data_9QXY # _entry.id 9QXY # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.403 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9QXY pdb_00009qxy 10.2210/pdb9qxy/pdb WWPDB D_1292147213 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2025-04-23 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9QXY _pdbx_database_status.recvd_initial_deposition_date 2025-04-16 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email ivo.tews@soton.ac.uk _pdbx_contact_author.name_first Ivo _pdbx_contact_author.name_last Tews _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-4704-1139 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Stubbs, J.' 1 0000-0002-3788-1687 'Tews, I.' 2 0000-0002-4704-1139 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'SSX structure of Thaumatin grown in microfluidic droplets' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Stubbs, J.' 1 0000-0002-3788-1687 primary 'Tews, I.' 2 0000-0002-4704-1139 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer nat 'Thaumatin I' 22155.980 1 ? 0 'RESIDUES 1-206' ? 2 non-polymer syn 'L(+)-TARTARIC ACID' 150.087 1 ? ? ? ? 3 water nat water 18.015 100 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name Thaumatin-1 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;ATFEIVNRCSYTVWAAASKGDAALDAGGRQLNSGESWTINVEPGTNGGKIWARTDCYFDDSGSGICKTGDCGGLLRCKRF GRPPTTLAEFSLNQYGKDYIDISNIKGFNVPMNFSPTTRGCRGVRCAADIVGQCPAKLKAPGGGCNDACTVFQTSEYCCT TGKCGPTEYSRFFKRLCPDAFSYVLDKPTTVTCPGSSNYRVTFCPT ; _entity_poly.pdbx_seq_one_letter_code_can ;ATFEIVNRCSYTVWAAASKGDAALDAGGRQLNSGESWTINVEPGTNGGKIWARTDCYFDDSGSGICKTGDCGGLLRCKRF GRPPTTLAEFSLNQYGKDYIDISNIKGFNVPMNFSPTTRGCRGVRCAADIVGQCPAKLKAPGGGCNDACTVFQTSEYCCT TGKCGPTEYSRFFKRLCPDAFSYVLDKPTTVTCPGSSNYRVTFCPT ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'L(+)-TARTARIC ACID' TLA 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 THR n 1 3 PHE n 1 4 GLU n 1 5 ILE n 1 6 VAL n 1 7 ASN n 1 8 ARG n 1 9 CYS n 1 10 SER n 1 11 TYR n 1 12 THR n 1 13 VAL n 1 14 TRP n 1 15 ALA n 1 16 ALA n 1 17 ALA n 1 18 SER n 1 19 LYS n 1 20 GLY n 1 21 ASP n 1 22 ALA n 1 23 ALA n 1 24 LEU n 1 25 ASP n 1 26 ALA n 1 27 GLY n 1 28 GLY n 1 29 ARG n 1 30 GLN n 1 31 LEU n 1 32 ASN n 1 33 SER n 1 34 GLY n 1 35 GLU n 1 36 SER n 1 37 TRP n 1 38 THR n 1 39 ILE n 1 40 ASN n 1 41 VAL n 1 42 GLU n 1 43 PRO n 1 44 GLY n 1 45 THR n 1 46 ASN n 1 47 GLY n 1 48 GLY n 1 49 LYS n 1 50 ILE n 1 51 TRP n 1 52 ALA n 1 53 ARG n 1 54 THR n 1 55 ASP n 1 56 CYS n 1 57 TYR n 1 58 PHE n 1 59 ASP n 1 60 ASP n 1 61 SER n 1 62 GLY n 1 63 SER n 1 64 GLY n 1 65 ILE n 1 66 CYS n 1 67 LYS n 1 68 THR n 1 69 GLY n 1 70 ASP n 1 71 CYS n 1 72 GLY n 1 73 GLY n 1 74 LEU n 1 75 LEU n 1 76 ARG n 1 77 CYS n 1 78 LYS n 1 79 ARG n 1 80 PHE n 1 81 GLY n 1 82 ARG n 1 83 PRO n 1 84 PRO n 1 85 THR n 1 86 THR n 1 87 LEU n 1 88 ALA n 1 89 GLU n 1 90 PHE n 1 91 SER n 1 92 LEU n 1 93 ASN n 1 94 GLN n 1 95 TYR n 1 96 GLY n 1 97 LYS n 1 98 ASP n 1 99 TYR n 1 100 ILE n 1 101 ASP n 1 102 ILE n 1 103 SER n 1 104 ASN n 1 105 ILE n 1 106 LYS n 1 107 GLY n 1 108 PHE n 1 109 ASN n 1 110 VAL n 1 111 PRO n 1 112 MET n 1 113 ASN n 1 114 PHE n 1 115 SER n 1 116 PRO n 1 117 THR n 1 118 THR n 1 119 ARG n 1 120 GLY n 1 121 CYS n 1 122 ARG n 1 123 GLY n 1 124 VAL n 1 125 ARG n 1 126 CYS n 1 127 ALA n 1 128 ALA n 1 129 ASP n 1 130 ILE n 1 131 VAL n 1 132 GLY n 1 133 GLN n 1 134 CYS n 1 135 PRO n 1 136 ALA n 1 137 LYS n 1 138 LEU n 1 139 LYS n 1 140 ALA n 1 141 PRO n 1 142 GLY n 1 143 GLY n 1 144 GLY n 1 145 CYS n 1 146 ASN n 1 147 ASP n 1 148 ALA n 1 149 CYS n 1 150 THR n 1 151 VAL n 1 152 PHE n 1 153 GLN n 1 154 THR n 1 155 SER n 1 156 GLU n 1 157 TYR n 1 158 CYS n 1 159 CYS n 1 160 THR n 1 161 THR n 1 162 GLY n 1 163 LYS n 1 164 CYS n 1 165 GLY n 1 166 PRO n 1 167 THR n 1 168 GLU n 1 169 TYR n 1 170 SER n 1 171 ARG n 1 172 PHE n 1 173 PHE n 1 174 LYS n 1 175 ARG n 1 176 LEU n 1 177 CYS n 1 178 PRO n 1 179 ASP n 1 180 ALA n 1 181 PHE n 1 182 SER n 1 183 TYR n 1 184 VAL n 1 185 LEU n 1 186 ASP n 1 187 LYS n 1 188 PRO n 1 189 THR n 1 190 THR n 1 191 VAL n 1 192 THR n 1 193 CYS n 1 194 PRO n 1 195 GLY n 1 196 SER n 1 197 SER n 1 198 ASN n 1 199 TYR n 1 200 ARG n 1 201 VAL n 1 202 THR n 1 203 PHE n 1 204 CYS n 1 205 PRO n 1 206 THR n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name ? _entity_src_nat.pdbx_organism_scientific 'Thaumatococcus daniellii' _entity_src_nat.pdbx_ncbi_taxonomy_id 4621 _entity_src_nat.genus ? _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TLA non-polymer . 'L(+)-TARTARIC ACID' ? 