data_9QWL # _entry.id 9QWL # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.413 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9QWL pdb_00009qwl 10.2210/pdb9qwl/pdb WWPDB D_1292147130 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-04-29 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9QWL _pdbx_database_status.recvd_initial_deposition_date 2025-04-14 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.content_type unspecified _pdbx_database_related.db_id 9QWL _pdbx_database_related.db_name PDB _pdbx_database_related.details . # _pdbx_contact_author.id 2 _pdbx_contact_author.email uwe.sauer@umu.se _pdbx_contact_author.name_first Uwe _pdbx_contact_author.name_last Sauer _pdbx_contact_author.name_mi H. _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-3420-439X # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Sauer, U.H.' 1 0000-0002-3420-439X 'Cisneros, D.A.' 2 0000-0001-9919-0075 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'BACTEROIDALES T6SS MINOR HCP SUBUNITS FORM HETEROMERES CARRYING EFFECTORS' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'San-Miguel, S.G.' 1 ? primary 'Al-Ammari, M.K.S.' 2 ? primary 'Johansson, E.' 3 ? primary 'Kowalska, A.' 4 ? primary 'Sauer, U.H.' 5 0000-0002-3420-439X primary 'Batista, P.R.' 6 ? primary 'Sandblad, L.' 7 0000-0003-3492-3287 primary 'Uhlin, B.E.' 8 0000-0002-2991-8072 primary 'Cisneros, D.A.' 9 0000-0001-9919-0075 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Bacterodales T6SS protein TssD (Hcp)' 15851.054 1 ? ? ? 'linker and 6His-tag added after K129 at the C-terminus: ASGGGHHHHHH' 2 non-polymer syn 'DI(HYDROXYETHYL)ETHER' 106.120 2 ? ? ? ? 3 water nat water 18.015 5 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Type VI secretion system needle protein Hcp,Type VI secretion system tube protein TssD' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)AFRATLSFAGKEFDVLDCTYSLKRDVDSKGRPSSNIYGGQIRLHVESTDDTSILEN(MSE)TNQFKPHSGSIVFK KGDEEAK(MSE)KELTWENGYITEFTENIDIVGSQP(MSE)TITFVVSAQVIKIGGAQFEQNWPKASGGGHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MAFRATLSFAGKEFDVLDCTYSLKRDVDSKGRPSSNIYGGQIRLHVESTDDTSILENMTNQFKPHSGSIVFKKGDEEAKM KELTWENGYITEFTENIDIVGSQPMTITFVVSAQVIKIGGAQFEQNWPKASGGGHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'DI(HYDROXYETHYL)ETHER' PEG 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 ALA n 1 3 PHE n 1 4 ARG n 1 5 ALA n 1 6 THR n 1 7 LEU n 1 8 SER n 1 9 PHE n 1 10 ALA n 1 11 GLY n 1 12 LYS n 1 13 GLU n 1 14 PHE n 1 15 ASP n 1 16 VAL n 1 17 LEU n 1 18 ASP n 1 19 CYS n 1 20 THR n 1 21 TYR n 1 22 SER n 1 23 LEU n 1 24 LYS n 1 25 ARG n 1 26 ASP n 1 27 VAL n 1 28 ASP n 1 29 SER n 1 30 LYS n 1 31 GLY n 1 32 ARG n 1 33 PRO n 1 34 SER n 1 35 SER n 1 36 ASN n 1 37 ILE n 1 38 TYR n 1 39 GLY n 1 40 GLY n 1 41 GLN n 1 42 ILE n 1 43 ARG n 1 44 LEU n 1 45 HIS n 1 46 VAL n 1 47 GLU n 1 48 SER n 1 49 THR n 1 50 ASP n 1 51 ASP n 1 52 THR n 1 53 SER n 1 54 ILE n 1 55 LEU n 1 56 GLU n 1 57 ASN n 1 58 MSE n 1 59 THR n 1 60 ASN n 1 61 GLN n 1 62 PHE n 1 63 LYS n 1 64 PRO n 1 65 HIS n 1 66 SER n 1 67 GLY n 1 68 SER n 1 69 ILE n 1 70 VAL n 1 71 PHE n 1 72 LYS n 1 73 LYS n 1 74 GLY n 1 75 ASP n 1 76 GLU n 1 77 GLU n 1 78 ALA n 1 79 LYS n 1 80 MSE n 1 81 LYS n 1 82 GLU n 1 83 LEU n 1 84 THR n 1 85 TRP n 1 86 GLU n 1 87 ASN n 1 88 GLY n 1 89 TYR n 1 90 ILE n 1 91 THR n 1 92 GLU n 1 93 PHE n 1 94 THR n 1 95 GLU n 1 96 ASN n 1 97 ILE n 1 98 ASP n 1 99 ILE n 1 100 VAL n 1 101 GLY n 1 102 SER n 1 103 GLN n 1 104 PRO n 1 105 MSE n 1 106 THR n 1 107 ILE n 1 108 THR n 1 109 PHE n 1 110 VAL n 1 111 VAL n 1 112 SER n 1 113 ALA n 1 114 GLN n 1 115 VAL n 1 116 ILE