.62 110.84 431 21 CYS A 53 ? ? -34.80 119.36 432 21 ILE A 55 ? ? -100.95 -70.25 433 21 ARG A 57 ? ? 70.37 -5.73 434 21 ILE A 60 ? ? 38.29 -97.73 435 21 GLU A 61 ? ? 160.87 -51.92 436 21 GLN A 63 ? ? 57.00 -79.76 437 22 GLU A 9 ? ? -142.68 36.36 438 22 ASP A 13 ? ? 66.90 99.76 439 22 GLU A 14 ? ? -148.21 -108.50 440 22 LYS A 15 ? ? -149.48 -23.43 441 22 CYS A 16 ? ? 73.84 95.90 442 22 LEU A 20 ? ? 77.20 58.51 443 22 SER A 21 ? ? -129.37 -95.69 444 22 ASP A 25 ? ? -153.73 59.43 445 22 ASP A 28 ? ? 175.92 130.09 446 22 ARG A 31 ? ? -145.75 30.41 447 22 LEU A 32 ? ? 47.58 -166.64 448 22 MET A 35 ? ? 148.70 -32.14 449 22 LYS A 51 ? ? -145.52 47.15 450 22 LYS A 52 ? ? -166.46 110.30 451 22 CYS A 53 ? ? -35.42 118.42 452 22 ILE A 55 ? ? -88.30 -70.49 453 22 ILE A 60 ? ? 36.54 -98.65 454 22 GLU A 61 ? ? 165.83 -52.24 455 22 GLN A 63 ? ? 51.64 -81.71 456 23 LYS A 3 ? ? 60.86 -177.13 457 23 GLU A 6 ? ? 56.78 -156.72 458 23 GLU A 8 ? ? -137.94 -139.12 459 23 GLU A 9 ? ? -155.34 38.24 460 23 ASP A 13 ? ? 76.92 117.88 461 23 GLU A 14 ? ? -158.00 -101.08 462 23 LYS A 15 ? ? -152.01 -33.20 463 23 CYS A 16 ? ? 84.38 95.10 464 23 LEU A 20 ? ? 77.33 54.86 465 23 SER A 21 ? ? -118.94 -99.68 466 23 ASP A 25 ? ? -150.39 52.96 467 23 ASP A 28 ? ? 172.90 127.78 468 23 ARG A 31 ? ? -147.40 25.89 469 23 LEU A 32 ? ? 49.39 -167.28 470 23 CYS A 34 ? ? -65.08 -72.72 471 23 MET A 35 ? ? 152.34 -30.29 472 23 LYS A 52 ? ? -170.96 118.48 473 23 ILE A 60 ? ? 38.24 -97.95 474 23 GLU A 61 ? ? 164.28 -59.30 475 23 GLN A 63 ? ? 51.00 -81.60 476 24 LYS A 3 ? ? 58.67 -162.09 477 24 LYS A 4 ? ? 73.95 -4.45 478 24 ASP A 13 ? ? -152.40 76.84 479 24 GLU A 14 ? ? -164.75 -35.50 480 24 CYS A 16 ? ? 52.43 76.89 481 24 SER A 21 ? ? -128.86 -106.60 482 24 ASP A 28 ? ? -179.89 -54.40 483 24 VAL A 29 ? ? 46.70 -167.86 484 24 ARG A 31 ? ? -146.50 30.69 485 24 LEU A 32 ? ? 46.95 -163.43 486 24 MET A 35 ? ? 147.37 -34.96 487 24 LYS A 51 ? ? -149.92 46.35 488 24 LYS A 52 ? ? -165.44 109.78 489 24 CYS A 53 ? ? -35.47 118.41 490 24 ILE A 55 ? ? -98.04 -65.46 491 24 ARG A 57 ? ? 65.97 -1.93 492 24 ILE A 60 ? ? 37.04 -100.22 493 24 GLU A 61 ? ? 167.18 -55.75 494 24 GLN A 63 ? ? 52.36 -84.89 495 24 ASP A 67 ? ? -142.53 -74.68 496 25 LYS A 3 ? ? -151.05 -152.35 497 25 LYS A 4 ? ? -116.75 -99.87 498 25 ASP A 5 ? ? 56.60 -129.07 499 25 GLU A 8 ? ? -141.60 22.94 500 25 ASP A 11 ? ? -67.26 94.01 501 25 ASP A 13 ? ? -152.50 78.35 502 25 GLU A 14 ? ? -169.29 -51.95 503 25 LYS A 15 ? ? 94.70 3.58 504 25 CYS A 16 ? ? 53.82 73.44 505 25 SER A 21 ? ? -136.53 -118.06 506 25 ASP A 25 ? ? -144.87 39.58 507 25 ASP A 28 ? ? 173.78 141.44 508 25 ARG A 31 ? ? -149.66 25.40 509 25 LEU A 32 ? ? 48.19 -164.74 510 25 MET A 35 ? ? 148.62 -32.79 511 25 LYS A 51 ? ? -144.97 49.09 512 25 LYS A 52 ? ? -161.68 108.65 513 25 CYS A 53 ? ? -34.86 117.55 514 25 ILE A 60 ? ? 36.87 -98.99 515 25 GLU A 61 ? ? 166.96 -66.50 516 25 GLN A 63 ? ? 55.34 -86.05 517 26 ASP A 5 ? ? 