'C4 H6 O6' 150.087 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 THR 2 2 2 THR THR A . n A 1 3 PHE 3 3 3 PHE PHE A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 ILE 5 5 5 ILE ILE A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 ASN 7 7 7 ASN ASN A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 CYS 9 9 9 CYS CYS A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 TYR 11 11 11 TYR TYR A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 TRP 14 14 14 TRP TRP A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 GLN 30 30 30 GLN GLN A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 ASN 32 32 32 ASN ASN A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 TRP 37 37 37 TRP TRP A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 ASN 40 40 40 ASN ASN A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 PRO 43 43 43 PRO PRO A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 ASN 46 46 46 ASN ASN A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 TRP 51 51 51 TRP TRP A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 ARG 53 53 53 ARG ARG A . n A 1 54 THR 54 54 54 THR THR A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 CYS 56 56 56 CYS CYS A . n A 1 57 TYR 57 57 57 TYR TYR A . n A 1 58 PHE 58 58 58 PHE PHE A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 CYS 66 66 66 CYS CYS A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 THR 68 68 68 THR THR A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 ASP 70 70 70 ASP ASP A . n A 1 71 CYS 71 71 71 CYS CYS A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 ARG 76 76 76 ARG ARG A . n A 1 77 CYS 77 77 77 CYS CYS A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 ARG 79 79 79 ARG ARG A . n A 1 80 PHE 80 80 80 PHE PHE A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 ARG 82 82 82 ARG ARG A . n A 1 83 PRO 83 83 83 PRO PRO A . n A 1 84 PRO 84 84 84 PRO PRO A . n A 1 85 THR 85 85 85 THR THR A . n A 1 86 THR 86 86 86 THR THR A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 ALA 88 88 88 ALA ALA A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 PHE 90 90 90 PHE PHE A . n A 1 91 SER 91 91 91 SER SER A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 ASN 93 93 93 ASN ASN A . n A 1 94 GLN 94 94 94 GLN GLN A . n A 1 95 TYR 95 95 95 TYR TYR A . n A 1 96 GLY 96 96 96 GLY GLY A . n A 1 97 LYS 97 97 97 LYS LYS A . n A 1 98 ASP 98 98 98 ASP ASP A . n A 1 99 TYR 99 99 99 TYR TYR A . n A 1 100 ILE 100 100 100 ILE ILE A . n A 1 101 ASP 101 101 101 ASP ASP A . n A 1 102 ILE 102 102 102 ILE ILE A . n A 1 103 SER 103 103 103 SER SER A . n A 1 104 ASN 104 104 104 ASN ASN A . n A 1 105 ILE 105 105 105 ILE ILE A . n A 1 106 LYS 106 106 106 LYS LYS A . n A 1 107 GLY 107 107 107 GLY GLY A . n A 1 108 PHE 108 108 108 PHE PHE A . n A 1 109 ASN 109 109 109 ASN ASN A . n A 1 110 VAL 110 110 110 VAL VAL A . n A 1 111 PRO 111 111 111 PRO PRO A . n A 1 112 MET 112 112 112 MET MET A . n A 1 113 ASN 113 113 113 ASN ASN A . n A 1 114 PHE 114 114 114 PHE PHE A . n A 1 115 SER 115 115 115 SER SER A . n A 1 116 PRO 116 116 116 PRO PRO A . n A 1 117 THR 117 117 117 THR THR A . n A 1 118 THR 118 118 118 THR THR A . n A 1 119 ARG 119 119 119 ARG ARG A . n A 1 120 GLY 120 120 120 GLY GLY A . n A 1 121 CYS 121 121 121 CYS CYS A . n A 1 122 ARG 122 122 122 ARG ARG A . n A 1 123 GLY 123 123 123 GLY GLY A . n A 1 124 VAL 124 124 124 VAL VAL A . n A 1 125 ARG 125 125 125 ARG ARG A . n A 1 126 CYS 126 126 126 CYS CYS A . n A 1 127 ALA 127 127 127 ALA ALA A . n A 1 128 ALA 128 128 128 ALA ALA A . n A 1 129 ASP 129 129 129 ASP ASP A . n A 1 130 ILE 130 130 130 ILE ILE A . n A 1 131 VAL 131 131 131 VAL VAL A . n A 1 132 GLY 132 132 132 GLY GLY A . n A 1 133 GLN 133 133 133 GLN GLN A . n A 1 134 CYS 134 134 134 CYS CYS A . n A 1 135 PRO 135 135 135 PRO PRO A . n A 1 136 ALA 136 136 136 ALA ALA A . n A 1 137 LYS 137 137 137 LYS LYS A . n A 1 138 LEU 138 138 138 LEU LEU A . n A 1 139 LYS 139 139 139 LYS LYS A . n A 1 140 ALA 140 140 140 ALA ALA A . n A 1 141 PRO 141 141 141 PRO PRO A . n A 1 142 GLY 142 142 142 GLY GLY A . n A 1 143 GLY 143 143 143 GLY GLY A . n A 1 144 GLY 144 144 144 GLY GLY A . n A 1 145 CYS 145 145 145 CYS CYS A . n A 1 146 ASN 146 146 146 ASN ASN A . n A 1 147 ASP 147 147 147 ASP ASP A . n A 1 148 ALA 148 148 148 ALA ALA A . n A 1 149 CYS 149 149 149 CYS CYS A . n A 1 150 THR 150 150 150 THR THR A . n A 1 151 VAL 151 151 151 VAL VAL A . n A 1 152 PHE 152 152 152 PHE PHE A . n A 1 153 GLN 153 153 153 GLN GLN A . n A 1 154 THR 154 154 154 THR THR A . n A 1 155 SER 155 155 155 SER SER A . n A 1 156 GLU 156 156 156 GLU GLU A . n A 1 157 TYR 157 157 157 TYR TYR A . n A 1 158 CYS 158 158 158 CYS CYS A . n A 1 159 CYS 159 159 159 CYS CYS A . n A 1 160 THR 160 160 160 THR THR A . n A 1 161 THR 161 161 161 THR THR A . n A 1 162 GLY 162 162 162 GLY GLY A . n A 1 163 LYS 163 163 163 LYS LYS A . n A 1 164 CYS 164 164 164 CYS CYS A . n A 1 165 GLY 165 165 165 GLY GLY A . n A 1 166 PRO 166 166 166 PRO PRO A . n A 1 167 THR 167 167 167 THR THR A . n A 1 168 GLU 168 168 168 GLU GLU A . n A 1 169 TYR 169 169 169 TYR TYR A . n A 1 170 SER 170 170 170 SER SER A . n A 1 171 ARG 171 171 171 ARG ARG A . n A 1 172 PHE 172 172 172 PHE PHE A . n A 1 173 PHE 173 173 173 PHE PHE A . n A 1 174 LYS 174 174 174 LYS LYS A . n A 1 175 ARG 175 175 175 ARG ARG A . n A 1 176 LEU 176 176 176 LEU LEU A . n A 1 177 CYS 177 177 177 CYS CYS A . n A 1 178 PRO 178 178 178 PRO PRO A . n A 1 179 ASP 179 179 179 ASP ASP A . n A 1 180 ALA 180 180 180 ALA ALA A . n A 1 181 PHE 181 181 181 PHE PHE A . n A 1 182 SER 182 182 182 SER SER A . n A 1 183 TYR 183 183 183 TYR TYR A . n A 1 184 VAL 184 184 184 VAL VAL A . n A 1 185 LEU 185 185 185 LEU LEU A . n A 1 186 ASP 186 186 186 ASP ASP A . n A 1 187 LYS 187 187 187 LYS LYS A . n A 1 188 PRO 188 188 188 PRO PRO A . n A 1 189 THR 189 189 189 