data_9QUM # _entry.id 9QUM # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.413 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9QUM pdb_00009qum 10.2210/pdb9qum/pdb WWPDB D_1292147062 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-04-22 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9QUM _pdbx_database_status.recvd_initial_deposition_date 2025-04-10 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email xzou@mmk.su.se _pdbx_contact_author.name_first Xiaodong _pdbx_contact_author.name_last Zou _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-6748-6656 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Hofer, G.' 1 0000-0002-9248-6989 'Wang, L.' 2 0000-0002-7398-1124 'Pacoste, L.' 3 0009-0005-6090-8736 'Hager, P.' 4 0009-0008-1551-2515 'Fonjallaz, A.' 5 0000-0002-9390-1654 'Scaletti Hutchinson, E.' 6 0000-0002-8741-8981 'Stenmark, P.' 7 0000-0003-4777-3417 'Di Palma, M.' 8 0000-0002-0710-9389 'Williams, L.' 9 0009-0002-4066-3899 'Worral, J.' 10 0000-0002-1863-834X 'Steiner, R.' 11 0000-0001-7084-9745 'Xu, H.' 12 0000-0002-8271-3906 'Zou, X.' 13 0000-0001-6748-6656 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title ;Continuous Serial Electron Diffraction for High Quality Protein Structures ; _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Hofer, G.' 1 0000-0002-9248-6989 primary 'Wang, L.' 2 0000-0002-7398-1124 primary 'Pacoste, L.' 3 0009-0005-6090-8736 primary 'Hager, P.' 4 0009-0008-1551-2515 primary 'Fonjallaz, A.' 5 0000-0002-9390-1654 primary 'Williams, L.' 6 0009-0002-4066-3899 primary 'Worrall, J.' 7 0000-0002-1863-834X primary 'Steiner, R.' 8 0000-0001-7084-9745 primary 'Xu, H.' 9 0000-0002-8271-3906 primary 'Zou, X.' 10 0000-0001-6748-6656 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer nat 'Lysozyme C' 16257.660 1 3.2.1.17 ? ? ? 2 non-polymer syn 'ACETATE ION' 59.044 1 ? ? ? ? 3 non-polymer syn 'CHLORIDE ION' 35.453 3 ? ? ? ? 4 water nat water 18.015 147 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name '1,4-beta-N-acetylmuramidase C,Allergen Gal d IV' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MRSLLILVLCFLPLAALGKVFGRCELAAAMKRHGLDNYRGYSLGNWVCAAKFESNFNTQATNRNTDGSTDYGILQINSRW WCNDGRTPGSRNLCNIPCSALLSSDITASVNCAKKIVSDGNGMNAWVAWRNRCKGTDVQAWIRGCRL ; _entity_poly.pdbx_seq_one_letter_code_can ;MRSLLILVLCFLPLAALGKVFGRCELAAAMKRHGLDNYRGYSLGNWVCAAKFESNFNTQATNRNTDGSTDYGILQINSRW WCNDGRTPGSRNLCNIPCSALLSSDITASVNCAKKIVSDGNGMNAWVAWRNRCKGTDVQAWIRGCRL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ACETATE ION' ACT 3 'CHLORIDE ION' CL 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ARG n 1 3 SER n 1 4 LEU n 1 5 LEU n 1 6 ILE n 1 7 LEU n 1 8 VAL n 1 9 LEU n 1 10 CYS n 1 11 PHE n 1 12 LEU n 1 13 PRO n 1 14 LEU n 1 15 ALA n 1 16 ALA n 1 17 LEU n 1 18 GLY n 1 19 LYS n 1 20 VAL n 1 21 PHE n 1 22 GLY n 1 23 ARG n 1 24 CYS n 1 25 GLU n 1 26 LEU n 1 27 ALA n 1 28 ALA n 1 29 ALA n 1 30 MET n 1 31 LYS n 1 32 ARG n 1 33 HIS n 1 34 GLY n 1 35 LEU n 1 36 ASP n 1 37 ASN n 1 38 TYR n 1 39 ARG n 1 40 GLY n 1 41 TYR n 1 42 SER n 1 43 LEU n 1 44 GLY n 1 45 ASN n 1 46 TRP n 1 47 VAL n 1 48 CYS n 1 49 ALA n 1 50 ALA n 1 51 LYS n 1 52 PHE n 1 53 GLU n 1 54 SER n 1 55 ASN n 1 56 PHE n 1 57 ASN n 1 58 THR n 1 59 GLN n 1 60 ALA n 1 61 THR n 1 62 ASN n 1 63 ARG n 1 64 ASN n 1 65 THR n 1 66 ASP n 1 67 GLY n 1 68 SER n 1 69 THR n 1 70 ASP n 1 71 TYR n 1 72 GLY n 1 73 ILE n 1 74 LEU n 1 75 GLN n 1 76 ILE n 1 77 ASN n 1 78 SER n 1 79 ARG n 1 80 TRP n 1 81 TRP n 1 82 CYS n 1 83 ASN n 1 84 ASP n 1 85 GLY n 1 86 ARG n 1 87 THR n 1 88 PRO n 1 89 GLY n 1 90 SER n 1 91 ARG n 1 92 ASN n 1 93 LEU n 1 94 CYS n 1 95 ASN n 1 96 ILE n 1 97 PRO n 1 98 CYS n 1 99 SER n 1 100 ALA n 1 101 LEU n 1 102 LEU n 1 103 SER n 1 104 SER n 1 105 ASP n 1 106 ILE n 1 107 THR n 1 108 ALA n 1 109 SER n 1 110 VAL n 1 111 ASN n 1 112 CYS n 1 113 ALA n 1 114 LYS n 1 115 LYS n 1 116 ILE n 1 117 VAL n 1 118 SER n 1 119 ASP n 1 120 GLY n 1 121 ASN n 1 122 GLY n 1 123 MET n 1 124 ASN n 1 125 ALA n 1 126 TRP n 1 127 VAL n 1 128 ALA n 1 129 TRP n 1 130 ARG n 1 131 ASN n 1 132 ARG n 1 133 CYS n 1 134 LYS n 1 135 GLY n 1 136 THR n 1 137 ASP n 1 138 VAL n 1 139 GLN n 1 140 ALA n 1 141 TRP n 1 142 ILE n 1 143 ARG n 1 144 GLY n 1 145 CYS n 1 146 ARG n 1 147 LEU n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num 1 _entity_src_nat.pdbx_end_seq_num 147 _entity_src_nat.common_name chicken _entity_src_nat.pdbx_organism_scientific 'Gallus gallus' _entity_src_nat.pdbx_ncbi_taxonomy_id 9031 _entity_src_nat.genus ? _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ACT non-polymer . 'ACETATE ION' ? 'C2 H3 O2 -1' 59.044 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -17 ? ? ? A . n A 1 2 ARG 2 -16 ? ? ? A . n A 1 3 SER 3 -15 ? ? ? A . n A 1 4 LEU 4 -14 ? ? ? A . n A 1 5 LEU 5 -13 ? ? ? A . n A 1 6 ILE 6 -12 ? ? ? A . n A 1 7 LEU 7 -11 ? ? ? A . n A 1 8 VAL 8 -10 ? ? ? A . n A 1 9 LEU 9 -9 ? ? ? A . n A 1 10 CYS 10 -8 ? ? ? A . n A 1 11 PHE 11 -7 ? ? ? A . n A 1 12 LEU 12 -6 ? ? ? A . n A 1 13 PRO 13 -5 ? ? ? A . n A 1 14 LEU 14 -4 ? ? ? A . n A 1 15 ALA 15 -3 ? ? ? A . n A 1 16 ALA 16 -2 ? ? ? A . n A 1 17 LEU 17 -1 ? ? ? A . n A 1 18 GLY 18 0 ? ? ? A . n A 1 19 LYS 19 1 1 LYS LYS A . n A 1 20 VAL 20 2 2 VAL VAL A . n A 1 21 PHE 21 3 3 PHE PHE A . n A 1 22 GLY 22 4 4 GLY GLY A . n A 1 23 ARG 23 5 5 ARG ARG A . n A 1 24 CYS 24 6 6 CYS CYS A . n A 1 25 GLU 25 7 7 GLU GLU A . n A 1 26 LEU 26 8 8 LEU LEU A . n A 1 27 ALA 27 9 9 ALA ALA A . n A 1 28 ALA 28 10 10 ALA ALA A . n A 1 29 ALA 29 11 11 ALA ALA A . n A 1 30 MET 30 12 12 MET MET A . n A 1 31 LYS 31 13 13 LYS LYS A . n A 1 32 ARG 32 14 14 ARG ARG A . n A 1 33 HIS 33 15 15 HIS HIS A . n A 1 34 GLY 34 16 16 GLY GLY A . n A 1 35 LEU 35 17 17 LEU LEU A . n A 1 36 ASP 36 18 18 ASP ASP A . n A 1 37 ASN 37 19 19 ASN ASN A . n A 1 38 TYR 38 20 20 TYR TYR A . n A 1 39 ARG 39 21 21 ARG ARG A . n A 1 40 GLY 40 22 22 GLY GLY A . n A 1 41 TYR 41 23 23 TYR TYR A . n A 1 42 SER 42 24 24 SER SER A . n A 1 43 LEU 43 25 25 LEU LEU A . n A 1 44 GLY 44 26 26 GLY GLY A . n A 1 45 ASN 45 27 27 ASN ASN A . n A 1 46 TRP 46 28 28 TRP TRP A . n A 1 47 VAL 47 29 29 VAL VAL A . n A 1 48 CYS 48 30 30 CYS CYS A . n A 1 49 