47.94 -132.69 518 26 GLU A 6 ? ? -155.10 -157.32 519 26 GLU A 8 ? ? 45.55 77.34 520 26 ASP A 11 ? ? -77.65 37.01 521 26 GLU A 14 ? ? -176.66 -31.99 522 26 CYS A 16 ? ? 54.50 77.95 523 26 LEU A 20 ? ? 74.15 66.47 524 26 SER A 21 ? ? -136.28 -111.81 525 26 ASP A 25 ? ? -149.60 20.10 526 26 ASP A 28 ? ? 173.88 124.70 527 26 ARG A 31 ? ? -144.23 37.24 528 26 LEU A 32 ? ? 47.24 -159.35 529 26 MET A 35 ? ? 155.79 -37.58 530 26 LYS A 51 ? ? -112.39 65.74 531 26 ILE A 55 ? ? -92.33 -67.93 532 26 ASP A 59 ? ? -78.62 46.28 533 26 ILE A 60 ? ? 38.10 -99.25 534 26 GLU A 61 ? ? 167.26 -71.51 535 26 GLN A 63 ? ? 42.46 -104.36 536 26 ALA A 66 ? ? -59.90 102.38 537 27 LYS A 4 ? ? 33.91 42.96 538 27 ASP A 5 ? ? -154.36 -157.68 539 27 GLU A 8 ? ? -128.77 -126.82 540 27 SER A 10 ? ? 85.12 98.80 541 27 GLU A 14 ? ? -165.42 -33.36 542 27 CYS A 16 ? ? 54.05 76.96 543 27 LEU A 20 ? ? 67.01 67.95 544 27 SER A 21 ? ? -141.11 -99.95 545 27 ASP A 25 ? ? -147.97 16.89 546 27 GLU A 27 ? ? -104.22 -62.76 547 27 ASP A 28 ? ? 175.69 131.33 548 27 ARG A 31 ? ? -147.23 29.92 549 27 LEU A 32 ? ? 49.01 -162.55 550 27 CYS A 34 ? ? -57.71 -72.43 551 27 MET A 35 ? ? 152.19 -37.46 552 27 LYS A 51 ? ? -158.64 38.66 553 27 LYS A 52 ? ? -166.48 111.52 554 27 CYS A 53 ? ? -33.43 119.12 555 27 ILE A 55 ? ? -102.31 -69.66 556 27 ARG A 57 ? ? 67.69 -4.28 557 27 ILE A 60 ? ? 38.40 -99.33 558 27 GLU A 61 ? ? 164.01 -51.14 559 27 GLN A 63 ? ? 56.27 -83.74 560 28 GLU A 8 ? ? -147.46 25.67 561 28 SER A 10 ? ? -146.36 -76.40 562 28 THR A 12 ? ? -144.58 50.92 563 28 GLU A 14 ? ? -166.70 -36.58 564 28 CYS A 16 ? ? 58.57 77.47 565 28 LEU A 20 ? ? 78.41 55.03 566 28 SER A 21 ? ? -153.17 80.99 567 28 MET A 22 ? ? 49.99 96.04 568 28 ASP A 28 ? ? 174.98 126.35 569 28 ARG A 31 ? ? -144.31 26.92 570 28 LEU A 32 ? ? 49.16 -166.48 571 28 MET A 35 ? ? 148.78 -37.49 572 28 LYS A 51 ? ? -144.04 53.32 573 28 LYS A 52 ? ? -173.36 110.54 574 28 CYS A 53 ? ? -35.06 119.52 575 28 ILE A 55 ? ? -103.64 -67.60 576 28 ARG A 57 ? ? 57.85 12.81 577 28 ILE A 60 ? ? 39.74 -97.28 578 28 GLU A 61 ? ? 159.67 -58.96 579 28 GLN A 63 ? ? 47.52 -80.83 580 29 ASP A 5 ? ? -161.04 -159.91 581 29 GLU A 6 ? ? -65.45 -137.94 582 29 GLU A 8 ? ? 50.37 92.30 583 29 ASP A 11 ? ? 58.56 72.54 584 29 THR A 12 ? ? 66.20 178.68 585 29 ASP A 13 ? ? 73.41 153.23 586 29 GLU A 14 ? ? 151.62 -29.63 587 29 CYS A 16 ? ? 52.46 84.14 588 29 LEU A 20 ? ? 75.45 55.51 589 29 SER A 21 ? ? -155.83 69.25 590 29 MET A 22 ? ? 57.84 100.67 591 29 ASP A 25 ? ? -152.24 50.57 592 29 ASP A 28 ? ? 167.82 133.33 593 29 ARG A 31 ? ? -144.18 24.79 594 29 LEU A 32 ? ? 48.34 -164.53 595 29 CYS A 34 ? ? -63.99 -72.40 596 29 MET A 35 ? ? 150.14 -30.77 597 29 SER A 50 ? ? -129.40 -62.48 598 29 ARG A 57 ? ? 59.34 14.62 599 29 ILE A 60 ? ? 39.00 -98.05 600 29 GLU A 61 ? ? 163.16 -54.46 601 29 THR A 62 ? ? -141.00 21.29 602 29 GLN A 63 ? ? 52.14 -78.52 603 30 LYS A 4 ? ? -83.40 48.49 604 30 GLU A 6 ? ? 59.79 -169.87 605 30 GLU A 8 ? ? 