THR THR A . n A 1 190 THR 190 190 190 THR THR A . n A 1 191 VAL 191 191 191 VAL VAL A . n A 1 192 THR 192 192 192 THR THR A . n A 1 193 CYS 193 193 193 CYS CYS A . n A 1 194 PRO 194 194 194 PRO PRO A . n A 1 195 GLY 195 195 195 GLY GLY A . n A 1 196 SER 196 196 196 SER SER A . n A 1 197 SER 197 197 197 SER SER A . n A 1 198 ASN 198 198 198 ASN ASN A . n A 1 199 TYR 199 199 199 TYR TYR A . n A 1 200 ARG 200 200 200 ARG ARG A . n A 1 201 VAL 201 201 201 VAL VAL A . n A 1 202 THR 202 202 202 THR THR A . n A 1 203 PHE 203 203 203 PHE PHE A . n A 1 204 CYS 204 204 204 CYS CYS A . n A 1 205 PRO 205 205 205 PRO PRO A . n A 1 206 THR 206 206 206 THR THR A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 TLA 1 301 301 TLA TLA A . C 3 HOH 1 401 422 HOH HOH A . C 3 HOH 2 402 436 HOH HOH A . C 3 HOH 3 403 421 HOH HOH A . C 3 HOH 4 404 490 HOH HOH A . C 3 HOH 5 405 419 HOH HOH A . C 3 HOH 6 406 402 HOH HOH A . C 3 HOH 7 407 424 HOH HOH A . C 3 HOH 8 408 429 HOH HOH A . C 3 HOH 9 409 460 HOH HOH A . C 3 HOH 10 410 528 HOH HOH A . C 3 HOH 11 411 478 HOH HOH A . C 3 HOH 12 412 415 HOH HOH A . C 3 HOH 13 413 437 HOH HOH A . C 3 HOH 14 414 485 HOH HOH A . C 3 HOH 15 415 443 HOH HOH A . C 3 HOH 16 416 441 HOH HOH A . C 3 HOH 17 417 469 HOH HOH A . C 3 HOH 18 418 480 HOH HOH A . C 3 HOH 19 419 418 HOH HOH A . C 3 HOH 20 420 581 HOH HOH A . C 3 HOH 21 421 479 HOH HOH A . C 3 HOH 22 422 446 HOH HOH A . C 3 HOH 23 423 483 HOH HOH A . C 3 HOH 24 424 433 HOH HOH A . C 3 HOH 25 425 432 HOH HOH A . C 3 HOH 26 426 450 HOH HOH A . C 3 HOH 27 427 486 HOH HOH A . C 3 HOH 28 428 454 HOH HOH A . C 3 HOH 29 429 457 HOH HOH A . C 3 HOH 30 430 449 HOH HOH A . C 3 HOH 31 431 474 HOH HOH A . C 3 HOH 32 432 476 HOH HOH A . C 3 HOH 33 433 414 HOH HOH A . C 3 HOH 34 434 504 HOH HOH A . C 3 HOH 35 435 468 HOH HOH A . C 3 HOH 36 436 439 HOH HOH A . C 3 HOH 37 437 455 HOH HOH A . C 3 HOH 38 438 514 HOH HOH A . C 3 HOH 39 439 501 HOH HOH A . C 3 HOH 40 440 597 HOH HOH A . C 3 HOH 41 441 550 HOH HOH A . C 3 HOH 42 442 583 HOH HOH A . C 3 HOH 43 443 510 HOH HOH A . C 3 HOH 44 444 556 HOH HOH A . C 3 HOH 45 445 532 HOH HOH A . C 3 HOH 46 446 587 HOH HOH A . C 3 HOH 47 447 463 HOH HOH A . C 3 HOH 48 448 580 HOH HOH A . C 3 HOH 49 449 482 HOH HOH A . C 3 HOH 50 450 462 HOH HOH A . C 3 HOH 51 451 493 HOH HOH A . C 3 HOH 52 452 576 HOH HOH A . C 3 HOH 53 453 503 HOH HOH A . C 3 HOH 54 454 548 HOH HOH A . C 3 HOH 55 455 2 HOH HOH A . C 3 HOH 56 456 541 HOH HOH A . C 3 HOH 57 457 593 HOH HOH A . C 3 HOH 58 458 559 HOH HOH A . C 3 HOH 59 459 530 HOH HOH A . C 3 HOH 60 460 588 HOH HOH A . C 3 HOH 61 461 540 HOH HOH A . C 3 HOH 62 462 507 HOH HOH A . C 3 HOH 63 463 3 HOH HOH A . C 3 HOH 64 464 555 HOH HOH A . C 3 HOH 65 465 499 HOH HOH A . C 3 HOH 66 466 539 HOH HOH A . C 3 HOH 67 467 560 HOH HOH A . C 3 HOH 68 468 472 HOH HOH A . C 3 HOH 69 469 500 HOH HOH A . C 3 HOH 70 470 489 HOH HOH A . C 3 HOH 71 471 538 HOH HOH A . C 3 HOH 72 472 565 HOH HOH A . C 3 HOH 73 473 524 HOH HOH A . C 3 HOH 74 474 563 HOH HOH A . C 3 HOH 75 475 611 HOH HOH A . C 3 HOH 76 476 465 HOH HOH A . C 3 HOH 77 477 484 HOH HOH A . C 3 HOH 78 478 515 HOH HOH A . C 3 HOH 79 479 505 HOH HOH A . C 3 HOH 80 480 562 HOH HOH A . C 3 HOH 81 481 586 HOH HOH A . C 3 HOH 82 482 577 HOH HOH A . C 3 HOH 83 483 430 HOH HOH A . C 3 HOH 84 484 575 HOH HOH A . C 3 HOH 85 485 561 HOH HOH A . C 3 HOH 86 486 585 HOH HOH A . C 3 HOH 87 487 554 HOH HOH A . C 3 HOH 88 488 582 HOH HOH A . C 3 HOH 89 489 545 HOH HOH A . C 3 HOH 90 490 549 HOH HOH A . C 3 HOH 91 491 605 HOH HOH A . C 3 HOH 92 492 564 HOH HOH A . C 3 HOH 93 493 625 HOH HOH A . C 3 HOH 94 494 637 HOH HOH A . C 3 HOH 95 495 573 HOH HOH A . C 3 HOH 96 496 645 HOH HOH A . C 3 HOH 97 497 655 HOH HOH A . C 3 HOH 98 498 653 HOH HOH A . C 3 HOH 99 499 680 HOH HOH A . C 3 HOH 100 500 672 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? '5.8.0430 (refmacat 0.4.100)' ? 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? CrystFEL ? ? ? . ? 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? CrystFEL ? ? ? . ? 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . ? 4 # _cell.angle_alpha 90 _cell.angle_alpha_esd ? _cell.angle_beta 90 _cell.angle_beta_esd ? _cell.angle_gamma 90 _cell.angle_gamma_esd ? _cell.entry_id 9QXY _cell.details ? _cell.formula_units_Z ? _cell.length_a 58.97 _cell.length_a_esd ? _cell.length_b 58.97 _cell.length_b_esd ? _cell.length_c 152.75 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9QXY _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9QXY _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.99 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 59.02 _exptl_crystal.description Bipyramidal _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method MICROFLUIDIC _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;Crystals were grown in a droplet microfluidic device 50 x 40 micron (w x h) with a QX200 oil flow rate of 22.5 uL/min, a crystallisation condition flow rate of 6 uL/min and a thaumatin flow rate of 1.5 uL/min resulting in 81 pL droplets. Thaumatin from Thaumatococcus danielii (T7639, Sigma-Aldrich) was dissolved in milliQ water to a final concentration of 50 mg/mL The