n 1 117 LYS n 1 118 ILE n 1 119 GLY n 1 120 GLY n 1 121 ALA n 1 122 GLN n 1 123 PHE n 1 124 GLU n 1 125 GLN n 1 126 ASN n 1 127 TRP n 1 128 PRO n 1 129 LYS n 1 130 ALA n 1 131 SER n 1 132 GLY n 1 133 GLY n 1 134 GLY n 1 135 HIS n 1 136 HIS n 1 137 HIS n 1 138 HIS n 1 139 HIS n 1 140 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 140 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ;BF9343_1943, CQW34_01545, DW228_07065, DWW08_15770, F2Z25_09975, F2Z89_01225, FSA03_13490, HMPREF1018_02079, HMPREF2533_02193, NXX45_14030, O1420_02540, O1433_05645 ; _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain NCTC9343 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bacteroides fragilis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 817 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'DE(3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PEG non-polymer . 'DI(HYDROXYETHYL)ETHER' ? 'C4 H10 O3' 106.120 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 ? ? ? A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 PHE 3 3 3 PHE PHE A . n A 1 4 ARG 4 4 4 ARG ARG A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 PHE 9 9 9 PHE PHE A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 PHE 14 14 14 PHE PHE A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 CYS 19 19 19 CYS CYS A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 TYR 21 21 21 TYR TYR A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 ARG 32 32 32 ARG ARG A . n A 1 33 PRO 33 33 33 PRO PRO A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 ASN 36 36 36 ASN ASN A . n A 1 37 ILE 37 37 37 ILE ILE A . n A 1 38 TYR 38 38 38 TYR TYR A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 GLN 41 41 41 GLN GLN A . n A 1 42 ILE 42 42 42 ILE ILE A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 HIS 45 45 45 HIS HIS A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 SER 48 48 48 SER SER A . n A 1 49 THR 49 49 49 THR THR A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 ASP 51 51 51 ASP ASP A . n A 1 52 THR 52 52 52 THR THR A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 ILE 54 54 54 ILE ILE A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 ASN 57 57 57 ASN ASN A . n A 1 58 MSE 58 58 58 MSE MSE A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 ASN 60 60 60 ASN ASN A . n A 1 61 GLN 61 61 61 GLN GLN A . n A 1 62 PHE 62 62 62 PHE PHE A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 PRO 64 64 64 PRO PRO A . n A 1 65 HIS 65 65 65 HIS HIS A . n A 1 66 SER 66 66 66 SER SER A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 SER 68 68 68 SER SER A . n A 1 69 ILE 69 69 69 ILE ILE A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 PHE 71 71 71 PHE PHE A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 ASP 75 75 75 ASP ASP A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 MSE 80 80 80 MSE MSE A . n A 1 81 LYS 81 81 81 LYS LYS A . n A 1 82 GLU 82 82 82 GLU GLU A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 THR 84 84 84 THR THR A . n A 1 85 TRP 85 85 85 TRP TRP A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 ASN 87 87 87 ASN ASN A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 TYR 89 89 89 TYR TYR A . n A 1 90 ILE 90 90 90 ILE ILE A . n A 1 91 THR 91 91 91 THR THR A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 PHE 93 93 93 PHE PHE A . n A 1 94 THR 94 94 94 THR THR A . n A 1 95 GLU 95 95 95 GLU GLU A . n A 1 96 ASN 96 96 96 ASN ASN A . n A 1 97 ILE 97 97 97 ILE ILE A . n A 1 98 ASP 98 98 98 ASP ASP A . n A 1 99 ILE 99 99 99 ILE ILE A . n A 1 100 VAL 100 100 100 VAL VAL A . n A 1 101 GLY 101 101 101 GLY GLY A . n A 1 102 SER 102 102 102 SER SER A . n A 1 103 GLN 103 103 103 GLN GLN A . n A 1 104 PRO 104 104 104 PRO PRO A . n A 1 105 MSE 105 105 105 MSE MSE A . n A 1 106 THR 106 106 106 THR THR A . n A 1 107 ILE 107 107 107 ILE ILE A . n A 1 108 THR 108 108 108 THR THR A . n A 1 109 PHE 109 109 109 PHE PHE A . n A 1 110 VAL 110 110 110 VAL VAL A . n A 1 111 VAL 111 111 111 VAL VAL A . n A 1 112 SER 112 112 112 SER SER A . n A 1 113 ALA 113 113 113 ALA ALA A . n A 1 114 GLN 114 114 114 GLN GLN A . n A 1 115 VAL 115 115 115 VAL VAL A . n A 1 116 ILE 116 116 116 ILE ILE A . n A 1 117 LYS 117 117 117 LYS LYS A . n A 1 118 ILE 118 118 118 ILE ILE A . n A 1 119 GLY 119 119 119 GLY GLY A . n A 1 120 GLY 120 120 120 GLY GLY A . n A 1 121 ALA 121 121 121 ALA ALA A . n A 1 122 GLN 122 122 122 GLN GLN A . n A 1 123 PHE 123 123 123 PHE PHE A . n A 1 124 GLU 124 124 124 GLU GLU A . n A 1 125 GLN 125 125 125 GLN GLN A . n A 1 126 ASN 126 126 126 ASN ASN A . n A 1 127 TRP 127 127 127 TRP TRP A . n A 1 128 PRO 128 128 128 PRO PRO A . n A 1 129 LYS 129 129 129 LYS LYS A . n A 1 130 ALA 130 130 130 ALA ALA A . n A 1 131 SER 131 131 ? ? ? A . n A 1 132 GLY 132 132 ? ? ? A . n A 1 133 GLY 133 133 ? ? ? A . n A 1 134 GLY 134 134 ? ? ? A . n A 1 135 HIS 135 135 ? ? ? A . n A 1 136 HIS 136 136 ? ? ? A . n A 1 137 HIS 137 137 ? ? ? A . n A 1 138 HIS 138 138 ? ? ? A . n A 1 139 HIS 139 139 ? ? ? A . n A 1 140 HIS 140 140 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 PEG 1 201 2 PEG PEG A . C 2 PEG 1 202 3 PEG PEG A . D 3 HOH 1 301 7 HOH HOH A . D 3 HOH 2 302 1 HOH HOH A . D 3 HOH 3 303 3 HOH HOH A . D 3 HOH 4 304 5 HOH HOH A . D 3 HOH 5 305 4 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.19.2_4158)' ? 1 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? V4.3 ? 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? v20161205 ? 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? v0.7.1 ? 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.19.2_4158)' ? 5 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 9QWL _cell.details ? _cell.formula_units_Z ? _cell.length_a 77.366 _cell.length_a_esd ? _cell.length_b 77.366 _cell.length_b_esd ? _cell.length_c 47.635 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9QWL _symmetry.cell_setting ? _symmetry.Int_Tables_number 168 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 6' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9QWL _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.60 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 52.62 _exptl_crystal.description 'hexagonal plates' _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'Hcp1 at 14 mg/ml, 30% w/v PEG 400, 200 mM trisodium citrate (Na3C6H5O7) and 100 mM Tris pH 8.5,' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 291 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 4M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-06-25 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9677 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE ID30B' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9677 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ID30B _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate 47.14 _reflns.entry_id 9QWL _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.95 _reflns.d_resolution_low 22.44 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 248578 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.64 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 20 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 35.10 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.0566 _reflns.pdbx_Rpim_I_all 