42.22 77.79 606 30 GLU A 9 ? ? -95.50 38.42 607 30 SER A 10 ? ? -160.72 81.91 608 30 ASP A 11 ? ? -112.40 71.03 609 30 THR A 12 ? ? 52.35 -163.19 610 30 ASP A 13 ? ? -165.53 98.95 611 30 GLU A 14 ? ? -172.25 -31.35 612 30 CYS A 16 ? ? 52.12 78.48 613 30 LEU A 20 ? ? 67.96 63.76 614 30 SER A 21 ? ? -131.75 -108.62 615 30 ASP A 25 ? ? -152.68 42.71 616 30 ASP A 28 ? ? 172.59 -46.54 617 30 VAL A 29 ? ? 49.88 -178.41 618 30 ARG A 31 ? ? -144.38 29.82 619 30 LEU A 32 ? ? 47.62 -165.92 620 30 CYS A 34 ? ? -71.57 -74.67 621 30 MET A 35 ? ? 154.12 -35.33 622 30 LYS A 51 ? ? -150.31 42.20 623 30 LYS A 52 ? ? -167.19 110.65 624 30 CYS A 53 ? ? -31.76 119.00 625 30 ILE A 55 ? ? -98.75 -70.61 626 30 ILE A 60 ? ? 38.67 -98.40 627 30 GLU A 61 ? ? 161.88 -56.37 628 30 GLN A 63 ? ? 49.29 -79.39 629 31 LYS A 3 ? ? -144.36 -159.08 630 31 GLU A 6 ? ? 60.12 102.21 631 31 GLU A 8 ? ? 41.75 79.68 632 31 GLU A 9 ? ? -90.41 36.19 633 31 SER A 10 ? ? 97.66 117.68 634 31 GLU A 14 ? ? -166.29 -36.72 635 31 CYS A 16 ? ? 57.54 76.32 636 31 SER A 21 ? ? -153.70 86.96 637 31 MET A 22 ? ? 45.59 94.62 638 31 ASP A 25 ? ? -151.94 65.55 639 31 GLU A 27 ? ? -121.94 -72.28 640 31 ASP A 28 ? ? -174.38 126.77 641 31 ARG A 31 ? ? -144.74 30.61 642 31 LEU A 32 ? ? 45.29 -161.59 643 31 MET A 35 ? ? 151.44 -34.09 644 31 LYS A 51 ? ? -140.85 46.54 645 31 LYS A 52 ? ? -170.44 112.02 646 31 CYS A 53 ? ? -36.23 119.47 647 31 ILE A 55 ? ? -90.37 -71.78 648 31 ARG A 57 ? ? 59.72 6.66 649 31 ILE A 60 ? ? 37.71 -97.32 650 31 GLU A 61 ? ? 162.21 -51.65 651 31 GLN A 63 ? ? 59.00 -73.31 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 1 LYS A 1 ? ? GLY A 2 ? ? 99.07 2 1 GLY A 2 ? ? LYS A 3 ? ? 126.18 3 1 LYS A 3 ? ? LYS A 4 ? ? 103.54 4 1 ASP A 5 ? ? GLU A 6 ? ? 50.25 5 1 GLU A 8 ? ? GLU A 9 ? ? -115.46 6 10 LYS A 1 ? ? GLY A 2 ? ? -148.29 7 24 ASP A 67 ? ? SER A 68 ? ? 144.25 8 31 LYS A 1 ? ? GLY A 2 ? ? -145.48 # loop_ _pdbx_validate_chiral.id _pdbx_validate_chiral.PDB_model_num _pdbx_validate_chiral.auth_atom_id _pdbx_validate_chiral.label_alt_id _pdbx_validate_chiral.auth_asym_id _pdbx_validate_chiral.auth_comp_id _pdbx_validate_chiral.auth_seq_id _pdbx_validate_chiral.PDB_ins_code _pdbx_validate_chiral.details _pdbx_validate_chiral.omega 1 1 CA ? A LYS 1 ? 'WRONG HAND' . 2 1 CA ? A LYS 3 ? 'WRONG HAND' . 3 1 CA ? A ASP 5 ? 'WRONG HAND' . 4 1 CA ? A SER 10 ? 'WRONG HAND' . # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 HIS A 39 ? ? 0.107 'SIDE CHAIN' 2 10 ARG A 31 ? ? 0.111 'SIDE CHAIN' 3 31 ARG A 30 ? ? 0.083 'SIDE CHAIN' # _pdbx_nmr_ensemble.entry_id 9QAL _pdbx_nmr_ensemble.conformers_calculated_total_number 31 _pdbx_nmr_ensemble.conformers_submitted_total_number 31 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 9QAL _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'minimized average structure' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '0.7 mM [U-99% 15N] ARKADIA 2 E3 Ub ligase, RING Domain, 50 mM potassium phosphate, 2 mM DSS, 90% H2O/10% D2O' '90% H2O/10% D2O' 15N-Sample solution ? 