crystallisation condition was 40% (w/v) sodium potassium tartrate, 0.1 M bis-Tris propane pH 6.5. ; _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 294 # _diffrn.ambient_environment ? _diffrn.ambient_temp 293 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment Y # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'PSI JUNGFRAU 4M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2025-02-09 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator M _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.072 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE ID29' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.072 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ID29 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate 20.93 _reflns.entry_id 9QXY _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.60 _reflns.d_resolution_low 58.97 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 36626 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.00 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 224.12 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 7.1 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.990 _reflns.pdbx_CC_star 0.997 _reflns.pdbx_R_split 0.095 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.60 _reflns_shell.d_res_low 1.63 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 0.5 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1791 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 94.16 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.314 _reflns_shell.pdbx_CC_star 0.691 _reflns_shell.pdbx_R_split 2.024 _reflns_shell.percent_possible_all 100.00 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] -2.105 _refine.aniso_B[1][2] 0.000 _refine.aniso_B[1][3] -0.000 _refine.aniso_B[2][2] -2.105 _refine.aniso_B[2][3] 0.000 _refine.aniso_B[3][3] 4.210 _refine.B_iso_max ? _refine.B_iso_mean 29.453 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.983 _refine.correlation_coeff_Fo_to_Fc_free 0.975 _refine.details 'Hydrogens have been added in their riding positions' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9QXY _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.600 _refine.ls_d_res_low 55.073 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 36538 _refine.ls_number_reflns_R_free 1860 _refine.ls_number_reflns_R_work 34678 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 100.000 _refine.ls_percent_reflns_R_free 5.091 _refine.ls_R_factor_all 0.147 _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.1758 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1457 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'MASK BULK SOLVENT' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.071 _refine.pdbx_overall_ESU_R_Free 0.064 _refine.pdbx_solvent_vdw_probe_radii 1.300 _refine.pdbx_solvent_ion_probe_radii 0.900 _refine.pdbx_solvent_shrinkage_radii 0.900 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 5.155 _refine.overall_SU_ML 0.068 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1546 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 10 _refine_hist.number_atoms_solvent 100 _refine_hist.number_atoms_total 1656 _refine_hist.d_res_high 1.600 _refine_hist.d_res_low 55.073 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.010 0.012 1662 ? r_bond_refined_d ? ? ? 'X-RAY DIFFRACTION' ? 0.001 0.016 1498 ? r_bond_other_d ? ? ? 'X-RAY DIFFRACTION' ? 1.677 1.799 2277 ? r_angle_refined_deg ? ? ? 'X-RAY DIFFRACTION' ? 0.612 1.753 3467 ? r_angle_other_deg ? ? ? 'X-RAY DIFFRACTION' ? 6.979 5.000 226 ? r_dihedral_angle_1_deg ? ? ? 'X-RAY DIFFRACTION' ? 6.297 5.000 12 ? r_dihedral_angle_2_deg ? ? ? 'X-RAY DIFFRACTION' ? 11.350 10.000 256 ? r_dihedral_angle_3_deg ? ? ? 'X-RAY DIFFRACTION' ? 15.867 10.000 68 ? r_dihedral_angle_6_deg ? ? ? 'X-RAY DIFFRACTION' ? 0.091 0.200 246 ? r_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.007 0.020 2031 ? r_gen_planes_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 399 ? r_gen_planes_other ? ? ? 'X-RAY DIFFRACTION' ? 0.194 0.200 218 ? r_nbd_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.196 0.200 1167 ? r_symmetry_nbd_other ? ? ? 'X-RAY DIFFRACTION' ? 0.175 0.200 792 ? r_nbtor_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.083 0.200 828 ? r_symmetry_nbtor_other ? ? ? 'X-RAY DIFFRACTION' ? 0.113 0.200 50 ? r_xyhbond_nbd_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.198 0.200 7 ? r_symmetry_nbd_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.170 0.200 39 ? r_nbd_other ? ? ? 'X-RAY DIFFRACTION' ? 0.261 0.200 6 ? r_symmetry_xyhbond_nbd_refined ? ? ? 'X-RAY DIFFRACTION' ? 7.808 2.580 851 ? r_mcbond_it ? ? ? 'X-RAY DIFFRACTION' ? 7.752 2.578 851 ? r_mcbond_other ? ? ? 'X-RAY DIFFRACTION' ? 10.714 4.660 1069 ? r_mcangle_it ? ? ? 'X-RAY DIFFRACTION' ? 10.735 4.661 1070 ? r_mcangle_other ? ? ? 'X-RAY DIFFRACTION' ? 12.155 3.058 811 ? r_scbond_it ? ? ? 'X-RAY DIFFRACTION' ? 12.155 3.059 810 ? r_scbond_other ? ? ? 'X-RAY DIFFRACTION' ? 17.213 5.401 1199 ? r_scangle_it ? ? ? 'X-RAY DIFFRACTION' ? 17.214 5.401 1199 ? r_scangle_other ? ? ? 'X-RAY DIFFRACTION' ? 19.626 28.045 1692 ? r_lrange_it ? ? ? 'X-RAY DIFFRACTION' ? 