0.0125 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1 _reflns.pdbx_CC_star 1 _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.055 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.95 _reflns_shell.d_res_low 2.02 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 3.28 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 26002 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 15 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 1.0 _reflns_shell.pdbx_Rpim_I_all 0.246 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.943 _reflns_shell.pdbx_CC_star 0.985 _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 99.58 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.127 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9QWL _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.95 _refine.ls_d_res_low 22.44 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 23222 _refine.ls_number_reflns_R_free 2334 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.73 _refine.ls_percent_reflns_R_free 10.05 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1953 _refine.ls_R_factor_R_free 0.2343 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1910 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol 51.8 _refine.solvent_model_param_ksol 0.41 _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.40 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details 'random selection' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 33.78 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.22 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1015 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 14 _refine_hist.number_atoms_solvent 5 _refine_hist.number_atoms_total 1034 _refine_hist.d_res_high 1.95 _refine_hist.d_res_low 22.44 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.018 ? 1047 ? f_bond_d ? ? ? 'X-RAY DIFFRACTION' ? 1.873 ? 1406 ? f_angle_d ? ? ? 'X-RAY DIFFRACTION' ? 12.355 ? 141 ? f_dihedral_angle_d ? ? ? 'X-RAY DIFFRACTION' ? 0.087 ? 153 ? f_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.024 ? 181 ? f_plane_restr ? ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.95 1.99 . . 140 1226 100.00 6.6 . . . 0.3490 . . . . . . . . . . . . . . . 0.3521 'X-RAY DIFFRACTION' 1.99 2.03 . . 144 1222 99.00 6.6 . . . 0.2983 . . . . . . . . . . . . . . . 0.3345 'X-RAY DIFFRACTION' 2.03 2.08 . . 136 1249 100.00 . . . . 0.2778 . . . . . . . . . . . . . . . 0.3112 'X-RAY DIFFRACTION' 2.08 2.13 . . 140 1203 100.00 6.6 . . . 0.2633 . . . . . . . . . . . . . . . 0.3233 'X-RAY DIFFRACTION' 2.13 2.19 . . 131 1240 100.00 6.6 . . . 0.2369 . . . . . . . . . . . . . . . 0.2395 'X-RAY DIFFRACTION' 2.19 2.25 . . 130 1242 100.00 6.6 . . . 0.2030 . . . . . . . . . . . . . . . 0.2516 'X-RAY DIFFRACTION' 2.25 2.33 . . 138 1218 100.00 6.6 . . . 0.2103 . . . . . . . . . . . . . . . 0.2505 'X-RAY DIFFRACTION' 2.33 2.41 . . 140 1237 100.00 6.6 . . . 0.2404 . . . . . . . . . . . . . . . 0.2428 'X-RAY DIFFRACTION' 2.41 2.51 . . 136 1235 100.00 6.6 . . . 0.2239 . . . . . . . . . . . . . . . 0.2394 'X-RAY DIFFRACTION' 2.51 2.62 . . 123 1222 100.00 6.6 . . . 0.2148 . . . . . . . . . . . . . . . 0.2776 'X-RAY DIFFRACTION' 2.62 2.76 . . 144 1235 100.00 6.6 . . . 0.2129 . . . . . . . . . . . . . . . 0.2539 'X-RAY DIFFRACTION' 2.76 2.93 . . 138 1227 100.00 6.6 . . . 0.2461 . . . . . . . . . . . . . . . 0.2795 'X-RAY DIFFRACTION' 2.93 3.16 . . 138 1222 100.00 6.6 . . . 0.2091 . . . . . . . . . . . . . . . 0.2982 'X-RAY DIFFRACTION' 3.16 3.47 . . 134 1229 100.00 6.6 . . . 0.2037 . . . . . . . . . . . . . . . 0.2821 'X-RAY DIFFRACTION' 3.47 3.97 . . 