2 '0.7 mM [U-99% 13C; U-99% 15N] ARKADIA 2 E3 Ub ligase, RING Domain, 50 mM potassium phosphate, 2 mM DSS, 90% H2O/10% D2O' '90% H2O/10% D2O' 13C/15N-Sample solution ? 3 '0.7 mM ARKADIA 2 E3 Ub ligase, RING Domain, 50 mM potassium phosphate, 2 mM DSS, 90% H2O/10% D2O' '90% H2O/10% D2O' 1H-Sample solution ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'ARKADIA 2 E3 Ub ligase, RING Domain' 0.7 ? mM '[U-99% 15N]' 1 'potassium phosphate' 50 ? mM 'natural abundance' 1 DSS 2 ? mM 'natural abundance' 2 'ARKADIA 2 E3 Ub ligase, RING Domain' 0.7 ? mM '[U-99% 13C; U-99% 15N]' 2 'potassium phosphate' 50 ? mM 'natural abundance' 2 DSS 2 ? mM 'natural abundance' 3 'ARKADIA 2 E3 Ub ligase, RING Domain' 0.7 ? mM 'natural abundance' 3 'potassium phosphate' 50 ? mM 'natural abundance' 3 DSS 2 ? mM 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7 _pdbx_nmr_exptl_sample_conditions.ionic_strength 50 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label 'Conditions 1' _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 2 '2D 1H-13C HSQC aliphatic' 2 isotropic 20 1 2 '2D 1H-13C HSQC aromatic' 2 isotropic 2 1 1 '2D 1H-15N HSQC' 2 isotropic 21 1 1 '2D 1H-15N Trosy HSQC' 2 isotropic 3 1 3 '2D 1H-1H NOESY' 2 isotropic 4 1 2 '3D 1H-13C NOESY aliphatic' 2 isotropic 5 1 2 '3D 1H-13C NOESY aromatic' 2 isotropic 6 1 1 '3D 1H-15N NOESY' 2 isotropic 19 1 2 '3D HCCH-TOCSY' 2 isotropic 18 1 2 '3D HNCA' 2 isotropic 17 1 2 '3D HN(CO)CA' 2 isotropic 16 1 2 '3D HNCO' 2 isotropic 15 1 2 '3D HN(CA)CO' 2 isotropic 14 1 2 '3D CBCA(CO)NH' 2 isotropic 13 1 2 '3D HNCACB' 2 isotropic 12 1 2 '3D HBHA(CO)NH' 2 isotropic 11 1 2 '3D HNHA' 2 isotropic 10 1 3 '1D 1H' 2 isotropic # _pdbx_nmr_refine.entry_id 9QAL _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 4 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'chemical shift assignment' CARA 1.8.4 'Keller and Wuthrich' 2 'peak picking' XEASY ? 'Bartels et al.' 3 'structure calculation' DYANA ? 'Guntert, Braun and Wuthrich' 4 refinement Amber 5.0 'Case, Darden, Cheatham III, Simmerling, Wang, Duke, Luo, ... and Kollman' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASP N N N N 41 ASP CA C N S 42 ASP C C N N 43 ASP O O N N 44 ASP CB C N N 45 ASP CG C N N 46 ASP OD1 O N N 47 ASP OD2 O N N 48 ASP OXT O N N 49 ASP H H N N 50 ASP H2 H N N 51 ASP HA H N N 52 ASP HB2 H N N 53 ASP HB3 H N N 54 ASP HD2 H N N 55 ASP HXT H N N 56 CYS N N N N 57 CYS CA C N R 58 CYS C C N N 59 CYS O O N N 60 CYS CB C N N 61 CYS SG S N N 62 CYS OXT O N N 63 CYS H H N N 64 CYS H2 H N N 65 CYS HA H N N 66 CYS HB2 H N N 67 CYS HB3 H N N 68 CYS HG H N N 69 CYS HXT H N N 70 GLN N N N N 71 GLN CA C N S 72 GLN C C N N 73 GLN O O N N 74 GLN CB C N N 75 GLN CG C N N 76 GLN CD C N N 77 GLN OE1 O N N 78 GLN NE2 N N N 79 GLN OXT O N N 80 GLN H H N N 81 GLN H2 H N N 82 GLN HA H N N 83 GLN HB2 H N N 84 GLN HB3 H N N 85 GLN HG2 H N N 86 GLN HG3 H N N 87 GLN HE21 H