ALA 49 31 31 ALA ALA A . n A 1 50 ALA 50 32 32 ALA ALA A . n A 1 51 LYS 51 33 33 LYS LYS A . n A 1 52 PHE 52 34 34 PHE PHE A . n A 1 53 GLU 53 35 35 GLU GLU A . n A 1 54 SER 54 36 36 SER SER A . n A 1 55 ASN 55 37 37 ASN ASN A . n A 1 56 PHE 56 38 38 PHE PHE A . n A 1 57 ASN 57 39 39 ASN ASN A . n A 1 58 THR 58 40 40 THR THR A . n A 1 59 GLN 59 41 41 GLN GLN A . n A 1 60 ALA 60 42 42 ALA ALA A . n A 1 61 THR 61 43 43 THR THR A . n A 1 62 ASN 62 44 44 ASN ASN A . n A 1 63 ARG 63 45 45 ARG ARG A . n A 1 64 ASN 64 46 46 ASN ASN A . n A 1 65 THR 65 47 47 THR THR A . n A 1 66 ASP 66 48 48 ASP ASP A . n A 1 67 GLY 67 49 49 GLY GLY A . n A 1 68 SER 68 50 50 SER SER A . n A 1 69 THR 69 51 51 THR THR A . n A 1 70 ASP 70 52 52 ASP ASP A . n A 1 71 TYR 71 53 53 TYR TYR A . n A 1 72 GLY 72 54 54 GLY GLY A . n A 1 73 ILE 73 55 55 ILE ILE A . n A 1 74 LEU 74 56 56 LEU LEU A . n A 1 75 GLN 75 57 57 GLN GLN A . n A 1 76 ILE 76 58 58 ILE ILE A . n A 1 77 ASN 77 59 59 ASN ASN A . n A 1 78 SER 78 60 60 SER SER A . n A 1 79 ARG 79 61 61 ARG ARG A . n A 1 80 TRP 80 62 62 TRP TRP A . n A 1 81 TRP 81 63 63 TRP TRP A . n A 1 82 CYS 82 64 64 CYS CYS A . n A 1 83 ASN 83 65 65 ASN ASN A . n A 1 84 ASP 84 66 66 ASP ASP A . n A 1 85 GLY 85 67 67 GLY GLY A . n A 1 86 ARG 86 68 68 ARG ARG A . n A 1 87 THR 87 69 69 THR THR A . n A 1 88 PRO 88 70 70 PRO PRO A . n A 1 89 GLY 89 71 71 GLY GLY A . n A 1 90 SER 90 72 72 SER SER A . n A 1 91 ARG 91 73 73 ARG ARG A . n A 1 92 ASN 92 74 74 ASN ASN A . n A 1 93 LEU 93 75 75 LEU LEU A . n A 1 94 CYS 94 76 76 CYS CYS A . n A 1 95 ASN 95 77 77 ASN ASN A . n A 1 96 ILE 96 78 78 ILE ILE A . n A 1 97 PRO 97 79 79 PRO PRO A . n A 1 98 CYS 98 80 80 CYS CYS A . n A 1 99 SER 99 81 81 SER SER A . n A 1 100 ALA 100 82 82 ALA ALA A . n A 1 101 LEU 101 83 83 LEU LEU A . n A 1 102 LEU 102 84 84 LEU LEU A . n A 1 103 SER 103 85 85 SER SER A . n A 1 104 SER 104 86 86 SER SER A . n A 1 105 ASP 105 87 87 ASP ASP A . n A 1 106 ILE 106 88 88 ILE ILE A . n A 1 107 THR 107 89 89 THR THR A . n A 1 108 ALA 108 90 90 ALA ALA A . n A 1 109 SER 109 91 91 SER SER A . n A 1 110 VAL 110 92 92 VAL VAL A . n A 1 111 ASN 111 93 93 ASN ASN A . n A 1 112 CYS 112 94 94 CYS CYS A . n A 1 113 ALA 113 95 95 ALA ALA A . n A 1 114 LYS 114 96 96 LYS LYS A . n A 1 115 LYS 115 97 97 LYS LYS A . n A 1 116 ILE 116 98 98 ILE ILE A . n A 1 117 VAL 117 99 99 VAL VAL A . n A 1 118 SER 118 100 100 SER SER A . n A 1 119 ASP 119 101 101 ASP ASP A . n A 1 120 GLY 120 102 102 GLY GLY A . n A 1 121 ASN 121 103 103 ASN ASN A . n A 1 122 GLY 122 104 104 GLY GLY A . n A 1 123 MET 123 105 105 MET MET A . n A 1 124 ASN 124 106 106 ASN ASN A . n A 1 125 ALA 125 107 107 ALA ALA A . n A 1 126 TRP 126 108 108 TRP TRP A . n A 1 127 VAL 127 109 109 VAL VAL A . n A 1 128 ALA 128 110 110 ALA ALA A . n A 1 129 TRP 129 111 111 TRP TRP A . n A 1 130 ARG 130 112 112 ARG ARG A . n A 1 131 ASN 131 113 113 ASN ASN A . n A 1 132 ARG 132 114 114 ARG ARG A . n A 1 133 CYS 133 115 115 CYS CYS A . n A 1 134 LYS 134 116 116 LYS LYS A . n A 1 135 GLY 135 117 117 GLY GLY A . n A 1 136 THR 136 118 118 THR THR A . n A 1 137 ASP 137 119 119 ASP ASP A . n A 1 138 VAL 138 120 120 VAL VAL A . n A 1 139 GLN 139 121 121 GLN GLN A . n A 1 140 ALA 140 122 122 ALA ALA A . n A 1 141 TRP 141 123 123 TRP TRP A . n A 1 142 ILE 142 124 124 ILE ILE A . n A 1 143 ARG 143 125 125 ARG ARG A . n A 1 144 GLY 144 126 126 GLY GLY A . n A 1 145 CYS 145 127 127 CYS CYS A . n A 1 146 ARG 146 128 128 ARG ALA A . n A 1 147 LEU 147 129 129 LEU ALA A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ACT 1 201 201 ACT ACT A . C 3 CL 1 202 4 CL CL A . D 3 CL 1 203 7 CL CL A . E 3 CL 1 204 8 CL CL A . F 4 HOH 1 301 128 HOH HOH A . F 4 HOH 2 302 58 HOH HOH A . F 4 HOH 3 303 131 HOH HOH A . F 4 HOH 4 304 123 HOH HOH A . F 4 HOH 5 305 61 HOH HOH A . F 4 HOH 6 306 137 HOH HOH A . F 4 HOH 7 307 121 HOH HOH A . F 4 HOH 8 308 69 HOH HOH A . F 4 HOH 9 309 64 HOH HOH A . F 4 HOH 10 310 106 HOH HOH A . F 4 HOH 11 311 62 HOH HOH A . F 4 HOH 12 312 56 HOH HOH A . F 4 HOH 13 313 92 HOH HOH A . F 4 HOH 14 314 2 HOH HOH A . F 4 HOH 15 315 36 HOH HOH A . F 4 HOH 16 316 31 HOH HOH A . F 4 HOH 17 317 22 HOH HOH A . F 4 HOH 18 318 84 HOH HOH A . F 4 HOH 19 319 30 HOH HOH A . F 4 HOH 20 320 35 HOH HOH A . F 4 HOH 21 321 101 HOH HOH A . F 4 HOH 22 322 17 HOH HOH A . F 4 HOH 23 323 10 HOH HOH A . F 4 HOH 24 324 34 HOH HOH A . F 4 HOH 25 325 24 HOH HOH A . F 4 HOH 26 326 50 HOH HOH A . F 4 HOH 27 327 18 HOH HOH A . F 4 HOH 28 328 20 HOH HOH A . F 4 HOH 29 329 15 HOH HOH A . F 4 HOH 30 330 82 HOH HOH A . F 4 HOH 31 331 27 HOH HOH A . F 4 HOH 32 332 160 HOH HOH A . F 4 HOH 33 333 45 HOH HOH A . F 4 HOH 34 334 9 HOH HOH A . F 4 HOH 35 335 26 HOH HOH A . F 4 HOH 36 336 96 HOH HOH A . F 4 HOH 37 337 25 HOH HOH A . F 4 HOH 38 338 118 HOH HOH A . F 4 HOH 39 339 47 HOH HOH A . F 4 HOH 40 340 70 HOH HOH A . F 4 HOH 41 341 13 HOH HOH A . F 4 HOH 42 342 29 HOH HOH A . F 4 HOH 43 343 7 HOH HOH A . F 4 HOH 44 344 21 HOH HOH A . F 4 HOH 45 345 12 HOH HOH A . F 4 HOH 46 346 100 HOH HOH A . F 4 HOH 47 347 5 HOH HOH A . F 4 HOH 48 348 1 HOH HOH A . F 4 HOH 49 349 130 HOH HOH A . F 4 HOH 50 350 68 HOH HOH A . F 4 HOH 51 351 46 HOH HOH A . F 4 HOH 52 352 75 HOH HOH A . F 4 HOH 53 353 3 HOH HOH A . F 4 HOH 54 354 8 HOH HOH A . F 4 HOH 55 355 60 HOH HOH A . F 4 HOH 56 356 37 HOH HOH A . F 4 HOH 57 357 78 HOH HOH A . F 4 HOH 58 358 76 HOH HOH A . F 4 HOH 59 359 16 HOH HOH A . F 4 HOH 60 360 4 HOH HOH A . F 4 HOH 61 361 44 HOH HOH A . F 4 HOH 62 362 119 HOH HOH A . F 4 HOH 63 363 28 HOH HOH A . F 4 HOH 64 364 59 HOH HOH A . F 4 HOH 65 365 14 HOH HOH A . F 4 HOH 66 366 42 HOH HOH A . F 4 HOH 67 367 153 HOH HOH A . F 4 HOH 68 368 91 HOH HOH A . F 4 HOH 69 369 11 HOH HOH A . F 4 HOH 70 370 6 HOH HOH A . F 4 HOH 71 371 165 HOH HOH A . F 4 HOH 72 372 38 HOH HOH A . F 4 HOH 73 373 85 HOH HOH A . F 4 HOH 74 374 33 HOH HOH A . F 4 HOH 75 375 39 HOH HOH A . F 4 HOH 76 376 134 HOH HOH A . F 4 HOH 77 377 87 HOH HOH A . F 4 HOH 78 378 88 HOH HOH A . F 4 HOH 79 379 168 HOH HOH A . F 4 HOH 80 380 81 HOH HOH A . F 4 HOH 81 381 52 HOH HOH A . F 4 HOH 82 382 111 HOH HOH A . F 4 HOH 83 383 93 HOH HOH A . F 4 HOH 84 384 