136 1236 100.00 6.6 . . . 0.1869 . . . . . . . . . . . . . . . 0.2428 'X-RAY DIFFRACTION' 3.98 5.00 . . 152 1207 100.00 6.6 . . . 0.1439 . . . . . . . . . . . . . . . 0.1601 'X-RAY DIFFRACTION' 5.00 22.44 . . 134 1238 99.00 6.6 . . . 0.1612 . . . . . . . . . . . . . . . 0.2065 # _struct.entry_id 9QWL _struct.title 'Hemolysin-coregulated-protein-1 (Hcp1) from Bacteroides fragilis strain NCTC9343' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9QWL _struct_keywords.text 'Type VI Secretion System (T6SS), STRUCTURAL HEMOLYSIN-COREGULATED-PROTEIN, Hcp hetero-hexamers, human gut microbiome, CELL INVASION' _struct_keywords.pdbx_keywords 'CELL INVASION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A081TQ32_BACFG _struct_ref.pdbx_db_accession A0A081TQ32 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MAFRATLSFAGKEFDVLDCTYSLKRDVDSKGRPSSNIYGGQIRLHVESTDDTSILENMTNQFKPHSGSIVFKKGDEEAKM KELTWENGYITEFTENIDIVGSQPMTITFVVSAQVIKIGGAQFEQNWPK ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9QWL _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 129 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A081TQ32 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 129 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 129 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9QWL ALA A 130 ? UNP A0A081TQ32 ? ? 'expression tag' 130 1 1 9QWL SER A 131 ? UNP A0A081TQ32 ? ? 'expression tag' 131 2 1 9QWL GLY A 132 ? UNP A0A081TQ32 ? ? 'expression tag' 132 3 1 9QWL GLY A 133 ? UNP A0A081TQ32 ? ? 'expression tag' 133 4 1 9QWL GLY A 134 ? UNP A0A081TQ32 ? ? 'expression tag' 134 5 1 9QWL HIS A 135 ? UNP A0A081TQ32 ? ? 'expression tag' 135 6 1 9QWL HIS A 136 ? UNP A0A081TQ32 ? ? 'expression tag' 136 7 1 9QWL HIS A 137 ? UNP A0A081TQ32 ? ? 'expression tag' 137 8 1 9QWL HIS A 138 ? UNP A0A081TQ32 ? ? 'expression tag' 138 9 1 9QWL HIS A 139 ? UNP A0A081TQ32 ? ? 'expression tag' 139 10 1 9QWL HIS A 140 ? UNP A0A081TQ32 ? ? 'expression tag' 140 11 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details hexameric _pdbx_struct_assembly.oligomeric_count 6 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 19920 ? 1 MORE -44 ? 1 'SSA (A^2)' 33530 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4,5,6 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details mass-photometer # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_555 -y,x-y,z -0.5000000000 -0.8660254038 0.0000000000 0.0000000000 0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_555 -x+y,-x,z -0.5000000000 0.8660254038 0.0000000000 0.0000000000 -0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 4 'crystal symmetry operation' 4_555 -x,-y,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 5 'crystal symmetry operation' 5_555 y,-x+y,z 0.5000000000 0.8660254038 0.0000000000 0.0000000000 -0.8660254038 0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 6 'crystal symmetry operation' 6_555 x-y,x,z 0.5000000000 -0.8660254038 0.0000000000 0.0000000000 0.8660254038 0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id THR _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 52 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ASN _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 60 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id THR _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 52 _struct_conf.end_auth_comp_id ASN _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 60 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A ASN 57 C ? ? ? 1_555 A MSE 58 N ? ? A ASN 57 A MSE 58 1_555 ? ? ? ? ? ? ? 1.344 ? ? covale2 covale both ? A MSE 58 C ? ? ? 