N N 88 GLN HE22 H N N 89 GLN HXT H N N 90 GLU N N N N 91 GLU CA C N S 92 GLU C C N N 93 GLU O O N N 94 GLU CB C N N 95 GLU CG C N N 96 GLU CD C N N 97 GLU OE1 O N N 98 GLU OE2 O N N 99 GLU OXT O N N 100 GLU H H N N 101 GLU H2 H N N 102 GLU HA H N N 103 GLU HB2 H N N 104 GLU HB3 H N N 105 GLU HG2 H N N 106 GLU HG3 H N N 107 GLU HE2 H N N 108 GLU HXT H N N 109 GLY N N N N 110 GLY CA C N N 111 GLY C C N N 112 GLY O O N N 113 GLY OXT O N N 114 GLY H H N N 115 GLY H2 H N N 116 GLY HA2 H N N 117 GLY HA3 H N N 118 GLY HXT H N N 119 HIS N N N N 120 HIS CA C N S 121 HIS C C N N 122 HIS O O N N 123 HIS CB C N N 124 HIS CG C Y N 125 HIS ND1 N Y N 126 HIS CD2 C Y N 127 HIS CE1 C Y N 128 HIS NE2 N Y N 129 HIS OXT O N N 130 HIS H H N N 131 HIS H2 H N N 132 HIS HA H N N 133 HIS HB2 H N N 134 HIS HB3 H N N 135 HIS HD1 H N N 136 HIS HD2 H N N 137 HIS HE1 H N N 138 HIS HE2 H N N 139 HIS HXT H N N 140 ILE N N N N 141 ILE CA C N S 142 ILE C C N N 143 ILE O O N N 144 ILE CB C N S 145 ILE CG1 C N N 146 ILE CG2 C N N 147 ILE CD1 C N N 148 ILE OXT O N N 149 ILE H H N N 150 ILE H2 H N N 151 ILE HA H N N 152 ILE HB H N N 153 ILE HG12 H N N 154 ILE HG13 H N N 155 ILE HG21 H N N 156 ILE HG22 H N N 157 ILE HG23 H N N 158 ILE HD11 H N N 159 ILE HD12 H N N 160 ILE HD13 H N N 161 ILE HXT H N N 162 LEU N N N N 163 LEU CA C N S 164 LEU C C N N 165 LEU O O N N 166 LEU CB C N N 167 LEU CG C N N 168 LEU CD1 C N N 169 LEU CD2 C N N 170 LEU OXT O N N 171 LEU H H N N 172 LEU H2 H N N 173 LEU HA H N N 174 LEU HB2 H N N 175 LEU HB3 H N N 176 LEU HG H N N 177 LEU HD11 H N N 178 LEU HD12 H N N 179 LEU HD13 H N N 180 LEU HD21 H N N 181 LEU HD22 H N N 182 LEU HD23 H N N 183 LEU HXT H N N 184 LYS N N N N 185 LYS CA C N S 186 LYS C C N N 187 LYS O O N N 188 LYS CB C N N 189 LYS CG C N N 190 LYS CD C N N 191 LYS CE C N N 192 LYS NZ N N N 193 LYS OXT O N N 194 LYS H H N N 195 LYS H2 H N N 196 LYS HA H N N 197 LYS HB2 H N N 198 LYS HB3 H N N 199 LYS HG2 H N N 200 LYS HG3 H N N 201 LYS HD2 H N N 202 LYS HD3 H N N 203 LYS HE2 H N N 204 LYS HE3 H N N 205 LYS HZ1 H N N 206 LYS HZ2 H N N 207 LYS HZ3 H N N 208 LYS HXT H N N 209 MET N N N N 210 MET CA C N S 211 MET C C N N 212 MET O O N N 213 MET CB C N N 214 MET CG C N N 215 MET SD S N N 216 MET CE C N N 217 MET OXT O N N 218 MET H H N N 219 MET H2 H N N 220 MET HA H N N 221 MET HB2 H N N 222 MET HB3 H N N 223 MET HG2 H N N 224 MET HG3 H N N 225 MET HE1 H N N 226 MET HE2 H N N 227 MET HE3 H N N 228 MET HXT H N N 229 PHE N N N N 230 PHE CA C N S 231 PHE C C N N 232 PHE O O N N 233 PHE CB C N N 234 PHE CG C Y N 235 PHE CD1 C Y N 236 PHE CD2 C Y N 237 PHE CE1 C Y N 238 PHE CE2 C Y N 239 PHE CZ C Y N 240 PHE OXT O N N 241 PHE H H N N 242 PHE H2 H N N 243 PHE HA H N N 244 PHE HB2 H N N 245 PHE HB3 H N N 246 PHE HD1 H N N 247 PHE HD2 H N N 248 PHE HE1 H N N 249 PHE HE2 H N N 250 PHE HZ H N N 251 PHE HXT H N N 252 PRO N N N N 253 PRO CA C N S 254 PRO C C N N 255 PRO O O N N 256 PRO CB C N N 257 PRO CG C N N 258 PRO