79 HOH HOH A . F 4 HOH 85 385 141 HOH HOH A . F 4 HOH 86 386 115 HOH HOH A . F 4 HOH 87 387 99 HOH HOH A . F 4 HOH 88 388 63 HOH HOH A . F 4 HOH 89 389 132 HOH HOH A . F 4 HOH 90 390 23 HOH HOH A . F 4 HOH 91 391 116 HOH HOH A . F 4 HOH 92 392 154 HOH HOH A . F 4 HOH 93 393 166 HOH HOH A . F 4 HOH 94 394 41 HOH HOH A . F 4 HOH 95 395 143 HOH HOH A . F 4 HOH 96 396 43 HOH HOH A . F 4 HOH 97 397 54 HOH HOH A . F 4 HOH 98 398 53 HOH HOH A . F 4 HOH 99 399 32 HOH HOH A . F 4 HOH 100 400 104 HOH HOH A . F 4 HOH 101 401 40 HOH HOH A . F 4 HOH 102 402 80 HOH HOH A . F 4 HOH 103 403 139 HOH HOH A . F 4 HOH 104 404 19 HOH HOH A . F 4 HOH 105 405 71 HOH HOH A . F 4 HOH 106 406 48 HOH HOH A . F 4 HOH 107 407 77 HOH HOH A . F 4 HOH 108 408 135 HOH HOH A . F 4 HOH 109 409 167 HOH HOH A . F 4 HOH 110 410 114 HOH HOH A . F 4 HOH 111 411 86 HOH HOH A . F 4 HOH 112 412 125 HOH HOH A . F 4 HOH 113 413 74 HOH HOH A . F 4 HOH 114 414 138 HOH HOH A . F 4 HOH 115 415 158 HOH HOH A . F 4 HOH 116 416 129 HOH HOH A . F 4 HOH 117 417 142 HOH HOH A . F 4 HOH 118 418 126 HOH HOH A . F 4 HOH 119 419 67 HOH HOH A . F 4 HOH 120 420 72 HOH HOH A . F 4 HOH 121 421 95 HOH HOH A . F 4 HOH 122 422 51 HOH HOH A . F 4 HOH 123 423 113 HOH HOH A . F 4 HOH 124 424 122 HOH HOH A . F 4 HOH 125 425 66 HOH HOH A . F 4 HOH 126 426 55 HOH HOH A . F 4 HOH 127 427 90 HOH HOH A . F 4 HOH 128 428 127 HOH HOH A . F 4 HOH 129 429 83 HOH HOH A . F 4 HOH 130 430 73 HOH HOH A . F 4 HOH 131 431 107 HOH HOH A . F 4 HOH 132 432 108 HOH HOH A . F 4 HOH 133 433 112 HOH HOH A . F 4 HOH 134 434 103 HOH HOH A . F 4 HOH 135 435 94 HOH HOH A . F 4 HOH 136 436 89 HOH HOH A . F 4 HOH 137 437 109 HOH HOH A . F 4 HOH 138 438 140 HOH HOH A . F 4 HOH 139 439 105 HOH HOH A . F 4 HOH 140 440 124 HOH HOH A . F 4 HOH 141 441 144 HOH HOH A . F 4 HOH 142 442 146 HOH HOH A . F 4 HOH 143 443 98 HOH HOH A . F 4 HOH 144 444 110 HOH HOH A . F 4 HOH 145 445 147 HOH HOH A . F 4 HOH 146 446 148 HOH HOH A . F 4 HOH 147 447 145 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 128 ? CG ? A ARG 146 CG 2 1 Y 1 A ARG 128 ? CD ? A ARG 146 CD 3 1 Y 1 A ARG 128 ? NE ? A ARG 146 NE 4 1 Y 1 A ARG 128 ? CZ ? A ARG 146 CZ 5 1 Y 1 A ARG 128 ? NH1 ? A ARG 146 NH1 6 1 Y 1 A ARG 128 ? NH2 ? A ARG 146 NH2 7 1 Y 1 A LEU 129 ? CG ? A LEU 147 CG 8 1 Y 1 A LEU 129 ? CD1 ? A LEU 147 CD1 9 1 Y 1 A LEU 129 ? CD2 ? A LEU 147 CD2 # _cell.angle_alpha 87.730 _cell.angle_alpha_esd ? _cell.angle_beta 108.970 _cell.angle_beta_esd ? _cell.angle_gamma 111.600 _cell.angle_gamma_esd ? _cell.entry_id 9QUM _cell.details ? _cell.formula_units_Z ? _cell.length_a 26.660 _cell.length_a_esd ? _cell.length_b 31.150 _cell.length_b_esd ? _cell.length_c 33.570 _cell.length_c_esd ? _cell.volume 24411.176 _cell.volume_esd ? _cell.Z_PDB 1 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9QUM _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 _symmetry.space_group_name_Hall 'P 1' _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9QUM _exptl.crystals_number ? _exptl.details ? _exptl.method 'ELECTRON CRYSTALLOGRAPHY' _exptl.method_details ? # _reflns.B_iso_Wilson_estimate 8.70 _reflns.entry_id 9QUM _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high ? _reflns.d_resolution_low ? _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs ? _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs ? _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI ? _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 11.04 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9QUM _refine.pdbx_refine_id 'ELECTRON CRYSTALLOGRAPHY' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 0.83 _refine.ls_d_res_low 11.73 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 87855 _refine.ls_number_reflns_R_free 2000 _refine.ls_number_reflns_R_work 85855 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.29 _refine.ls_percent_reflns_R_free 2.28 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1762 _refine.ls_R_factor_R_free 0.2064 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1755 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.96 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct ? _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details 'Random selection' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 28.8099 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1562 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'ELECTRON CRYSTALLOGRAPHY' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 0.83 _refine_hist.d_res_low 11.73 _refine_hist.number_atoms_solvent 147 _refine_hist.number_atoms_total 1146 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 992 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 7 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'ELECTRON CRYSTALLOGRAPHY' ? 0.0188 ? 1075 ? f_bond_d ? ? ? 'ELECTRON CRYSTALLOGRAPHY' ? 1.2195 ? 1464 ? f_angle_d ? ? ? 'ELECTRON CRYSTALLOGRAPHY' ? 0.1137 ? 151 ? f_chiral_restr ? ? ? 'ELECTRON CRYSTALLOGRAPHY' ? 0.0113 ? 196 ? f_plane_restr ? ? ? 'ELECTRON CRYSTALLOGRAPHY' ? 6.3402 ? 161 ? f_dihedral_angle_d ? ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'ELECTRON CRYSTALLOGRAPHY' 0.83 0.85 . . 123 5308 85.43 . . . . 0.3942 . . . . . . . . . . . . . . . 0.3823 'ELECTRON CRYSTALLOGRAPHY' 0.85 0.87 . . 137 5842 93.73 . . . . 0.3934 . . . . . . . . . . . . . . . 0.4083 'ELECTRON CRYSTALLOGRAPHY' 0.87 0.90 . . 143 6131 98.03 . . . . 0.3719 . . . . . . . . . . . . . . . 0.3872 'ELECTRON CRYSTALLOGRAPHY' 0.90 0.93 . . 144 6195 99.25 . . . . 0.3439 . . . . . . . . . . . . . . . 0.3364 'ELECTRON CRYSTALLOGRAPHY' 0.93 0.96 . . 145 6245 99.75 . . . . 0.3193 . . . . . . . . . . . . . . . 0.3664 'ELECTRON CRYSTALLOGRAPHY' 0.96 1.00 . . 145 6218 99.94 . . . . 0.2854 . . . . . . . . . . . . . . . 0.3025 'ELECTRON CRYSTALLOGRAPHY' 1.00 1.05 . . 146 6235 99.98 . . . . 0.2461 . . . . . . . . . . . . . . . 0.2756 'ELECTRON CRYSTALLOGRAPHY' 1.05 1.10 . . 144 6211 100.00 . . . . 0.2077 . . . . . . . . . . . . . . . 0.2517 'ELECTRON CRYSTALLOGRAPHY' 1.10 1.17 . . 146 6277 100.00 . . . . 0.1736 . . . . . . . . . . . . . . . 0.2272 'ELECTRON CRYSTALLOGRAPHY' 1.17 1.26 . . 145 6248 100.00 . . . . 