19.619 27.210 1685 ? r_lrange_other ? ? ? 'X-RAY DIFFRACTION' ? 6.709 3.000 3160 ? r_rigid_bond_restr ? ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.600 1.642 2652 . 149 2503 100.0000 . 0.390 . . 0.391 . . . . . 0.391 . . . . . 20 . 0.914 0.907 0.375 'X-RAY DIFFRACTION' 1.642 1.686 2580 . 120 2460 100.0000 . 0.352 . . 0.352 . . . . . 0.352 . . . . . 20 . 0.939 0.947 0.360 'X-RAY DIFFRACTION' 1.686 1.735 2514 . 137 2377 100.0000 . 0.325 . . 0.322 . . . . . 0.315 . . . . . 20 . 0.956 0.953 0.372 'X-RAY DIFFRACTION' 1.735 1.789 2430 . 113 2317 100.0000 . 0.294 . . 0.291 . . . . . 0.278 . . . . . 20 . 0.971 0.944 0.347 'X-RAY DIFFRACTION' 1.789 1.847 2369 . 139 2230 100.0000 . 0.258 . . 0.260 . . . . . 0.241 . . . . . 20 . 0.977 0.971 0.227 'X-RAY DIFFRACTION' 1.847 1.912 2304 . 106 2198 100.0000 . 0.210 . . 0.206 . . . . . 0.181 . . . . . 20 . 0.983 0.969 0.300 'X-RAY DIFFRACTION' 1.912 1.984 2212 . 116 2096 100.0000 . 0.164 . . 0.163 . . . . . 0.137 . . . . . 20 . 0.988 0.976 0.189 'X-RAY DIFFRACTION' 1.984 2.065 2125 . 91 2034 100.0000 . 0.136 . . 0.134 . . . . . 0.110 . . . . . 20 . 0.992 0.981 0.199 'X-RAY DIFFRACTION' 2.065 2.157 2062 . 110 1952 100.0000 . 0.124 . . 0.121 . . . . . 0.102 . . . . . 20 . 0.994 0.985 0.166 'X-RAY DIFFRACTION' 2.157 2.262 1983 . 108 1875 100.0000 . 0.132 . . 0.131 . . . . . 0.113 . . . . . 20 . 0.993 0.988 0.154 'X-RAY DIFFRACTION' 2.262 2.384 1896 . 110 1786 100.0000 . 0.132 . . 0.129 . . . . . 0.115 . . . . . 20 . 0.993 0.982 0.178 'X-RAY DIFFRACTION' 2.384 2.528 1771 . 78 1693 100.0000 . 0.125 . . 0.125 . . . . . 0.110 . . . . . 20 . 0.993 0.989 0.145 'X-RAY DIFFRACTION' 2.528 2.702 1694 . 88 1606 100.0000 . 0.143 . . 0.140 . . . . . 0.124 . . . . . 20 . 0.990 0.972 0.198 'X-RAY DIFFRACTION' 2.702 2.918 1577 . 75 1502 100.0000 . 0.138 . . 0.137 . . . . . 0.125 . . . . . 20 . 0.989 0.988 0.169 'X-RAY DIFFRACTION' 2.918 3.196 1465 . 65 1400 100.0000 . 0.122 . . 0.120 . . . . . 0.115 . . . . . 20 . 0.992 0.989 0.157 'X-RAY DIFFRACTION' 3.196 3.572 1337 . 71 1266 100.0000 . 0.117 . . 0.116 . . . . . 0.116 . . . . . 20 . 0.993 0.988 0.132 'X-RAY DIFFRACTION' 3.572 4.121 1202 . 66 1136 100.0000 . 0.095 . . 0.093 . . . . . 0.101 . . . . . 20 . 0.995 0.993 0.117 'X-RAY DIFFRACTION' 4.121 5.041 1029 . 55 974 100.0000 . 0.092 . . 0.090 . . . . . 0.100 . . . . . 20 . 0.997 0.991 0.127 'X-RAY DIFFRACTION' 5.041 7.099 822 . 40 782 100.0000 . 0.146 . . 0.146 . . . . . 0.160 . . . . . 20 . 0.992 0.989 0.146 'X-RAY DIFFRACTION' 7.099 55.073 514 . 23 491 100.0000 . 0.182 . . 0.183 . . . . . 0.204 . . . . . 20 . 0.977 0.985 0.172 # _struct.entry_id 9QXY _struct.title 'SSX structure of Thaumatin grown in microfluidic droplets' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9QXY _struct_keywords.text 'Taste-modifying protein, PLANT PROTEIN' _struct_keywords.pdbx_keywords 'PLANT PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code THM1_THADA _struct_ref.pdbx_db_accession P02883 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;ATFEIVNRCSYTVWAAASKGDAALDAGGRQLNSGESWTINVEPGTNGGKIWARTDCYFDDSGSGICKTGDCGGLLRCKRF GRPPTTLAEFSLNQYGKDYIDISNIKGFNVPMDFSPTTRGCRGVRCAADIVGQCPAKLKAPGGGCNDACTVFQTSEYCCT TGKCGPTEYSRFFKRLCPDAFSYVLDKPTTVTCPGSSNYRVTFCPT ; _struct_ref.pdbx_align_begin 23 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9QXY _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 206 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P02883 _struct_ref_seq.db_align_beg 23 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 228 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 206 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 9QXY _struct_ref_seq_dif.mon_id ASN _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 113 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P02883 _struct_ref_seq_dif.db_mon_id ASP _struct_ref_seq_dif.pdbx_seq_db_seq_num 135 _struct_ref_seq_dif.details conflict _struct_ref_seq_dif.pdbx_auth_seq_num 113 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 0.9999999999999999 _pdbx_struct_oper_list.matrix[1][2] 0.0 _pdbx_struct_oper_list.matrix[1][3] 0.0 _pdbx_struct_oper_list.vector[1] 0.0 _pdbx_struct_oper_list.matrix[2][1] 0.0 _pdbx_struct_oper_list.matrix[2][2] 0.9999999999999999 _pdbx_struct_oper_list.matrix[2][3] 0.0 _pdbx_struct_oper_list.vector[2] 0.0 _pdbx_struct_oper_list.matrix[3][1] 0.0 _pdbx_struct_oper_list.matrix[3][2] 0.0 _pdbx_struct_oper_list.matrix[3][3] 1.0 _pdbx_struct_oper_list.vector[3] 0.0 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 129 ? CYS A 134 ? ASP A 129 CYS A 134 1 ? 6 HELX_P HELX_P2 AA2 PRO A 135 ? LYS A 139 ? PRO A 135 LYS A 139 5 ? 5 HELX_P HELX_P3 AA3 ASP A 147 ? GLN A 153 ? ASP A 147 GLN A 153 1 ? 7 HELX_P HELX_P4 AA4 THR A 154 ? CYS A 159 ? THR A 154 CYS A 159 1 ? 6 HELX_P HELX_P5 AA5 THR A 167 ? CYS A 177 ? THR A 167 CYS A 177 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 9 SG ? ? ? 1_555 A CYS 204 SG ? ? A CYS 9 A CYS 204 1_555 ? ? ? ? ? ? ? 2.043 ? ? disulf2 disulf ? ? A CYS 56 SG ? ? ? 1_555 A CYS 66 SG ? ? A CYS 56 A CYS 66 1_555 ? ? ? ? ? ? ? 2.038 ? ? disulf3 disulf ? ? A CYS 71 SG ? ? ? 1_555 A CYS 77 SG ? ? A CYS 71 A CYS 77 1_555 ? ? ? ? ? ? ? 