CD C N N 259 PRO OXT O N N 260 PRO H H N N 261 PRO HA H N N 262 PRO HB2 H N N 263 PRO HB3 H N N 264 PRO HG2 H N N 265 PRO HG3 H N N 266 PRO HD2 H N N 267 PRO HD3 H N N 268 PRO HXT H N N 269 SER N N N N 270 SER CA C N S 271 SER C C N N 272 SER O O N N 273 SER CB C N N 274 SER OG O N N 275 SER OXT O N N 276 SER H H N N 277 SER H2 H N N 278 SER HA H N N 279 SER HB2 H N N 280 SER HB3 H N N 281 SER HG H N N 282 SER HXT H N N 283 THR N N N N 284 THR CA C N S 285 THR C C N N 286 THR O O N N 287 THR CB C N R 288 THR OG1 O N N 289 THR CG2 C N N 290 THR OXT O N N 291 THR H H N N 292 THR H2 H N N 293 THR HA H N N 294 THR HB H N N 295 THR HG1 H N N 296 THR HG21 H N N 297 THR HG22 H N N 298 THR HG23 H N N 299 THR HXT H N N 300 TRP N N N N 301 TRP CA C N S 302 TRP C C N N 303 TRP O O N N 304 TRP CB C N N 305 TRP CG C Y N 306 TRP CD1 C Y N 307 TRP CD2 C Y N 308 TRP NE1 N Y N 309 TRP CE2 C Y N 310 TRP CE3 C Y N 311 TRP CZ2 C Y N 312 TRP CZ3 C Y N 313 TRP CH2 C Y N 314 TRP OXT O N N 315 TRP H H N N 316 TRP H2 H N N 317 TRP HA H N N 318 TRP HB2 H N N 319 TRP HB3 H N N 320 TRP HD1 H N N 321 TRP HE1 H N N 322 TRP HE3 H N N 323 TRP HZ2 H N N 324 TRP HZ3 H N N 325 TRP HH2 H N N 326 TRP HXT H N N 327 VAL N N N N 328 VAL CA C N S 329 VAL C C N N 330 VAL O O N N 331 VAL CB C N N 332 VAL CG1 C N N 333 VAL CG2 C N N 334 VAL OXT O N N 335 VAL H H N N 336 VAL H2 H N N 337 VAL HA H N N 338 VAL HB H N N 339 VAL HG11 H N N 340 VAL HG12 H N N 341 VAL HG13 H N N 342 VAL HG21 H N N 343 VAL HG22 H N N 344 VAL HG23 H N N 345 VAL HXT H N N 346 ZN ZN ZN N N 347 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASP N CA sing N N 39 ASP N H sing N N 40 ASP N H2 sing N N 41 ASP CA C sing N N 42 ASP CA CB sing N N 43 ASP CA HA sing N N 44 ASP C O doub N N 45 ASP C OXT sing N N 46 ASP CB CG sing N N 47 ASP CB HB2 sing N N 48 ASP CB HB3 sing N N 49 ASP CG OD1 doub N N 50 ASP CG OD2 sing N N 51 ASP OD2 HD2 sing N N 52 ASP OXT HXT sing N N 53 CYS N CA sing N N 54 CYS N H sing N N 55 CYS N H2 sing N N 56 CYS CA C sing N N 57 CYS CA CB sing N N 58 CYS CA HA sing N N 59 CYS C O doub N N 60 CYS C OXT sing N N 61 CYS CB SG sing N N 62 CYS CB HB2 sing N N 63 CYS CB HB3 sing N N 64 CYS SG HG sing N N 65 CYS OXT HXT sing N N 66 GLN N CA sing N N 67 GLN N H sing N N 68 GLN N H2 sing N N 69 GLN CA C sing N N 70 GLN CA CB sing N N 71 GLN CA HA sing N N 72 GLN C O doub N N 73 GLN C OXT sing N N 74 GLN CB CG sing N N 75 GLN CB HB2 sing N N 76 GLN CB HB3 sing N N 77 GLN CG CD sing N N 78 GLN CG HG2 sing N N 79 GLN CG HG3 sing N N 80 GLN CD OE1 doub N N 81 GLN CD NE2 sing N N 82 GLN NE2 HE21 sing N N 83 GLN NE2 HE22 sing N N 84 GLN OXT HXT sing N N 85 GLU N CA sing N N 86 GLU N H sing N N 87 GLU N H2 sing N N 88 GLU CA C sing N N 89 GLU CA CB sing N N 90 GLU CA HA sing N N 91 GLU C O doub N N 92 GLU C OXT sing N N 93 GLU CB CG sing N N 94 GLU CB HB2 sing N N 95 GLU CB HB3 sing N N 96 GLU CG CD sing N N 97 GLU CG HG2 sing N N 98 GLU CG HG3 sing N N 99 GLU CD