0.1594 . . . . . . . . . . . . . . . 0.1926 'ELECTRON CRYSTALLOGRAPHY' 1.26 1.39 . . 145 6213 100.00 . . . . 0.1536 . . . . . . . . . . . . . . . 0.1843 'ELECTRON CRYSTALLOGRAPHY' 1.39 1.59 . . 147 6260 100.00 . . . . 0.1488 . . . . . . . . . . . . . . . 0.2064 'ELECTRON CRYSTALLOGRAPHY' 1.59 2.00 . . 144 6231 100.00 . . . . 0.1552 . . . . . . . . . . . . . . . 0.1809 'ELECTRON CRYSTALLOGRAPHY' 2.00 11.73 . . 146 6241 99.97 . . . . 0.1315 . . . . . . . . . . . . . . . 0.1557 # _struct.entry_id 9QUM _struct.title 'Structure of lysozyme by continuous serial electron diffraction (SerialED)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9QUM _struct_keywords.text 'serial electron diffraction, SerialED, lysozyme, Hydrolase' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 3 ? F N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code LYSC_CHICK _struct_ref.pdbx_db_accession P00698 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MRSLLILVLCFLPLAALGKVFGRCELAAAMKRHGLDNYRGYSLGNWVCAAKFESNFNTQATNRNTDGSTDYGILQINSRW WCNDGRTPGSRNLCNIPCSALLSSDITASVNCAKKIVSDGNGMNAWVAWRNRCKGTDVQAWIRGCRL ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9QUM _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 147 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00698 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 147 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg -17 _struct_ref_seq.pdbx_auth_seq_align_end 129 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 590 ? 1 MORE -27 ? 1 'SSA (A^2)' 6210 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 22 ? HIS A 33 ? GLY A 4 HIS A 15 1 ? 12 HELX_P HELX_P2 AA2 ASN A 37 ? TYR A 41 ? ASN A 19 TYR A 23 5 ? 5 HELX_P HELX_P3 AA3 SER A 42 ? ASN A 55 ? SER A 24 ASN A 37 1 ? 14 HELX_P HELX_P4 AA4 PRO A 97 ? SER A 103 ? PRO A 79 SER A 85 5 ? 7 HELX_P HELX_P5 AA5 ILE A 106 ? ASP A 119 ? ILE A 88 ASP A 101 1 ? 14 HELX_P HELX_P6 AA6 GLY A 122 ? ALA A 125 ? GLY A 104 ALA A 107 5 ? 4 HELX_P HELX_P7 AA7 TRP A 126 ? CYS A 133 ? TRP A 108 CYS A 115 1 ? 8 HELX_P HELX_P8 AA8 ASP A 137 ? ARG A 143 ? ASP A 119 ARG A 125 5 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 24 SG ? ? ? 1_555 A CYS 145 SG ? ? A CYS 6 A CYS 127 1_555 ? ? ? ? ? ? ? 2.068 ? ? disulf2 disulf ? ? A CYS 48 SG ? ? ? 1_555 A CYS 133 SG ? ? A CYS 30 A CYS 115 1_555 ? ? ? ? ? ? ? 2.038 ? ? disulf3 disulf ? ? A CYS 82 SG ? ? ? 1_555 A CYS 98 SG ? ? A CYS 64 A CYS 80 1_555 ? ? ? ? ? ? ? 2.009 ? ? disulf4 disulf ? ? A CYS 94 SG ? ? ? 1_555 A CYS 112 SG ? ? A CYS 76 A CYS 94 1_555 ? ? ? ? ? ? ? 2.003 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 24 ? CYS A 145 ? CYS A 6 ? 1_555 CYS A 127 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 48 ? CYS A 133 ? CYS A 30 ? 1_555 CYS A 115 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 82 ? CYS A 98 ? CYS A 64 ? 1_555 CYS A 80 ? 1_555 SG SG . . . None 'Disulfide bridge' 4 CYS A 94 ? CYS A 112 ? CYS A 76 ? 1_555 CYS A 94 ? 1_555 SG SG . . . None 'Disulfide bridge' # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 61 ? ARG A 63 ? THR A 43 ARG A 45 AA1 2 THR A 69 ? TYR A 71 ? THR A 51 TYR A 53 AA1 3 ILE A 76 ? ASN A 77 ? ILE A 58 ASN A 59 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ASN A 62 ? N ASN A 44 O ASP A 70 ? O ASP A 52 AA1 2 3 N TYR A 71 ? N TYR A 53 O ILE A 76 ? O ILE A 58 # _pdbx_entry_details.entry_id 9QUM _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HD21 A ASN 106 ? ? O A HOH 301 ? ? 1.59 2 1 ND2 A ASN 106 ? ? O A HOH 301 ? ? 1.91 3 1 O A HOH 407 ? ? O A HOH 434 ? ? 1.92 4 1 O A HOH 445 ? ? O A HOH 446 ? ? 2.00 5 1 O A HOH 397 ? ? O A HOH 416 ? ? 2.08 6 1 O A HOH 313 ? ? O A HOH 428 ? ? 2.09 7 1 O A HOH 371 ? ? O A HOH 414 ? ? 2.12 8 1 OD2 A ASP 52 ? ? O A HOH 302 ? ? 2.12 9 1 O A HOH 382 ? ? O A HOH 412 ? ? 2.15 10 1 O A ARG 68 ? ? O A HOH 303 ? ? 2.15 11 1 CL A CL 204 ? A O A HOH 416 ? ? 2.18 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O A HOH 412 ? ? 1_555 O A HOH 437 ? ? 1_556 1.80 2 1 O A HOH 382 ? ? 1_555 O A HOH 437 ? ? 1_556 1.80 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ASP _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 101 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -89.74 _pdbx_validate_torsion.psi 37.02 # _space_group_symop.id 1 _space_group_symop.operation_xyz x,y,z # _em_3d_fitting.id 1 _em_3d_fitting.entry_id 9QUM _em_3d_fitting.method ? _em_3d_fitting.target_criteria maximum-likelihood _em_3d_fitting.details ? _em_3d_fitting.overall_b_value 11.04 _em_3d_fitting.ref_space RECIPROCAL _em_3d_fitting.ref_protocol OTHER # _em_3d_fitting_list.id 1 _em_3d_fitting_list.3d_fitting_id 1 _em_3d_fitting_list.pdb_entry_id 7SKW _em_3d_fitting_list.pdb_chain_id ? _em_3d_fitting_list.pdb_chain_residue_range ? _em_3d_fitting_list.details ? _em_3d_fitting_list.chain_id ? _em_3d_fitting_list.chain_residue_range ? _em_3d_fitting_list.source_name PDB _em_3d_fitting_list.type 'experimental model' _em_3d_fitting_list.accession_code 7SKW _em_3d_fitting_list.initial_refinement_model_id 1 # _em_3d_reconstruction.entry_id 9QUM _em_3d_reconstruction.id 1 _em_3d_reconstruction.method ? _em_3d_reconstruction.algorithm ? _em_3d_reconstruction.citation_id ? _em_3d_reconstruction.details ? _em_3d_reconstruction.resolution 0.83 _em_3d_reconstruction.resolution_method 'DIFFRACTION PATTERN/LAYERLINES' _em_3d_reconstruction.magnification_calibration ? _em_3d_reconstruction.nominal_pixel_size ? _em_3d_reconstruction.actual_pixel_size ? _em_3d_reconstruction.num_particles ? _em_3d_reconstruction.euler_angles_details ? _em_3d_reconstruction.num_class_averages ? _em_3d_reconstruction.refinement_type ? _em_3d_reconstruction.image_processing_id 1 _em_3d_reconstruction.symmetry_type '3D CRYSTAL' # _em_buffer.id 1 _em_buffer.specimen_id 1 _em_buffer.name ? _em_buffer.details 'Crystals were produced by adding 1 part of lysozyme solution (40 mg/mL) to 1 part of precipitant (0.8 M NaNO3, 50mM NaAc, pH 4.5)' _em_buffer.pH 4.5 # _em_entity_assembly.id 1 _em_entity_assembly.parent_id 0 _em_entity_assembly.source NATURAL _em_entity_assembly.type 'ORGANELLE OR CELLULAR COMPONENT' _em_entity_assembly.name Lysozyme _em_entity_assembly.details ? _em_entity_assembly.synonym ? _em_entity_assembly.oligomeric_details ? _em_entity_assembly.entity_id_list 1 # _em_imaging.entry_id 9QUM _em_imaging.id 1 _em_imaging.astigmatism ? _em_imaging.electron_beam_tilt_params ? _em_imaging.residual_tilt ? _em_imaging.microscope_model 'TFS KRIOS' _em_imaging.specimen_holder_type ? _em_imaging.specimen_holder_model 'FEI TITAN KRIOS AUTOGRID HOLDER' _em_imaging.details ? _em_imaging.date ? _em_imaging.accelerating_voltage 300 _em_imaging.illumination_mode 'FLOOD BEAM' _em_imaging.mode DIFFRACTION _em_imaging.nominal_cs ? _em_imaging.nominal_defocus_min 0 _em_imaging.nominal_defocus_max 0 _em_imaging.calibrated_defocus_min 0 _em_imaging.calibrated_defocus_max ? _em_imaging.tilt_angle_min ? _em_imaging.tilt_angle_max ? _em_imaging.nominal_magnification ? _em_imaging.calibrated_magnification ? _em_imaging.electron_source 'FIELD EMISSION GUN' _em_imaging.citation_id ? _em_imaging.temperature ? _em_imaging.detector_distance ? _em_imaging.recording_temperature_minimum 78 _em_imaging.recording_temperature_maximum 98 _em_imaging.alignment_procedure ? _em_imaging.c2_aperture_diameter 20 _em_imaging.specimen_id 1 _em_imaging.cryogen NITROGEN _em_imaging.objective_aperture ? _em_imaging.microscope_serial_number ? _em_imaging.microscope_version ? # _em_sample_support.id 1 _em_sample_support.film_material ? _em_sample_support.method ? _em_sample_support.grid_material COPPER _em_sample_support.grid_mesh_size 200 _em_sample_support.grid_type 'Quantifoil R0.6/1' _em_sample_support.details ? _em_sample_support.specimen_id 1 _em_sample_support.citation_id ? # _em_vitrification.entry_id 9QUM _em_vitrification.id 1 _em_vitrification.specimen_id 1 _em_vitrification.cryogen_name ETHANE _em_vitrification.humidity ? _em_vitrification.temp ? _em_vitrification.chamber_temperature ? _em_vitrification.instrument ? _em_vitrification.method ? _em_vitrification.time_resolved_state ? _em_vitrification.citation_id ? _em_vitrification.details 'Manual blotting in room temperature with ambient humidity' # _em_experiment.entry_id 9QUM _em_experiment.id 1 _em_experiment.reconstruction_method CRYSTALLOGRAPHY _em_experiment.aggregation_state '3D ARRAY' _em_experiment.entity_assembly_id 1 # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 442 ? 6.03 . 2 1 O ? A HOH 443 ? 6.09 . 3 1 O ? A HOH 444 ? 6.66 . 4 1 O ? A HOH 445 ? 7.15 . 5 1 O ? A HOH 446 ? 7.50 . 6 1 O ? A HOH 447 ? 9.12 . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -17 ? A MET 1 2 1 Y 1 A ARG -16 ? A ARG 2 3 1 Y 1 A SER -15 ? A SER 3 4 1 Y 1 A LEU -14 ? A LEU 4 5 1 Y 1 A LEU -13 ? A LEU 5 6 1 Y 1 A ILE -12 ? A ILE 6 7 1 Y 1 A LEU -11 ? A LEU 7 8 1 Y 1 A VAL -10 ? A VAL 8 9 1 Y 1 A LEU -9 ? A LEU 9 10 1 Y 1 A CYS -8 ? A CYS 10 11 1 Y 1 A PHE -7 ? A PHE 11 12 1 Y 1 A LEU -6 ? A LEU 12 13 1 Y 1 A PRO -5 ? A PRO 13 14 1 Y 1 A LEU -4 ? A LEU 14 15 1 Y 1 A ALA -3 ? A ALA 15 16 1 Y 1 A ALA -2 ? A ALA 16 17 1 Y 1 A LEU -1 ? A LEU 17 18 1 Y 1 A GLY 0 ? A GLY 18 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ACT C C N N 1 ACT O O N N 2 ACT OXT O N N 3 ACT CH3 C N N 4 ACT H1 H N N 5 ACT H2 H N N 6 ACT H3 H N N 7 ALA N N N N 8 ALA CA C N S 9 ALA C C N N 10 ALA O O N N 11 ALA CB C N N 12 ALA OXT O N N 13 ALA H H N N 14 ALA H2 H N N 15 ALA HA H N N 16 ALA HB1 H N N 17 ALA HB2 H N N 18 ALA HB3 H N N 19 ALA HXT H N N 20 ARG N N N N 21 ARG CA C N S 22 ARG C C N N 23 ARG O O N N 24 ARG CB C N N 25 ARG CG C N N 26 ARG CD C N N 27 ARG NE N N N 28 ARG CZ C N N 29 ARG NH1 N N N 30 ARG NH2 N N N 31 ARG OXT O N N 32 ARG H H N N 33 ARG H2 H N N 34 ARG HA H N N 35 ARG HB2 H N N 36 ARG HB3 H N N 37 ARG HG2 H N N 38 ARG HG3 H N N 39 ARG HD2 H N N 40 ARG HD3 H N N 41 ARG HE H N N 42 ARG HH11 H N N 43 ARG HH12 H N N 44 ARG HH21 H N N 45 ARG HH22 H N N 46 ARG HXT H N N 47 ASN N N N N 48 ASN CA C N S 49 ASN C C N N 50 ASN O O N N 51 ASN CB C N N 52 ASN CG C N N 53 ASN OD1 O N N 54 ASN ND2 N N N 55 ASN OXT O N N 56 ASN H H N N 57 ASN H2 H N N 58 ASN HA H N N 59 ASN HB2 H N N 60 ASN HB3 H N N 61 ASN HD21 H N N 62 ASN HD22 H N N 63 ASN HXT H N N 64 ASP N N N N 65 ASP CA C N S 66 ASP C C N N 67 ASP O O N N 68 ASP CB C N N 69 ASP CG C N N 70 ASP OD1 O N N 71 ASP OD2 O N N 72 ASP OXT O N N 73 ASP H H N N 74 ASP H2 H N N 75 ASP HA H N N 76 ASP HB2 H N N 77 ASP HB3 H N N 78 ASP HD2 H N N 79 ASP HXT H N N 80 CL CL CL N N 81 CYS N N N N 82 CYS CA C N R 83 CYS C C N N 84 CYS O O N N 85 CYS CB C N N 86 CYS SG S N N 87 CYS OXT O N N 88 CYS H H N N 89 CYS H2 H N N 90 CYS HA H N N 91 CYS HB2 H N N 92 CYS HB3 H N N 93 CYS HG H N N 94 CYS HXT H N N 95 GLN N N N N 96 GLN CA C N S 97 GLN C C N N 98 GLN O O N N 99 GLN CB C N N 100 GLN CG C N N 101 GLN CD C N N 102 GLN OE1 O N N 103 GLN NE2 N N N 104 GLN OXT O N N 105 GLN H H N N 106 GLN H2 H N N 107 GLN HA H N N 108 GLN HB2 H N N 109 GLN HB3 H N N 110 GLN HG2 H N N 111 GLN HG3 H N N 112 GLN HE21 H N N 113 GLN HE22 H N N 114 GLN HXT H N N 115 GLU N N N N 116 GLU CA C N S 117 GLU C C N N 118 GLU O O N N 119 GLU CB C N N 120 GLU CG C N N 121 GLU CD C N N 122 GLU OE1 O N N 123 GLU OE2 O N N 124 GLU OXT O N N 125 GLU H H N N 126 GLU H2 H N N 127 GLU HA H N N 128 GLU HB2 H N N 129 GLU HB3 H N N 130 GLU HG2 H N N 131 GLU HG3 H N N 132 GLU HE2 H N N 133 GLU HXT H N N 134 GLY N N N N 135 GLY CA C N N 136 GLY C C N N 137 GLY O O N N 138 GLY OXT O N N 139 GLY H H N N 140 GLY H2 H N N 141 GLY HA2 H N N 142 GLY HA3 H N N 143 GLY HXT H N N 144 HIS N N N N 145 HIS CA C N S 146 HIS C C N N 147 HIS O O N N 148 HIS CB C N N 149 HIS CG C Y N 150 HIS ND1 N Y N 151 HIS CD2 C Y N 152 HIS CE1 C Y N 153 HIS NE2 N Y N 154 HIS OXT O N N 155 HIS H H N N 156 HIS H2 H N N 157 HIS HA H N N 158 HIS HB2 H N N 159 HIS HB3 H N N 160 HIS HD1 H N N 161 HIS HD2 H N N 162 HIS HE1 H N N 163 HIS HE2 H N N 164 HIS HXT H N N 165 HOH O O N N 166 HOH H1 H N N 167 HOH H2 H N N 168 ILE N N N N 169 ILE CA C N S 170 ILE C C N N 171 ILE O O N N 172 ILE CB C N S 173 ILE CG1 C N N 174 ILE CG2 C N N 175 ILE CD1 C N N 176 ILE OXT O N N 177 ILE H H N N 178 ILE H2 H N N 179 ILE HA H N N 180 ILE HB H N N 181 ILE HG12 H N N 182 ILE HG13 H N N 183 ILE HG21 H N N 184 ILE HG22 H N N 185 ILE HG23 H N N 186 ILE HD11 H N N 187 ILE HD12 H N N 188 ILE