2.012 ? ? disulf4 disulf ? ? A CYS 121 SG ? ? ? 1_555 A CYS 193 SG ? ? A CYS 121 A CYS 193 1_555 ? ? ? ? ? ? ? 2.041 ? ? disulf5 disulf ? ? A CYS 126 SG ? ? ? 1_555 A CYS 177 SG ? ? A CYS 126 A CYS 177 1_555 ? ? ? ? ? ? ? 2.037 ? ? disulf6 disulf ? ? A CYS 134 SG ? ? ? 1_555 A CYS 145 SG ? ? A CYS 134 A CYS 145 1_555 ? ? ? ? ? ? ? 2.031 ? ? disulf7 disulf ? ? A CYS 149 SG ? ? ? 1_555 A CYS 158 SG ? ? A CYS 149 A CYS 158 1_555 ? ? ? ? ? ? ? 2.054 ? ? disulf8 disulf ? ? A CYS 159 SG A ? ? 1_555 A CYS 164 SG ? ? A CYS 159 A CYS 164 1_555 ? ? ? ? ? ? ? 2.004 ? ? disulf9 disulf ? ? A CYS 159 SG B ? ? 1_555 A CYS 164 SG ? ? A CYS 159 A CYS 164 1_555 ? ? ? ? ? ? ? 2.010 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 9 ? CYS A 204 ? CYS A 9 ? 1_555 CYS A 204 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 56 ? CYS A 66 ? CYS A 56 ? 1_555 CYS A 66 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 71 ? CYS A 77 ? CYS A 71 ? 1_555 CYS A 77 ? 1_555 SG SG . . . None 'Disulfide bridge' 4 CYS A 121 ? CYS A 193 ? CYS A 121 ? 1_555 CYS A 193 ? 1_555 SG SG . . . None 'Disulfide bridge' 5 CYS A 126 ? CYS A 177 ? CYS A 126 ? 1_555 CYS A 177 ? 1_555 SG SG . . . None 'Disulfide bridge' 6 CYS A 134 ? CYS A 145 ? CYS A 134 ? 1_555 CYS A 145 ? 1_555 SG SG . . . None 'Disulfide bridge' 7 CYS A 149 ? CYS A 158 ? CYS A 149 ? 1_555 CYS A 158 ? 1_555 SG SG . . . None 'Disulfide bridge' 8 CYS A 159 A CYS A 164 ? CYS A 159 ? 1_555 CYS A 164 ? 1_555 SG SG . . . None 'Disulfide bridge' 9 CYS A 159 B CYS A 164 ? CYS A 159 ? 1_555 CYS A 164 ? 1_555 SG SG . . . None 'Disulfide bridge' # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id PRO _struct_mon_prot_cis.label_seq_id 83 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id PRO _struct_mon_prot_cis.auth_seq_id 83 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 84 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 84 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 3.48 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 6 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel AA3 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 SER A 36 ? ASN A 40 ? SER A 36 ASN A 40 AA1 2 THR A 2 ? ASN A 7 ? THR A 2 ASN A 7 AA1 3 TYR A 199 ? PHE A 203 ? TYR A 199 PHE A 203 AA1 4 MET A 112 ? PRO A 116 ? MET A 112 PRO A 116 AA1 5 VAL A 124 ? CYS A 126 ? VAL A 124 CYS A 126 AA2 1 ALA A 23 ? LEU A 31 ? ALA A 23 LEU A 31 AA2 2 VAL A 13 ? SER A 18 ? VAL A 13 SER A 18 AA2 3 GLY A 48 ? ARG A 53 ? GLY A 48 ARG A 53 AA2 4 LEU A 87 ? GLN A 94 ? LEU A 87 GLN A 94 AA2 5 LYS A 97 ? SER A 103 ? LYS A 97 SER A 103 AA2 6 VAL A 191 ? PRO A 194 ? VAL A 191 PRO A 194 AA3 1 TYR A 57 ? PHE A 58 ? TYR A 57 PHE A 58 AA3 2 GLY A 64 ? ILE A 65 ? GLY A 64 ILE A 65 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O TRP A 37 ? O TRP A 37 N ILE A 5 ? N ILE A 5 AA1 2 3 N VAL A 6 ? N VAL A 6 O PHE A 203 ? O PHE A 203 AA1 3 4 O ARG A 200 ? O ARG A 200 N SER A 115 ? N SER A 115 AA1 4 5 N PHE A 114 ? N PHE A 114 O VAL A 124 ? O VAL A 124 AA2 1 2 O LEU A 31 ? O LEU A 31 N VAL A 13 ? N VAL A 13 AA2 2 3 N TRP A 14 ? N TRP A 14 O ARG A 53 ? O ARG A 53 AA2 3 4 N ILE A 50 ? N ILE A 50 O ALA A 88 ? O ALA A 88 AA2 4 5 N GLN A 94 ? N GLN A 94 O LYS A 97 ? O LYS A 97 AA2 5 6 N ASP A 98 ? N ASP A 98 O CYS A 193 ? O CYS A 193 AA3 1 2 N TYR A 57 ? N TYR A 57 O ILE A 65 ? O ILE A 65 # _pdbx_entry_details.entry_id 9QXY _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 22 ? ? -171.11 149.98 2 1 ASP A 25 ? ? 56.94 -134.78 3 1 CYS A 71 ? ? -113.32 69.82 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HOH O O N N 137 HOH H1 H N N 138 HOH H2 H N N 139 ILE N N N N 140 ILE CA C N S 141 ILE C C N N 142 ILE O O N N 143 ILE CB C N S 144 ILE CG1 C N N 145 ILE CG2 C N N 146 ILE CD1 C N N 147 ILE OXT O N N 148 ILE H H N N 149 ILE H2 H N N 150 ILE HA H N N 151 ILE HB H N N 152 ILE HG12 H N N 153 ILE HG13 H N N 154 ILE HG21 H N N 155 ILE HG22 H N N 156 ILE HG23 H N N 157 ILE HD11 H N N 158 ILE HD12 H N N 159 ILE HD13 H N N 160 ILE HXT H N N 161 LEU N N N N 162 LEU CA C N S 163 LEU C C N N 164 LEU O O N N 165 LEU CB C N N 166 LEU CG C N N 167 LEU CD1 C N N 168 LEU CD2 C N N 169 LEU OXT O N N 170 LEU H H N N 171 LEU H2 H N N 172 LEU HA H N N 173 LEU HB2 H N N 174 LEU HB3 H N N 175 LEU HG H N N 176 LEU HD11 H N N 177 LEU HD12 H N N 178 LEU HD13 H N N 179 LEU HD21 H N N 180 LEU HD22 H N N 181 LEU HD23 H N N 182 LEU HXT H N N 183 LYS N N N N 184 LYS CA C N S 185 LYS C C N N 186 LYS O O N N 187 LYS CB C N N 188 LYS CG C N N 189 LYS CD C N N 190 LYS CE C N N 191 LYS NZ N N N 192 LYS OXT O N N 193 LYS H H N N 194 LYS H2 H N N 195 LYS HA H N N 196 LYS HB2 H N N 197 LYS HB3 H N N 198 LYS HG2 H N N 199 LYS HG3 H N N 200 LYS HD2 H N N 201 LYS HD3 H N N 202 LYS HE2 H N N 203 LYS HE3 H N N 204 LYS HZ1 H N N 205 LYS HZ2 H N N 206 LYS HZ3 H N N 207 LYS HXT H N N 208 MET N N N N 209 MET CA C N S 210 MET C C N N 211 MET O O N N 212 MET CB C N N 213 MET CG C N N 214 MET SD S N N 215 MET CE C N N 216 MET OXT O N N 217 MET H H N N 218 MET H2 H N N 219 MET HA H N N 220 MET HB2 H N N 221 MET HB3 H N N 222 MET HG2 H N N 223 MET HG3 H N N 224 MET HE1 H N N 225 MET HE2 H N N 226 MET HE3 H N N 227 MET HXT H N N 