1_555 A THR 59 N ? ? A MSE 58 A THR 59 1_555 ? ? ? ? ? ? ? 1.338 ? ? covale3 covale both ? A LYS 79 C ? ? ? 1_555 A MSE 80 N ? ? A LYS 79 A MSE 80 1_555 ? ? ? ? ? ? ? 1.326 ? ? covale4 covale both ? A MSE 80 C ? ? ? 1_555 A LYS 81 N ? ? A MSE 80 A LYS 81 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale5 covale both ? A PRO 104 C ? ? ? 1_555 A MSE 105 N ? ? A PRO 104 A MSE 105 1_555 ? ? ? ? ? ? ? 1.326 ? ? covale6 covale both ? A MSE 105 C ? ? ? 1_555 A THR 106 N ? ? A MSE 105 A THR 106 1_555 ? ? ? ? ? ? ? 1.326 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 MSE A 58 ? . . . . MSE A 58 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 2 MSE A 80 ? . . . . MSE A 80 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 3 MSE A 105 ? . . . . MSE A 105 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 8 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA1 7 8 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ALA A 121 ? GLU A 124 ? ALA A 121 GLU A 124 AA1 2 MSE A 105 ? ILE A 118 ? MSE A 105 ILE A 118 AA1 3 LYS A 79 ? ILE A 97 ? LYS A 79 ILE A 97 AA1 4 HIS A 65 ? LYS A 73 ? HIS A 65 LYS A 73 AA1 5 PHE A 3 ? PHE A 9 ? PHE A 3 PHE A 9 AA1 6 LYS A 12 ? LYS A 24 ? LYS A 12 LYS A 24 AA1 7 TYR A 38 ? GLU A 47 ? TYR A 38 GLU A 47 AA1 8 MSE A 105 ? ILE A 118 ? MSE A 105 ILE A 118 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O PHE A 123 ? O PHE A 123 N ILE A 116 ? N ILE A 116 AA1 2 3 O LYS A 117 ? O LYS A 117 N THR A 84 ? N THR A 84 AA1 3 4 O LEU A 83 ? O LEU A 83 N ILE A 69 ? N ILE A 69 AA1 4 5 O SER A 68 ? O SER A 68 N SER A 8 ? N SER A 8 AA1 5 6 N PHE A 9 ? N PHE A 9 O LYS A 12 ? O LYS A 12 AA1 6 7 N LEU A 17 ? N LEU A 17 O HIS A 45 ? O HIS A 45 AA1 7 8 N LEU A 44 ? N LEU A 44 O PHE A 109 ? O PHE A 109 # _pdbx_entry_details.entry_id 9QWL _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 HG1 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 THR _pdbx_validate_close_contact.auth_seq_id_1 49 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 301 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.54 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 62 ? ? -141.58 44.95 2 1 ASP A 75 ? ? 118.97 73.78 3 1 GLU A 77 ? ? 60.29 -81.98 4 1 ALA A 78 ? ? 69.14 111.58 5 1 VAL A 100 ? ? -86.49 -76.18 6 1 GLN A 103 ? ? -48.09 103.27 7 1 PRO A 104 ? ? -68.15 -79.76 8 1 ASN A 126 ? ? -65.00 -75.89 9 1 TRP A 127 ? ? 57.23 83.63 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 4 ? ? 0.089 'SIDE CHAIN' 2 1 ARG A 32 ? ? 0.237 'SIDE CHAIN' # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 58 A MSE 58 ? MET 'modified residue' 2 A MSE 80 A MSE 80 ? MET 'modified residue' 3 A MSE 105 A MSE 105 ? MET 'modified residue' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MSE 1 ? A MSE 1 2 1 Y 1 A SER 131 ? A SER 131 3 1 Y 1 A GLY 132 ? A GLY 132 4 1 Y 1 A GLY 133 ? A GLY 133 5 1 Y 1 A GLY 134 ? A GLY 134 6 1 Y 1 A HIS 135 ? A HIS 135 7 1 Y 1 A HIS 136 ? A HIS 136 8 1 Y 1 A HIS 137 ? A HIS 137 9 1 Y 1 A HIS 138 ? A HIS 138 10 1 Y 1 A HIS 139 ? A HIS 139 11 1 Y 1 A HIS 140 ? A HIS 140 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MSE N N N N 230 MSE CA C N S 231 MSE C C N N 232 MSE O O N N 233 MSE OXT O N N 234 MSE CB C N N 235 MSE CG C N N 236 MSE SE SE N N 237 MSE CE C N N 238 MSE H H N N 239 MSE H2 H N N 240 MSE HA H N N 241 MSE HXT H N N 242 MSE HB2 H N N 243 MSE HB3 H N N 244 MSE HG2 H N N 245 MSE HG3 H N N 246 MSE HE1 H N N 247 MSE HE2 H N N 248 MSE HE3 H N N 249 PEG C1 C N N 250 PEG O1 O N N 251 PEG C2 C N N 252 PEG O2 O N N 253 PEG C3 C N N 254 PEG C4 C N N 255 PEG O4 O N N 256 PEG H11 H N N 257 PEG H12 H N N 258 PEG HO1 H N N 