HD13 H N N 189 ILE HXT H N N 190 LEU N N N N 191 LEU CA C N S 192 LEU C C N N 193 LEU O O N N 194 LEU CB C N N 195 LEU CG C N N 196 LEU CD1 C N N 197 LEU CD2 C N N 198 LEU OXT O N N 199 LEU H H N N 200 LEU H2 H N N 201 LEU HA H N N 202 LEU HB2 H N N 203 LEU HB3 H N N 204 LEU HG H N N 205 LEU HD11 H N N 206 LEU HD12 H N N 207 LEU HD13 H N N 208 LEU HD21 H N N 209 LEU HD22 H N N 210 LEU HD23 H N N 211 LEU HXT H N N 212 LYS N N N N 213 LYS CA C N S 214 LYS C C N N 215 LYS O O N N 216 LYS CB C N N 217 LYS CG C N N 218 LYS CD C N N 219 LYS CE C N N 220 LYS NZ N N N 221 LYS OXT O N N 222 LYS H H N N 223 LYS H2 H N N 224 LYS HA H N N 225 LYS HB2 H N N 226 LYS HB3 H N N 227 LYS HG2 H N N 228 LYS HG3 H N N 229 LYS HD2 H N N 230 LYS HD3 H N N 231 LYS HE2 H N N 232 LYS HE3 H N N 233 LYS HZ1 H N N 234 LYS HZ2 H N N 235 LYS HZ3 H N N 236 LYS HXT H N N 237 MET N N N N 238 MET CA C N S 239 MET C C N N 240 MET O O N N 241 MET CB C N N 242 MET CG C N N 243 MET SD S N N 244 MET CE C N N 245 MET OXT O N N 246 MET H H N N 247 MET H2 H N N 248 MET HA H N N 249 MET HB2 H N N 250 MET HB3 H N N 251 MET HG2 H N N 252 MET HG3 H N N 253 MET HE1 H N N 254 MET HE2 H N N 255 MET HE3 H N N 256 MET HXT H N N 257 PHE N N N N 258 PHE CA C N S 259 PHE C C N N 260 PHE O O N N 261 PHE CB C N N 262 PHE CG C Y N 263 PHE CD1 C Y N 264 PHE CD2 C Y N 265 PHE CE1 C Y N 266 PHE CE2 C Y N 267 PHE CZ C Y N 268 PHE OXT O N N 269 PHE H H N N 270 PHE H2 H N N 271 PHE HA H N N 272 PHE HB2 H N N 273 PHE HB3 H N N 274 PHE HD1 H N N 275 PHE HD2 H N N 276 PHE HE1 H N N 277 PHE HE2 H N N 278 PHE HZ H N N 279 PHE HXT H N N 280 PRO N N N N 281 PRO CA C N S 282 PRO C C N N 283 PRO O O N N 284 PRO CB C N N 285 PRO CG C N N 286 PRO CD C N N 287 PRO OXT O N N 288 PRO H H N N 289 PRO HA H N N 290 PRO HB2 H N N 291 PRO HB3 H N N 292 PRO HG2 H N N 293 PRO HG3 H N N 294 PRO HD2 H N N 295 PRO HD3 H N N 296 PRO HXT H N N 297 SER N N N N 298 SER CA C N S 299 SER C C N N 300 SER O O N N 301 SER CB C N N 302 SER OG O N N 303 SER OXT O N N 304 SER H H N N 305 SER H2 H N N 306 SER HA H N N 307 SER HB2 H N N 308 SER HB3 H N N 309 SER HG H N N 310 SER HXT H N N 311 THR N N N N 312 THR CA C N S 313 THR C C N N 314 THR O O N N 315 THR CB C N R 316 THR OG1 O N N 317 THR CG2 C N N 318 THR OXT O N N 319 THR H H N N 320 THR H2 H N N 321 THR HA H N N 322 THR HB H N N 323 THR HG1 H N N 324 THR HG21 H N N 325 THR HG22 H N N 326 THR HG23 H N N 327 THR HXT H N N 328 TRP N N N N 329 TRP CA C N S 330 TRP C C N N 331 TRP O O N N 332 TRP CB C N N 333 TRP CG C Y N 334 TRP CD1 C Y N 335 TRP CD2 C Y N 336 TRP NE1 N Y N 337 TRP CE2 C Y N 338 TRP CE3 C Y N 339 TRP CZ2 C Y N 340 TRP CZ3 C Y N 341 TRP CH2 C Y N 342 TRP OXT O N N 343 TRP H H N N 344 TRP H2 H N N 345 TRP HA H N N 346 TRP HB2 H N N 347 TRP HB3 H N N 348 TRP HD1 H N N 349 TRP HE1 H N N 350 TRP HE3 H N N 351 TRP HZ2 H N N 352 TRP HZ3 H N N 353 TRP HH2 H N N 354 TRP HXT H N N 355 TYR N N N N 356 TYR CA C N S 357 TYR C C N N 358 TYR O O N N 359 TYR CB C N N 360 TYR CG C Y N 361 TYR CD1 C Y N 362 TYR CD2 C Y N 363 TYR CE1 C Y N 364 TYR CE2 C Y N 365 TYR CZ C Y N 366 TYR OH O N N 367 TYR OXT O N N 368 TYR H H N N 369 TYR H2 H N N 370 TYR HA H N N 371 TYR HB2 H N N 372 TYR HB3 H N N 373 TYR HD1 H N N 374 TYR HD2 H N N 375 TYR HE1 H N N 376 TYR HE2 H N N 377 TYR HH H N N 378 TYR HXT H N N 379 VAL N N N N 380 VAL CA C N S 381 VAL C C N N 382 VAL O O N N 383 VAL CB C N N 384 VAL CG1 C N N 385 VAL CG2 C N N 386 VAL OXT O N N 387 VAL H H N N 388 VAL H2 H N N 389 VAL HA H N N 390 VAL HB H N N 391 VAL HG11 H N N 392 VAL HG12 H N N 393 VAL HG13 H N N 394 VAL HG21 H N N 395 VAL HG22 H N N 396 VAL HG23 H N N 397 VAL HXT H N N 398 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ACT C O doub N N 1 ACT C OXT sing N N 2 ACT C CH3 sing N N 3 ACT CH3 H1 sing N N 4 ACT CH3 H2 sing N N 5 ACT CH3 H3 sing N N 6 ALA N CA sing N N 7 ALA N H sing N N 8 ALA N H2 sing N N 9 ALA CA C sing N N 10 ALA CA CB sing N N 11 ALA CA HA sing N N 12 ALA C O doub N N 13 ALA C OXT sing N N 14 ALA CB HB1 sing N N 15 ALA CB HB2 sing N N 16 ALA CB HB3 sing N N 17 ALA OXT HXT sing N N 18 ARG N CA sing N N 19 ARG N H sing N N 20 ARG N H2 sing N N 21 ARG CA C sing N N 22 ARG CA CB sing N N 23 ARG CA HA sing N N 24 ARG C O doub N N 25 ARG C OXT sing N N 26 ARG CB CG sing N N 27 ARG CB HB2 sing N N 28 ARG CB HB3 sing N N 29 ARG CG CD sing N N 30 ARG CG HG2 sing N N 31 ARG CG HG3 sing N N 32 ARG CD NE sing N N 33 ARG CD HD2 sing N N 34 ARG CD HD3 sing N N 35 ARG NE CZ sing N N 36 ARG NE HE sing N N 37 ARG CZ NH1 sing N N 38 ARG CZ NH2 doub N N 39 ARG NH1 HH11 sing N N 40 ARG NH1 HH12 sing N N 41 ARG NH2 HH21 sing N N 42 ARG NH2 HH22 sing N N 43 ARG OXT HXT sing N N 44 ASN N CA sing N N 45 ASN N H sing N N 46 ASN N H2 sing N N 47 ASN CA C sing N N 48 ASN CA CB sing N N 49 ASN CA HA sing N N 50 ASN C O doub N N 51 ASN C OXT sing N N 52 ASN CB CG sing N N 53 ASN CB HB2 sing N N 54 ASN CB HB3 sing N N 55 ASN CG OD1 doub N N 56 ASN CG ND2 sing N N 57 ASN ND2 HD21 sing N N 58 ASN ND2 HD22 sing N N 59 ASN OXT HXT sing N N 60 ASP N CA sing N N 61 ASP N H sing N N 62 ASP N H2 sing N N 63 ASP CA C sing N N 64 ASP CA CB sing N N 65 ASP CA HA sing N N 66 ASP C O doub N N 67 ASP C OXT sing N N 68 ASP CB CG sing N N 69 ASP CB HB2 sing N N 70 ASP CB HB3 sing N N 71 ASP CG OD1 doub N N 72 ASP CG OD2 sing N N 73 ASP OD2 HD2 sing N N 74 ASP OXT HXT sing N N 75 CYS N CA sing N N 76 CYS N H sing N N 77 CYS N H2 sing N N 78 CYS CA C sing N N 79 CYS CA CB sing N N 80 CYS CA HA sing N N 81 CYS C O doub N N 82 CYS C OXT sing N N 83 CYS CB SG sing N N 84 CYS CB HB2 sing N N 85 CYS CB HB3 sing N N 86 CYS SG HG sing N N 87 CYS OXT HXT sing N N 88 GLN N CA sing N N 89 GLN N H sing N N 90 GLN N H2 sing N N 91 GLN CA C sing N N 92 GLN CA CB sing N N 93 GLN CA HA sing N N 94 GLN C O doub N N 95 GLN C OXT sing N N 96 GLN CB CG sing N N 97 GLN CB HB2 sing N N 98 GLN CB HB3 sing N N 99 GLN CG CD sing N N 100 GLN CG HG2 sing N N 101 GLN CG HG3 sing N N 102 GLN CD OE1 doub N N 103 GLN CD NE2 sing N N 104 GLN NE2 HE21 sing N N 105 GLN NE2 HE22 sing N N 106 GLN OXT HXT sing N N 107 GLU N CA sing N N 108 GLU N H sing N N 109 GLU N H2 sing N N 110 GLU CA C sing N N 111 