228 PHE N N N N 229 PHE CA C N S 230 PHE C C N N 231 PHE O O N N 232 PHE CB C N N 233 PHE CG C Y N 234 PHE CD1 C Y N 235 PHE CD2 C Y N 236 PHE CE1 C Y N 237 PHE CE2 C Y N 238 PHE CZ C Y N 239 PHE OXT O N N 240 PHE H H N N 241 PHE H2 H N N 242 PHE HA H N N 243 PHE HB2 H N N 244 PHE HB3 H N N 245 PHE HD1 H N N 246 PHE HD2 H N N 247 PHE HE1 H N N 248 PHE HE2 H N N 249 PHE HZ H N N 250 PHE HXT H N N 251 PRO N N N N 252 PRO CA C N S 253 PRO C C N N 254 PRO O O N N 255 PRO CB C N N 256 PRO CG C N N 257 PRO CD C N N 258 PRO OXT O N N 259 PRO H H N N 260 PRO HA H N N 261 PRO HB2 H N N 262 PRO HB3 H N N 263 PRO HG2 H N N 264 PRO HG3 H N N 265 PRO HD2 H N N 266 PRO HD3 H N N 267 PRO HXT H N N 268 SER N N N N 269 SER CA C N S 270 SER C C N N 271 SER O O N N 272 SER CB C N N 273 SER OG O N N 274 SER OXT O N N 275 SER H H N N 276 SER H2 H N N 277 SER HA H N N 278 SER HB2 H N N 279 SER HB3 H N N 280 SER HG H N N 281 SER HXT H N N 282 THR N N N N 283 THR CA C N S 284 THR C C N N 285 THR O O N N 286 THR CB C N R 287 THR OG1 O N N 288 THR CG2 C N N 289 THR OXT O N N 290 THR H H N N 291 THR H2 H N N 292 THR HA H N N 293 THR HB H N N 294 THR HG1 H N N 295 THR HG21 H N N 296 THR HG22 H N N 297 THR HG23 H N N 298 THR HXT H N N 299 TLA O1 O N N 300 TLA O11 O N N 301 TLA C1 C N N 302 TLA C2 C N R 303 TLA O2 O N N 304 TLA C3 C N R 305 TLA O3 O N N 306 TLA C4 C N N 307 TLA O4 O N N 308 TLA O41 O N N 309 TLA H11 H N N 310 TLA H2 H N N 311 TLA HA H N N 312 TLA H3 H N N 313 TLA HB H N N 314 TLA H41 H N N 315 TRP N N N N 316 TRP CA C N S 317 TRP C C N N 318 TRP O O N N 319 TRP CB C N N 320 TRP CG C Y N 321 TRP CD1 C Y N 322 TRP CD2 C Y N 323 TRP NE1 N Y N 324 TRP CE2 C Y N 325 TRP CE3 C Y N 326 TRP CZ2 C Y N 327 TRP CZ3 C Y N 328 TRP CH2 C Y N 329 TRP OXT O N N 330 TRP H H N N 331 TRP H2 H N N 332 TRP HA H N N 333 TRP HB2 H N N 334 TRP HB3 H N N 335 TRP HD1 H N N 336 TRP HE1 H N N 337 TRP HE3 H N N 338 TRP HZ2 H N N 339 TRP HZ3 H N N 340 TRP HH2 H N N 341 TRP HXT H N N 342 TYR N N N N 343 TYR CA C N S 344 TYR C C N N 345 TYR O O N N 346 TYR CB C N N 347 TYR CG C Y N 348 TYR CD1 C Y N 349 TYR CD2 C Y N 350 TYR CE1 C Y N 351 TYR CE2 C Y N 352 TYR CZ C Y N 353 TYR OH O N N 354 TYR OXT O N N 355 TYR H H N N 356 TYR H2 H N N 357 TYR HA H N N 358 TYR HB2 H N N 359 TYR HB3 H N N 360 TYR HD1 H N N 361 TYR HD2 H N N 362 TYR HE1 H N N 363 TYR HE2 H N N 364 TYR HH H N N 365 TYR HXT H N N 366 VAL N N N N 367 VAL CA C N S 368 VAL C C N N 369 VAL O O N N 370 VAL CB C N N 371 VAL CG1 C N N 372 VAL CG2 C N N 373 VAL OXT O N N 374 VAL H H N N 375 VAL H2 H N N 376 VAL HA H N N 377 VAL HB H N N 378 VAL HG11 H N N 379 VAL HG12 H N N 380 VAL HG13 H N N 381 VAL HG21 H N N 382 VAL HG22 H N N 383 VAL HG23 H N N 384 VAL HXT H N N 385 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HOH O H1 sing N N 129 HOH O H2 sing N N 130 ILE N CA sing N N 131 ILE N H sing N N 132 ILE N H2 sing N N 133 ILE CA C sing N N 134 ILE CA CB sing N N 135 ILE CA HA sing N N 136 ILE C O doub N N 137 ILE C OXT sing N N 138 ILE CB CG1 sing N N 139 ILE CB CG2 sing N N 140 ILE CB HB sing N N 141 ILE CG1 CD1 sing N N 142 ILE CG1 HG12 sing N N 143 ILE CG1 HG13 sing N N 144 ILE CG2 HG21 sing N N 145 ILE CG2 HG22 sing N N 146 ILE CG2 HG23 sing N N 147 ILE CD1 HD11 sing N N 148 ILE CD1 HD12 sing N N 149 ILE CD1 HD13 sing N N 150 ILE OXT HXT sing N N 151 LEU N CA sing N N 152 LEU N H sing N N 153 LEU N H2 sing N N 154 LEU CA C sing N N 155 LEU CA CB sing N N 156 LEU CA HA sing N N 157 LEU C O doub N N 158 LEU C OXT sing N N 159 LEU CB CG sing N N 160 LEU CB HB2 sing N N 161 LEU CB HB3 sing N N 162 LEU CG CD1 sing N N 163 LEU CG CD2 sing N N 164 LEU CG HG sing N N 165 LEU CD1 HD11 sing N N 166 LEU CD1 HD12 sing N N 167 LEU CD1 HD13 sing N N 168 LEU CD2 HD21 sing N N 169 LEU CD2 HD22 sing N N 170 LEU CD2 HD23 sing N N 171 LEU OXT HXT sing N N 172 LYS N CA sing N N 173 LYS N H sing N N 174 LYS N H2 sing N N 175 LYS CA C sing N N 176 LYS CA CB sing N N 177 LYS CA HA sing N N 178 LYS C O doub N N 179 LYS C OXT sing N N 180 LYS CB CG sing N N 181 LYS CB HB2 sing N N 182 LYS CB HB3 sing N N 183 LYS CG CD sing N N 184 LYS CG HG2 sing N N 185 LYS CG HG3 sing N N 186 LYS CD CE sing N N 187 LYS CD HD2 sing N N 188 LYS CD HD3 sing N N 189 LYS CE NZ sing N N 190 LYS CE HE2 sing N N 191 LYS CE HE3 sing N N 192 LYS NZ HZ1 sing N N 193 LYS NZ HZ2 sing N N 194 LYS NZ HZ3 sing N N 195 LYS OXT HXT sing N N 196 MET N CA sing N N 197 MET N H sing N N 198 MET N H2 sing N N 199 MET CA C sing N N 200 MET CA CB sing N N 201 MET CA HA sing N N 202 MET C O doub N N 203 MET C OXT sing N N 204 MET CB CG sing N N 205 MET CB HB2 sing N N 206 MET CB HB3 sing N N 207 MET CG SD sing N N 208 MET CG HG2 sing N N 209 MET CG HG3 sing N N 210 MET SD CE sing N N 211 MET CE HE1 sing N N 212 MET CE HE2 sing N N 213 MET CE HE3 sing N N 214 MET OXT HXT sing N N 215 PHE N CA sing N N 216 PHE N H sing N N 217 PHE N H2 sing N N 218 PHE CA C sing N N 219 PHE CA CB sing N N 220 PHE CA HA sing N N 221 PHE C O doub N N 222 PHE C OXT sing N N 223 PHE CB CG sing N N 224 PHE CB HB2 sing N N 225 PHE CB HB3 sing N N 226 PHE CG CD1 doub Y N 227 PHE CG CD2 sing Y N 228 PHE CD1 CE1 sing Y N 229 PHE CD1 HD1 sing N N 230 PHE