259 PEG H21 H N N 260 PEG H22 H N N 261 PEG H31 H N N 262 PEG H32 H N N 263 PEG H41 H N N 264 PEG H42 H N N 265 PEG HO4 H N N 266 PHE N N N N 267 PHE CA C N S 268 PHE C C N N 269 PHE O O N N 270 PHE CB C N N 271 PHE CG C Y N 272 PHE CD1 C Y N 273 PHE CD2 C Y N 274 PHE CE1 C Y N 275 PHE CE2 C Y N 276 PHE CZ C Y N 277 PHE OXT O N N 278 PHE H H N N 279 PHE H2 H N N 280 PHE HA H N N 281 PHE HB2 H N N 282 PHE HB3 H N N 283 PHE HD1 H N N 284 PHE HD2 H N N 285 PHE HE1 H N N 286 PHE HE2 H N N 287 PHE HZ H N N 288 PHE HXT H N N 289 PRO N N N N 290 PRO CA C N S 291 PRO C C N N 292 PRO O O N N 293 PRO CB C N N 294 PRO CG C N N 295 PRO CD C N N 296 PRO OXT O N N 297 PRO H H N N 298 PRO HA H N N 299 PRO HB2 H N N 300 PRO HB3 H N N 301 PRO HG2 H N N 302 PRO HG3 H N N 303 PRO HD2 H N N 304 PRO HD3 H N N 305 PRO HXT H N N 306 SER N N N N 307 SER CA C N S 308 SER C C N N 309 SER O O N N 310 SER CB C N N 311 SER OG O N N 312 SER OXT O N N 313 SER H H N N 314 SER H2 H N N 315 SER HA H N N 316 SER HB2 H N N 317 SER HB3 H N N 318 SER HG H N N 319 SER HXT H N N 320 THR N N N N 321 THR CA C N S 322 THR C C N N 323 THR O O N N 324 THR CB C N R 325 THR OG1 O N N 326 THR CG2 C N N 327 THR OXT O N N 328 THR H H N N 329 THR H2 H N N 330 THR HA H N N 331 THR HB H N N 332 THR HG1 H N N 333 THR HG21 H N N 334 THR HG22 H N N 335 THR HG23 H N N 336 THR HXT H N N 337 TRP N N N N 338 TRP CA C N S 339 TRP C C N N 340 TRP O O N N 341 TRP CB C N N 342 TRP CG C Y N 343 TRP CD1 C Y N 344 TRP CD2 C Y N 345 TRP NE1 N Y N 346 TRP CE2 C Y N 347 TRP CE3 C Y N 348 TRP CZ2 C Y N 349 TRP CZ3 C Y N 350 TRP CH2 C Y N 351 TRP OXT O N N 352 TRP H H N N 353 TRP H2 H N N 354 TRP HA H N N 355 TRP HB2 H N N 356 TRP HB3 H N N 357 TRP HD1 H N N 358 TRP HE1 H N N 359 TRP HE3 H N N 360 TRP HZ2 H N N 361 TRP HZ3 H N N 362 TRP HH2 H N N 363 TRP HXT H N N 364 TYR N N N N 365 TYR CA C N S 366 TYR C C N N 367 TYR O O N N 368 TYR CB C N N 369 TYR CG C Y N 370 TYR CD1 C Y N 371 TYR CD2 C Y N 372 TYR CE1 C Y N 373 TYR CE2 C Y N 374 TYR CZ C Y N 375 TYR OH O N N 376 TYR OXT O N N 377 TYR H H N N 378 TYR H2 H N N 379 TYR HA H N N 380 TYR HB2 H N N 381 TYR HB3 H N N 382 TYR HD1 H N N 383 TYR HD2 H N N 384 TYR HE1 H N N 385 TYR HE2 H N N 386 TYR HH H N N 387 TYR HXT H N N 388 VAL N N N N 389 VAL CA C N S 390 VAL C C N N 391 VAL O O N N 392 VAL CB C N N 393 VAL CG1 C N N 394 VAL CG2 C N N 395 VAL OXT O N N 396 VAL H H N N 397 VAL H2 H N N 398 VAL HA H N N 399 VAL HB H N N 400 VAL HG11 H N N 401 VAL HG12 H N N 402 VAL HG13 H N N 403 VAL HG21 H N N 404 VAL HG22 H N N 405 VAL HG23 H N N 406 VAL HXT H N N 407 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MSE N CA sing N N 218 MSE N H sing N N 219 MSE N H2 sing N N 220 MSE CA C sing N N 221 MSE CA CB sing N N 222 MSE CA HA sing N N 223 MSE C O doub N N 224 MSE C OXT sing N N 225 MSE OXT HXT sing N N 226 MSE CB CG sing N N 227 MSE CB HB2 sing N N 228 MSE CB HB3 sing N N 229 MSE CG SE sing N N 230 MSE CG HG2 sing N N 231 MSE CG HG3 sing N N 232 MSE SE CE sing N N 233 MSE CE HE1 sing N N 234 MSE CE HE2 sing N N 235 MSE CE HE3 sing N N 236 PEG C1 O1 sing N N 237 PEG C1 C2 sing N N 238 PEG C1 H11 sing N N 239 PEG C1 H12 sing N N 240 PEG O1 HO1 sing N N 241 PEG C2 O2 sing N N 242 PEG C2 H21 sing N N 243 PEG C2 H22 sing N N 244 PEG O2 C3 sing N N 245 PEG C3 C4 sing N N 246 PEG C3 H31 sing N N 247 PEG C3 H32 sing N N 248 PEG C4 O4 sing N N 249 PEG C4 H41 sing N N 250 PEG C4 H42 sing N N 251 PEG O4 HO4 sing N N 252 PHE N CA sing N N 253 PHE N H sing N N 254 PHE N H2 sing N N 255 PHE CA C sing N N 256 PHE CA CB sing N N 257 PHE CA HA sing N N 258 PHE C O doub N N 259 PHE C OXT sing N N 260 