OE1 doub N N 100 GLU CD OE2 sing N N 101 GLU OE2 HE2 sing N N 102 GLU OXT HXT sing N N 103 GLY N CA sing N N 104 GLY N H sing N N 105 GLY N H2 sing N N 106 GLY CA C sing N N 107 GLY CA HA2 sing N N 108 GLY CA HA3 sing N N 109 GLY C O doub N N 110 GLY C OXT sing N N 111 GLY OXT HXT sing N N 112 HIS N CA sing N N 113 HIS N H sing N N 114 HIS N H2 sing N N 115 HIS CA C sing N N 116 HIS CA CB sing N N 117 HIS CA HA sing N N 118 HIS C O doub N N 119 HIS C OXT sing N N 120 HIS CB CG sing N N 121 HIS CB HB2 sing N N 122 HIS CB HB3 sing N N 123 HIS CG ND1 sing Y N 124 HIS CG CD2 doub Y N 125 HIS ND1 CE1 doub Y N 126 HIS ND1 HD1 sing N N 127 HIS CD2 NE2 sing Y N 128 HIS CD2 HD2 sing N N 129 HIS CE1 NE2 sing Y N 130 HIS CE1 HE1 sing N N 131 HIS NE2 HE2 sing N N 132 HIS OXT HXT sing N N 133 ILE N CA sing N N 134 ILE N H sing N N 135 ILE N H2 sing N N 136 ILE CA C sing N N 137 ILE CA CB sing N N 138 ILE CA HA sing N N 139 ILE C O doub N N 140 ILE C OXT sing N N 141 ILE CB CG1 sing N N 142 ILE CB CG2 sing N N 143 ILE CB HB sing N N 144 ILE CG1 CD1 sing N N 145 ILE CG1 HG12 sing N N 146 ILE CG1 HG13 sing N N 147 ILE CG2 HG21 sing N N 148 ILE CG2 HG22 sing N N 149 ILE CG2 HG23 sing N N 150 ILE CD1 HD11 sing N N 151 ILE CD1 HD12 sing N N 152 ILE CD1 HD13 sing N N 153 ILE OXT HXT sing N N 154 LEU N CA sing N N 155 LEU N H sing N N 156 LEU N H2 sing N N 157 LEU CA C sing N N 158 LEU CA CB sing N N 159 LEU CA HA sing N N 160 LEU C O doub N N 161 LEU C OXT sing N N 162 LEU CB CG sing N N 163 LEU CB HB2 sing N N 164 LEU CB HB3 sing N N 165 LEU CG CD1 sing N N 166 LEU CG CD2 sing N N 167 LEU CG HG sing N N 168 LEU CD1 HD11 sing N N 169 LEU CD1 HD12 sing N N 170 LEU CD1 HD13 sing N N 171 LEU CD2 HD21 sing N N 172 LEU CD2 HD22 sing N N 173 LEU CD2 HD23 sing N N 174 LEU OXT HXT sing N N 175 LYS N CA sing N N 176 LYS N H sing N N 177 LYS N H2 sing N N 178 LYS CA C sing N N 179 LYS CA CB sing N N 180 LYS CA HA sing N N 181 LYS C O doub N N 182 LYS C OXT sing N N 183 LYS CB CG sing N N 184 LYS CB HB2 sing N N 185 LYS CB HB3 sing N N 186 LYS CG CD sing N N 187 LYS CG HG2 sing N N 188 LYS CG HG3 sing N N 189 LYS CD CE sing N N 190 LYS CD HD2 sing N N 191 LYS CD HD3 sing N N 192 LYS CE NZ sing N N 193 LYS CE HE2 sing N N 194 LYS CE HE3 sing N N 195 LYS NZ HZ1 sing N N 196 LYS NZ HZ2 sing N N 197 LYS NZ HZ3 sing N N 198 LYS OXT HXT sing N N 199 MET N CA sing N N 200 MET N H sing N N 201 MET N H2 sing N N 202 MET CA C sing N N 203 MET CA CB sing N N 204 MET CA HA sing N N 205 MET C O doub N N 206 MET C OXT sing N N 207 MET CB CG sing N N 208 MET CB HB2 sing N N 209 MET CB HB3 sing N N 210 MET CG SD sing N N 211 MET CG HG2 sing N N 212 MET CG HG3 sing N N 213 MET SD CE sing N N 214 MET CE HE1 sing N N 215 MET CE HE2 sing N N 216 MET CE HE3 sing N N 217 MET OXT HXT sing N N 218 PHE N CA sing N N 219 PHE N H sing N N 220 PHE N H2 sing N N 221 PHE CA C sing N N 222 PHE CA CB sing N N 223 PHE CA HA sing N N 224 PHE C O doub N N 225 PHE C