CD2 CE2 doub Y N 231 PHE CD2 HD2 sing N N 232 PHE CE1 CZ doub Y N 233 PHE CE1 HE1 sing N N 234 PHE CE2 CZ sing Y N 235 PHE CE2 HE2 sing N N 236 PHE CZ HZ sing N N 237 PHE OXT HXT sing N N 238 PRO N CA sing N N 239 PRO N CD sing N N 240 PRO N H sing N N 241 PRO CA C sing N N 242 PRO CA CB sing N N 243 PRO CA HA sing N N 244 PRO C O doub N N 245 PRO C OXT sing N N 246 PRO CB CG sing N N 247 PRO CB HB2 sing N N 248 PRO CB HB3 sing N N 249 PRO CG CD sing N N 250 PRO CG HG2 sing N N 251 PRO CG HG3 sing N N 252 PRO CD HD2 sing N N 253 PRO CD HD3 sing N N 254 PRO OXT HXT sing N N 255 SER N CA sing N N 256 SER N H sing N N 257 SER N H2 sing N N 258 SER CA C sing N N 259 SER CA CB sing N N 260 SER CA HA sing N N 261 SER C O doub N N 262 SER C OXT sing N N 263 SER CB OG sing N N 264 SER CB HB2 sing N N 265 SER CB HB3 sing N N 266 SER OG HG sing N N 267 SER OXT HXT sing N N 268 THR N CA sing N N 269 THR N H sing N N 270 THR N H2 sing N N 271 THR CA C sing N N 272 THR CA CB sing N N 273 THR CA HA sing N N 274 THR C O doub N N 275 THR C OXT sing N N 276 THR CB OG1 sing N N 277 THR CB CG2 sing N N 278 THR CB HB sing N N 279 THR OG1 HG1 sing N N 280 THR CG2 HG21 sing N N 281 THR CG2 HG22 sing N N 282 THR CG2 HG23 sing N N 283 THR OXT HXT sing N N 284 TLA O1 C1 doub N N 285 TLA O11 C1 sing N N 286 TLA O11 H11 sing N N 287 TLA C1 C2 sing N N 288 TLA C2 O2 sing N N 289 TLA C2 C3 sing N N 290 TLA C2 H2 sing N N 291 TLA O2 HA sing N N 292 TLA C3 O3 sing N N 293 TLA C3 C4 sing N N 294 TLA C3 H3 sing N N 295 TLA O3 HB sing N N 296 TLA C4 O4 doub N N 297 TLA C4 O41 sing N N 298 TLA O41 H41 sing N N 299 TRP N CA sing N N 300 TRP N H sing N N 301 TRP N H2 sing N N 302 TRP CA C sing N N 303 TRP CA CB sing N N 304 TRP CA HA sing N N 305 TRP C O doub N N 306 TRP C OXT sing N N 307 TRP CB CG sing N N 308 TRP CB HB2 sing N N 309 TRP CB HB3 sing N N 310 TRP CG CD1 doub Y N 311 TRP CG CD2 sing Y N 312 TRP CD1 NE1 sing Y N 313 TRP CD1 HD1 sing N N 314 TRP CD2 CE2 doub Y N 315 TRP CD2 CE3 sing Y N 316 TRP NE1 CE2 sing Y N 317 TRP NE1 HE1 sing N N 318 TRP CE2 CZ2 sing Y N 319 TRP CE3 CZ3 doub Y N 320 TRP CE3 HE3 sing N N 321 TRP CZ2 CH2 doub Y N 322 TRP CZ2 HZ2 sing N N 323 TRP CZ3 CH2 sing Y N 324 TRP CZ3 HZ3 sing N N 325 TRP CH2 HH2 sing N N 326 TRP OXT HXT sing N N 327 TYR N CA sing N N 328 TYR N H sing N N 329 TYR N H2 sing N N 330 TYR CA C sing N N 331 TYR CA CB sing N N 332 TYR CA HA sing N N 333 TYR C O doub N N 334 TYR C OXT sing N N 335 TYR CB CG sing N N 336 TYR CB HB2 sing N N 337 TYR CB HB3 sing N N 338 TYR CG CD1 doub Y N 339 TYR CG CD2 sing Y N 340 TYR CD1 CE1 sing Y N 341 TYR CD1 HD1 sing N N 342 TYR CD2 CE2 doub Y N 343 TYR CD2 HD2 sing N N 344 TYR CE1 CZ doub Y N 345 TYR CE1 HE1 sing N N 346 TYR CE2 CZ sing Y N 347 TYR CE2 HE2 sing N N 348 TYR CZ OH sing N N 349 TYR OH HH sing N N 350 TYR OXT HXT sing N N 351 VAL N CA sing N N 352 VAL N H sing N N 353 VAL N H2 sing N N 354 VAL CA C sing N N 355 VAL CA CB sing N N 356 VAL CA HA sing N N 357 VAL C O doub N N 358 VAL C OXT sing N N 359 VAL CB CG1 sing N N 360 VAL CB CG2 sing N N 361 VAL CB HB sing N N 362 VAL CG1 HG11 sing N N 363 VAL CG1 HG12 sing N N 364 VAL CG1 HG13 sing N N 365 VAL CG2 HG21 sing N N 366 VAL CG2 HG22 sing N N 367 VAL CG2 HG23 sing N N 368 VAL OXT HXT sing N N 369 # _pdbx_audit_support.funding_organization 'Biotechnology and Biological Sciences Research Council (BBSRC)' _pdbx_audit_support.country 'United Kingdom' _pdbx_audit_support.grant_number BB/T008768/1 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 7AC3 _pdbx_initial_refinement_model.details ? # _pdbx_serial_crystallography_data_reduction.diffrn_id 1 _pdbx_serial_crystallography_data_reduction.frames_total ? _pdbx_serial_crystallography_data_reduction.xfel_pulse_events ? _pdbx_serial_crystallography_data_reduction.frame_hits ? _pdbx_serial_crystallography_data_reduction.crystal_hits 17659 _pdbx_serial_crystallography_data_reduction.droplet_hits ? _pdbx_serial_crystallography_data_reduction.frames_failed_index ? _pdbx_serial_crystallography_data_reduction.frames_indexed 19053 _pdbx_serial_crystallography_data_reduction.lattices_indexed ? _pdbx_serial_crystallography_data_reduction.xfel_run_numbers ? _pdbx_serial_crystallography_data_reduction.lattices_merged ? # _pdbx_serial_crystallography_sample_delivery.diffrn_id 1 _pdbx_serial_crystallography_sample_delivery.description 'SOS Chip' _pdbx_serial_crystallography_sample_delivery.method 'fixed target' # _atom_sites.entry_id 9QXY _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.016958 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016958 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006547 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.pdbx_scat_Z _atom_type.pdbx_N_electrons _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c C 6 6 2.3103 20.8439 1.0201 10.2075 1.5888 0.5687 0.8651 51.6512 0.2156 H 1 1 0.4930 10.5109 0.3229 26.1257 0.1402 3.1424 0.0408 57.7997 0.0030 N 7 7 12.2220 0.0057 3.1346 9.8933 2.0141 28.9975 1.1672 0.5826 -11.5379 O 8 8 3.0487 13.2771 2.2870 5.7011 1.5464 0.3239 0.8671 32.9089 0.2508 S 16 16 6.9054 1.4679 5.2035 22.2151 1.4379 0.2536 1.5863 56.1720 1.0759 # loop_ # loop_ #