PHE CB CG sing N N 261 PHE CB HB2 sing N N 262 PHE CB HB3 sing N N 263 PHE CG CD1 doub Y N 264 PHE CG CD2 sing Y N 265 PHE CD1 CE1 sing Y N 266 PHE CD1 HD1 sing N N 267 PHE CD2 CE2 doub Y N 268 PHE CD2 HD2 sing N N 269 PHE CE1 CZ doub Y N 270 PHE CE1 HE1 sing N N 271 PHE CE2 CZ sing Y N 272 PHE CE2 HE2 sing N N 273 PHE CZ HZ sing N N 274 PHE OXT HXT sing N N 275 PRO N CA sing N N 276 PRO N CD sing N N 277 PRO N H sing N N 278 PRO CA C sing N N 279 PRO CA CB sing N N 280 PRO CA HA sing N N 281 PRO C O doub N N 282 PRO C OXT sing N N 283 PRO CB CG sing N N 284 PRO CB HB2 sing N N 285 PRO CB HB3 sing N N 286 PRO CG CD sing N N 287 PRO CG HG2 sing N N 288 PRO CG HG3 sing N N 289 PRO CD HD2 sing N N 290 PRO CD HD3 sing N N 291 PRO OXT HXT sing N N 292 SER N CA sing N N 293 SER N H sing N N 294 SER N H2 sing N N 295 SER CA C sing N N 296 SER CA CB sing N N 297 SER CA HA sing N N 298 SER C O doub N N 299 SER C OXT sing N N 300 SER CB OG sing N N 301 SER CB HB2 sing N N 302 SER CB HB3 sing N N 303 SER OG HG sing N N 304 SER OXT HXT sing N N 305 THR N CA sing N N 306 THR N H sing N N 307 THR N H2 sing N N 308 THR CA C sing N N 309 THR CA CB sing N N 310 THR CA HA sing N N 311 THR C O doub N N 312 THR C OXT sing N N 313 THR CB OG1 sing N N 314 THR CB CG2 sing N N 315 THR CB HB sing N N 316 THR OG1 HG1 sing N N 317 THR CG2 HG21 sing N N 318 THR CG2 HG22 sing N N 319 THR CG2 HG23 sing N N 320 THR OXT HXT sing N N 321 TRP N CA sing N N 322 TRP N H sing N N 323 TRP N H2 sing N N 324 TRP CA C sing N N 325 TRP CA CB sing N N 326 TRP CA HA sing N N 327 TRP C O doub N N 328 TRP C OXT sing N N 329 TRP CB CG sing N N 330 TRP CB HB2 sing N N 331 TRP CB HB3 sing N N 332 TRP CG CD1 doub Y N 333 TRP CG CD2 sing Y N 334 TRP CD1 NE1 sing Y N 335 TRP CD1 HD1 sing N N 336 TRP CD2 CE2 doub Y N 337 TRP CD2 CE3 sing Y N 338 TRP NE1 CE2 sing Y N 339 TRP NE1 HE1 sing N N 340 TRP CE2 CZ2 sing Y N 341 TRP CE3 CZ3 doub Y N 342 TRP CE3 HE3 sing N N 343 TRP CZ2 CH2 doub Y N 344 TRP CZ2 HZ2 sing N N 345 TRP CZ3 CH2 sing Y N 346 TRP CZ3 HZ3 sing N N 347 TRP CH2 HH2 sing N N 348 TRP OXT HXT sing N N 349 TYR N CA sing N N 350 TYR N H sing N N 351 TYR N H2 sing N N 352 TYR CA C sing N N 353 TYR CA CB sing N N 354 TYR CA HA sing N N 355 TYR C O doub N N 356 TYR C OXT sing N N 357 TYR CB CG sing N N 358 TYR CB HB2 sing N N 359 TYR CB HB3 sing N N 360 TYR CG CD1 doub Y N 361 TYR CG CD2 sing Y N 362 TYR CD1 CE1 sing Y N 363 TYR CD1 HD1 sing N N 364 TYR CD2 CE2 doub Y N 365 TYR CD2 HD2 sing N N 366 TYR CE1 CZ doub Y N 367 TYR CE1 HE1 sing N N 368 TYR CE2 CZ sing Y N 369 TYR CE2 HE2 sing N N 370 TYR CZ OH sing N N 371 TYR OH HH sing N N 372 TYR OXT HXT sing N N 373 VAL N CA sing N N 374 VAL N H sing N N 375 VAL N H2 sing N N 376 VAL CA C sing N N 377 VAL CA CB sing N N 378 VAL CA HA sing N N 379 VAL C O doub N N 380 VAL C OXT sing N N 381 VAL CB CG1 sing N N 382 VAL CB CG2 sing N N 383 VAL CB HB sing N N 384 VAL CG1 HG11 sing N N 385 VAL CG1 HG12 sing N N 386 VAL CG1 HG13 sing N N 387 VAL CG2 HG21 sing N N 388 VAL CG2 HG22 sing N N 389 VAL CG2 HG23 sing N N 390 VAL OXT HXT sing N N 391 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Other government' Sweden 'Insamlingsstiftelsen grant 2019-2022' 1 'Other government' Sweden SMK-1860 2 'Other government' Sweden 'CTS 15-96 and CTS 18-65' 3 # _atom_sites.entry_id 9QWL _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.012926 _atom_sites.fract_transf_matrix[1][2] 0.007463 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014925 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.020993 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S SE # loop_ #