OXT sing N N 226 PHE CB CG sing N N 227 PHE CB HB2 sing N N 228 PHE CB HB3 sing N N 229 PHE CG CD1 doub Y N 230 PHE CG CD2 sing Y N 231 PHE CD1 CE1 sing Y N 232 PHE CD1 HD1 sing N N 233 PHE CD2 CE2 doub Y N 234 PHE CD2 HD2 sing N N 235 PHE CE1 CZ doub Y N 236 PHE CE1 HE1 sing N N 237 PHE CE2 CZ sing Y N 238 PHE CE2 HE2 sing N N 239 PHE CZ HZ sing N N 240 PHE OXT HXT sing N N 241 PRO N CA sing N N 242 PRO N CD sing N N 243 PRO N H sing N N 244 PRO CA C sing N N 245 PRO CA CB sing N N 246 PRO CA HA sing N N 247 PRO C O doub N N 248 PRO C OXT sing N N 249 PRO CB CG sing N N 250 PRO CB HB2 sing N N 251 PRO CB HB3 sing N N 252 PRO CG CD sing N N 253 PRO CG HG2 sing N N 254 PRO CG HG3 sing N N 255 PRO CD HD2 sing N N 256 PRO CD HD3 sing N N 257 PRO OXT HXT sing N N 258 SER N CA sing N N 259 SER N H sing N N 260 SER N H2 sing N N 261 SER CA C sing N N 262 SER CA CB sing N N 263 SER CA HA sing N N 264 SER C O doub N N 265 SER C OXT sing N N 266 SER CB OG sing N N 267 SER CB HB2 sing N N 268 SER CB HB3 sing N N 269 SER OG HG sing N N 270 SER OXT HXT sing N N 271 THR N CA sing N N 272 THR N H sing N N 273 THR N H2 sing N N 274 THR CA C sing N N 275 THR CA CB sing N N 276 THR CA HA sing N N 277 THR C O doub N N 278 THR C OXT sing N N 279 THR CB OG1 sing N N 280 THR CB CG2 sing N N 281 THR CB HB sing N N 282 THR OG1 HG1 sing N N 283 THR CG2 HG21 sing N N 284 THR CG2 HG22 sing N N 285 THR CG2 HG23 sing N N 286 THR OXT HXT sing N N 287 TRP N CA sing N N 288 TRP N H sing N N 289 TRP N H2 sing N N 290 TRP CA C sing N N 291 TRP CA CB sing N N 292 TRP CA HA sing N N 293 TRP C O doub N N 294 TRP C OXT sing N N 295 TRP CB CG sing N N 296 TRP CB HB2 sing N N 297 TRP CB HB3 sing N N 298 TRP CG CD1 doub Y N 299 TRP CG CD2 sing Y N 300 TRP CD1 NE1 sing Y N 301 TRP CD1 HD1 sing N N 302 TRP CD2 CE2 doub Y N 303 TRP CD2 CE3 sing Y N 304 TRP NE1 CE2 sing Y N 305 TRP NE1 HE1 sing N N 306 TRP CE2 CZ2 sing Y N 307 TRP CE3 CZ3 doub Y N 308 TRP CE3 HE3 sing N N 309 TRP CZ2 CH2 doub Y N 310 TRP CZ2 HZ2 sing N N 311 TRP CZ3 CH2 sing Y N 312 TRP CZ3 HZ3 sing N N 313 TRP CH2 HH2 sing N N 314 TRP OXT HXT sing N N 315 VAL N CA sing N N 316 VAL N H sing N N 317 VAL N H2 sing N N 318 VAL CA C sing N N 319 VAL CA CB sing N N 320 VAL CA HA sing N N 321 VAL C O doub N N 322 VAL C OXT sing N N 323 VAL CB CG1 sing N N 324 VAL CB CG2 sing N N 325 VAL CB HB sing N N 326 VAL CG1 HG11 sing N N 327 VAL CG1 HG12 sing N N 328 VAL CG1 HG13 sing N N 329 VAL CG2 HG21 sing N N 330 VAL CG2 HG22 sing N N 331 VAL CG2 HG23 sing N N 332 VAL OXT HXT sing N N 333 # _pdbx_audit_support.funding_organization 'European Communitys Seventh Framework Programme' _pdbx_audit_support.country 'European Union' _pdbx_audit_support.grant_number 285950 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 AVANCE ? Bruker 600 'TXI Cryoprobe' 2 'AVANCE III HD' ? Bruker 700 'TCI Cryoprobe' # _atom_sites.entry_id 9QAL _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S ZN # loop_ #