GLU CA CB sing N N 112 GLU CA HA sing N N 113 GLU C O doub N N 114 GLU C OXT sing N N 115 GLU CB CG sing N N 116 GLU CB HB2 sing N N 117 GLU CB HB3 sing N N 118 GLU CG CD sing N N 119 GLU CG HG2 sing N N 120 GLU CG HG3 sing N N 121 GLU CD OE1 doub N N 122 GLU CD OE2 sing N N 123 GLU OE2 HE2 sing N N 124 GLU OXT HXT sing N N 125 GLY N CA sing N N 126 GLY N H sing N N 127 GLY N H2 sing N N 128 GLY CA C sing N N 129 GLY CA HA2 sing N N 130 GLY CA HA3 sing N N 131 GLY C O doub N N 132 GLY C OXT sing N N 133 GLY OXT HXT sing N N 134 HIS N CA sing N N 135 HIS N H sing N N 136 HIS N H2 sing N N 137 HIS CA C sing N N 138 HIS CA CB sing N N 139 HIS CA HA sing N N 140 HIS C O doub N N 141 HIS C OXT sing N N 142 HIS CB CG sing N N 143 HIS CB HB2 sing N N 144 HIS CB HB3 sing N N 145 HIS CG ND1 sing Y N 146 HIS CG CD2 doub Y N 147 HIS ND1 CE1 doub Y N 148 HIS ND1 HD1 sing N N 149 HIS CD2 NE2 sing Y N 150 HIS CD2 HD2 sing N N 151 HIS CE1 NE2 sing Y N 152 HIS CE1 HE1 sing N N 153 HIS NE2 HE2 sing N N 154 HIS OXT HXT sing N N 155 HOH O H1 sing N N 156 HOH O H2 sing N N 157 ILE N CA sing N N 158 ILE N H sing N N 159 ILE N H2 sing N N 160 ILE CA C sing N N 161 ILE CA CB sing N N 162 ILE CA HA sing N N 163 ILE C O doub N N 164 ILE C OXT sing N N 165 ILE CB CG1 sing N N 166 ILE CB CG2 sing N N 167 ILE CB HB sing N N 168 ILE CG1 CD1 sing N N 169 ILE CG1 HG12 sing N N 170 ILE CG1 HG13 sing N N 171 ILE CG2 HG21 sing N N 172 ILE CG2 HG22 sing N N 173 ILE CG2 HG23 sing N N 174 ILE CD1 HD11 sing N N 175 ILE CD1 HD12 sing N N 176 ILE CD1 HD13 sing N N 177 ILE OXT HXT sing N N 178 LEU N CA sing N N 179 LEU N H sing N N 180 LEU N H2 sing N N 181 LEU CA C sing N N 182 LEU CA CB sing N N 183 LEU CA HA sing N N 184 LEU C O doub N N 185 LEU C OXT sing N N 186 LEU CB CG sing N N 187 LEU CB HB2 sing N N 188 LEU CB HB3 sing N N 189 LEU CG CD1 sing N N 190 LEU CG CD2 sing N N 191 LEU CG HG sing N N 192 LEU CD1 HD11 sing N N 193 LEU CD1 HD12 sing N N 194 LEU CD1 HD13 sing N N 195 LEU CD2 HD21 sing N N 196 LEU CD2 HD22 sing N N 197 LEU CD2 HD23 sing N N 198 LEU OXT HXT sing N N 199 LYS N CA sing N N 200 LYS N H sing N N 201 LYS N H2 sing N N 202 LYS CA C sing N N 203 LYS CA CB sing N N 204 LYS CA HA sing N N 205 LYS C O doub N N 206 LYS C OXT sing N N 207 LYS CB CG sing N N 208 LYS CB HB2 sing N N 209 LYS CB HB3 sing N N 210 LYS CG CD sing N N 211 LYS CG HG2 sing N N 212 LYS CG HG3 sing N N 213 LYS CD CE sing N N 214 LYS CD HD2 sing N N 215 LYS CD HD3 sing N N 216 LYS CE NZ sing N N 217 LYS CE HE2 sing N N 218 LYS CE HE3 sing N N 219 LYS NZ HZ1 sing N N 220 LYS NZ HZ2 sing N N 221 LYS NZ HZ3 sing N N 222 LYS OXT HXT sing N N 223 MET N CA sing N N 224 MET N H sing N N 225 MET N H2 sing N N 226 MET CA C sing N N 227 MET CA CB sing N N 228 MET CA HA sing N N 229 MET C O doub N N 230 MET C OXT sing N N 231 MET CB CG sing N N 232 MET CB HB2 sing N N 233 MET CB HB3 sing N N 234 MET CG SD sing N N 235 MET CG HG2 sing N N 236 MET CG HG3 sing N N 237 MET SD CE sing N N 238 MET CE HE1 sing N N 239 MET CE HE2 sing N N 240 MET CE HE3 sing N N 241 MET OXT HXT sing N N 242 PHE N CA sing N N 243 PHE N H sing N N 244 PHE N H2 sing N N 245 PHE CA C sing N N 246 PHE CA CB sing N N 247 PHE CA HA sing N N 248 PHE C O doub N N 249 PHE C OXT sing N N 250 PHE CB CG sing N N 251 PHE CB HB2 sing N N 252 PHE CB HB3 sing N N 253 PHE CG CD1 doub Y N 254 PHE CG CD2 sing Y N 255 PHE CD1 CE1 sing Y N 256 PHE CD1 HD1 sing N N 257 PHE CD2 CE2 doub Y N 258 PHE CD2 HD2 sing N N 259 PHE CE1 CZ doub Y N 260 PHE CE1 HE1 sing N N 261 PHE CE2 CZ sing Y N 262 PHE CE2 HE2 sing N N 263 PHE CZ HZ sing N N 264 PHE OXT HXT sing N N 265 PRO N CA sing N N 266 PRO N CD sing N N 267 PRO N H sing N N 268 PRO CA C sing N N 269 PRO CA CB sing N N 270 PRO CA HA sing N N 271 PRO C O doub N N 272 PRO C OXT sing N N 273 PRO CB CG sing N N 274 PRO CB HB2 sing N N 275 PRO CB HB3 sing N N 276 PRO CG CD sing N N 277 PRO CG HG2 sing N N 278 PRO CG HG3 sing N N 279 PRO CD HD2 sing N N 280 PRO CD HD3 sing N N 281 PRO OXT HXT sing N N 282 SER N CA sing N N 283 SER N H sing N N 284 SER N H2 sing N N 285 SER CA C sing N N 286 SER CA CB sing N N 287 SER CA HA sing N N 288 SER C O doub N N 289 SER C OXT sing N N 290 SER CB OG sing N N 291 SER CB HB2 sing N N 292 SER CB HB3 sing N N 293 SER OG HG sing N N 294 SER OXT HXT sing N N 295 THR N CA sing N N 296 THR N H sing N N 297 THR N H2 sing N N 298 THR CA C sing N N 299 THR CA CB sing N N 300 THR CA HA sing N N 301 THR C O doub N N 302 THR C OXT sing N N 303 THR CB OG1 sing N N 304 THR CB CG2 sing N N 305 THR CB HB sing N N 306 THR OG1 HG1 sing N N 307 THR CG2 HG21 sing N N 308 THR CG2 HG22 sing N N 309 THR CG2 HG23 sing N N 310 THR OXT HXT sing N N 311 TRP N CA sing N N 312 TRP N H sing N N 313 TRP N H2 sing N N 314 TRP CA C sing N N 315 TRP CA CB sing N N 316 TRP CA HA sing N N 317 TRP C O doub N N 318 TRP C OXT sing N N 319 TRP CB CG sing N N 320 TRP CB HB2 sing N N 321 TRP CB HB3 sing N N 322 TRP CG CD1 doub Y N 323 TRP CG CD2 sing Y N 324 TRP CD1 NE1 sing Y N 325 TRP CD1 HD1 sing N N 326 TRP CD2 CE2 doub Y N 327 TRP CD2 CE3 sing Y N 328 TRP NE1 CE2 sing Y N 329 TRP NE1 HE1 sing N N 330 TRP CE2 CZ2 sing Y N 331 TRP CE3 CZ3 doub Y N 332 TRP CE3 HE3 sing N N 333 TRP CZ2 CH2 doub Y N 334 TRP CZ2 HZ2 sing N N 335 TRP CZ3 CH2 sing Y N 336 TRP CZ3 HZ3 sing N N 337 TRP CH2 HH2 sing N N 338 TRP OXT HXT sing N N 339 TYR N CA sing N N 340 TYR N H sing N N 341 TYR N H2 sing N N 342 TYR CA C sing N N 343 TYR CA CB sing N N 344 TYR CA HA sing N N 345 TYR C O doub N N 346 TYR C OXT sing N N 347 TYR CB CG sing N N 348 TYR CB HB2 sing N N 349 TYR CB HB3 sing N N 350 TYR CG CD1 doub Y N 351 TYR CG CD2 sing Y N 352 TYR CD1 CE1 sing Y N 353 TYR CD1 HD1 sing N N 354 TYR CD2 CE2 doub Y N 355 TYR CD2 HD2 sing N N 356 TYR CE1 CZ doub Y N 357 TYR CE1 HE1 sing N N 358 TYR CE2 CZ sing Y N 359 TYR CE2 HE2 sing N N 360 TYR CZ OH sing N N 361 TYR OH HH sing N N 362 TYR OXT HXT sing N N 363 VAL N CA sing N N 364 VAL N H sing N N 365 VAL N H2 sing N N 366 VAL CA C sing N N 367 VAL CA CB sing N N 368 VAL CA HA sing N N 369 VAL C O doub N N 370 VAL C OXT sing N N 371 VAL CB CG1 sing N N 372 VAL CB CG2 sing N N 373 VAL CB HB sing N N 374 VAL CG1 HG11 sing N N 375 VAL CG1 HG12 sing N N 376 VAL CG1 HG13 sing N N 377 VAL CG2 HG21 sing N N 378 VAL CG2 HG22 sing N N 379 VAL CG2 HG23 sing N N 380 VAL OXT HXT sing N N 381 # _em_3d_crystal_entity.angle_alpha 87.73 _em_3d_crystal_entity.angle_beta 108.97 _em_3d_crystal_entity.angle_gamma 111.6 _em_3d_crystal_entity.image_processing_id 1 _em_3d_crystal_entity.id 1 _em_3d_crystal_entity.length_a 26.66 _em_3d_crystal_entity.length_b 31.15 _em_3d_crystal_entity.length_c 33.57 _em_3d_crystal_entity.space_group_name 'P 1' _em_3d_crystal_entity.space_group_num 1 # loop_ _em_buffer_component.buffer_id _em_buffer_component.concentration _em_buffer_component.concentration_units _em_buffer_component.formula _em_buffer_component.id _em_buffer_component.name 1 50 mM NaAc 1 'sodium acetate' 1 0.8 M NaNO3 2 'sodium nitrate' # _em_ctf_correction.details ? _em_ctf_correction.em_image_processing_id 1 _em_ctf_correction.id 1 _em_ctf_correction.type NONE # loop_ _em_diffraction_shell.em_diffraction_stats_id _em_diffraction_shell.fourier_space_coverage _em_diffraction_shell.high_resolution _em_diffraction_shell.id _em_diffraction_shell.low_resolution _em_diffraction_shell.multiplicity _em_diffraction_shell.num_structure_factors _em_diffraction_shell.phase_residual 1 100 2 1 11.73 55.99 8729 16.36 1 85.4 0.83 2 0.85 55.99 7667 58.04 # _em_diffraction_stats.details ? _em_diffraction_stats.fourier_space_coverage 99.9 _em_diffraction_stats.high_resolution 0.83 _em_diffraction_stats.id 1 _em_diffraction_stats.image_processing_id 1 _em_diffraction_stats.num_intensities_measured 5003763 _em_diffraction_stats.num_structure_factors 89374 _em_diffraction_stats.overall_phase_error ? _em_diffraction_stats.overall_phase_residual ? _em_diffraction_stats.phase_error_rejection_criteria 0 _em_diffraction_stats.r_merge 0.109 _em_diffraction_stats.r_sym ? # _em_entity_assembly_molwt.entity_assembly_id 1 _em_entity_assembly_molwt.experimental_flag NO _em_entity_assembly_molwt.id 1 _em_entity_assembly_molwt.units MEGADALTONS _em_entity_assembly_molwt.value 0.0162 # _em_entity_assembly_naturalsource.cell ? _em_entity_assembly_naturalsource.cellular_location ? _em_entity_assembly_naturalsource.entity_assembly_id 1 _em_entity_assembly_naturalsource.id 2 _em_entity_assembly_naturalsource.ncbi_tax_id 9031 _em_entity_assembly_naturalsource.organism 'Gallus gallus' _em_entity_assembly_naturalsource.organelle ? _em_entity_assembly_naturalsource.organ ? _em_entity_assembly_naturalsource.strain ? _em_entity_assembly_naturalsource.tissue ? _em_entity_assembly_naturalsource.details ? # _em_image_processing.details ? _em_image_processing.id 1 _em_image_processing.image_recording_id 1 # _em_image_recording.average_exposure_time ? _em_image_recording.avg_electron_dose_per_subtomogram ? _em_image_recording.avg_electron_dose_per_image 1.52 _em_image_recording.details 'FEI Ceta-D CMOS detector' _em_image_recording.detector_mode ? _em_image_recording.film_or_detector_model 'FEI CETA (4k x 4k)' _em_image_recording.id 1 _em_image_recording.imaging_id 1 _em_image_recording.num_diffraction_images ? _em_image_recording.num_grids_imaged ? _em_image_recording.num_real_images ? # loop_ _em_software.category _em_software.details _em_software.id _em_software.image_processing_id _em_software.fitting_id _em_software.imaging_id _em_software.name _em_software.version _em_software.reference_DOI 'IMAGE ACQUISITION' ? 1 ? ? 1 ? ? ? MASKING ? 2 ? ? ? ? ? ? 'CTF CORRECTION' ? 3 1 ? ? ? ? ? 'LAYERLINE INDEXING' ? 4 ? ? ? ? ? ? 'DIFFRACTION INDEXING' ? 5 ? ? ? ? ? ? 'MODEL FITTING' ? 6 ? 1 ? ? ? ? OTHER ? 7 ? ? ? ? ? ? 'MOLECULAR REPLACEMENT' ? 8 1 ? ? ? ? ? 'LATTICE DISTORTION CORRECTION' ? 9 1 ? ? ? ? ? 'SYMMETRY DETERMINATION' ? 10 1 ? ? ? ? ? 'CRYSTALLOGRAPHY MERGING' ? 11 1 ? ? ? ? ? RECONSTRUCTION ? 12 1 ? ? PHENIX ? ? 'MODEL REFINEMENT' ? 13 ? 1 ? PHENIX ? ? # _em_specimen.concentration 40 _em_specimen.details 'Hen egg white lysozyme' _em_specimen.embedding_applied NO _em_specimen.experiment_id 1 _em_specimen.id 1 _em_specimen.shadowing_applied NO _em_specimen.staining_applied NO _em_specimen.vitrification_applied YES # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Knut and Alice Wallenberg Foundation' Sweden ? 1 'Swedish Research Council' Sweden ? 2 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 7SKW # _pdbx_related_exp_data_set.ordinal 1 _pdbx_related_exp_data_set.data_reference 10.15785/SBGRID/1150 _pdbx_related_exp_data_set.metadata_reference ? _pdbx_related_exp_data_set.data_set_type 'diffraction image data' _pdbx_related_exp_data_set.details ? # _space_group.name_H-M_alt 'P 1' _space_group.name_Hall 'P 1' _space_group.IT_number 1 _space_group.crystal_system triclinic _space_group.id 1 # _atom_sites.entry_id 9QUM _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.037509 _atom_sites.fract_transf_matrix[1][2] 0.014851 _atom_sites.fract_transf_matrix[1][3] 0.014305 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.034527 _atom_sites.fract_transf_matrix[2][3] 0.003157 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.031631 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.pdbx_scat_Cromer_Mann_a5 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.pdbx_scat_Cromer_Mann_b5 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 0.08930 0.25630 0.75700 1.04870 0.35750 0.24650 1.71000 6.40940 18.61130 50.25230 0.0 ;5-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? CL ? ? 0.24430 0.53970 1.39190 2.01970 0.66210 0.24680 1.52420 6.15370 16.66870 42.30860 0.0 ;5-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? 0.03490 0.12010 0.19700 0.05730 0.11950 0.53470 3.58670 12.34710 18.95250 38.62690 0.0 ;5-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 0.10220 0.32190 0.79820 0.81970 0.17150 0.24510 1.74810 6.19250 17.38940 48.14310 0.0 ;5-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 0.09740 0.29210 0.69100 0.69900 0.20390 0.20670 1.38150 4.69430 12.71050 32.47260 0.0 ;5-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 0.24970 0.56280 1.38990 2.18650 0.77150 0.26810 1.67110 7.02670 19.53770 50.38880 0.0 ;5-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ # loop_ #