data_9R1M # _entry.id 9R1M # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.414 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9R1M pdb_00009r1m 10.2210/pdb9r1m/pdb WWPDB D_1292147392 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-05-06 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9R1M _pdbx_database_status.recvd_initial_deposition_date 2025-04-27 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email d.n.woolfson@bristol.ac.uk _pdbx_contact_author.name_first Derek _pdbx_contact_author.name_last Woolfson _pdbx_contact_author.name_mi N. _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-0394-3202 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Petrenas, R.' 1 0000-0002-2997-7187 'Ozga, K.' 2 0000-0002-2837-283X 'Chubb, J.J.' 3 0009-0006-2256-7640 'Woolfson, D.N.' 4 0000-0002-0394-3202 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'X-ray crystal structure of a de novo designed lumiflavin binder, sc-apCC-4-LMF-1' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Petrenas, R.' 1 0000-0002-2997-7187 primary 'Ozga, K.' 2 0000-0002-2837-283X primary 'Chubb, J.J.' 3 0009-0006-2256-7640 primary 'Woolfson, D.N.' 4 0000-0002-0394-3202 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description sc-apCC-4-LMF-1 _entity.formula_weight 16758.049 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSSHHHHHHSSGLVPRGSHMQLEEIAQQSEEGAKQGKKIAWQLKKIAQGEPSAQGQLEEIAQQLEEIAKQSKKIAWQLK KIAQGPDSVQLEEIAQQVEEIAKQLKKIAWQLKKIAQGGTSGGQLEEIAQQLEEGAKQAKKTAWQLKKIAQ ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSSGLVPRGSHMQLEEIAQQSEEGAKQGKKIAWQLKKIAQGEPSAQGQLEEIAQQLEEIAKQSKKIAWQLK KIAQGPDSVQLEEIAQQVEEIAKQLKKIAWQLKKIAQGGTSGGQLEEIAQQLEEGAKQAKKTAWQLKKIAQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 LEU n 1 15 VAL n 1 16 PRO n 1 17 ARG n 1 18 GLY n 1 19 SER n 1 20 HIS n 1 21 MET n 1 22 GLN n 1 23 LEU n 1 24 GLU n 1 25 GLU n 1 26 ILE n 1 27 ALA n 1 28 GLN n 1 29 GLN n 1 30 SER n 1 31 GLU n 1 32 GLU n 1 33 GLY n 1 34 ALA n 1 35 LYS n 1 36 GLN n 1 37 GLY n 1 38 LYS n 1 39 LYS n 1 40 ILE n 1 41 ALA n 1 42 TRP n 1 43 GLN n 1 44 LEU n 1 45 LYS n 1 46 LYS n 1 47 ILE n 1 48 ALA n 1 49 GLN n 1 50 GLY n 1 51 GLU n 1 52 PRO n 1 53 SER n 1 54 ALA n 1 55 GLN n 1 56 GLY n 1 57 GLN n 1 58 LEU n 1 59 GLU n 1 60 GLU n 1 61 ILE n 1 62 ALA n 1 63 GLN n 1 64 GLN n 1 65 LEU n 1 66 GLU n 1 67 GLU n 1 68 ILE n 1 69 ALA n 1 70 LYS n 1 71 GLN n 1 72 SER n 1 73 LYS n 1 74 LYS n 1 75 ILE n 1 76 ALA n 1 77 TRP n 1 78 GLN n 1 79 LEU n 1 80 LYS n 1 81 LYS n 1 82 ILE n 1 83 ALA n 1 84 GLN n 1 85 GLY n 1 86 PRO n 1 87 ASP n 1 88 SER n 1 89 VAL n 1 90 GLN n 1 91 LEU n 1 92 GLU n 1 93 GLU n 1 94 ILE n 1 95 ALA n 1 96 GLN n 1 97 GLN n 1 98 VAL n 1 99 GLU n 1 100 GLU n 1 101 ILE n 1 102 ALA n 1 103 LYS n 1 104 GLN n 1 105 LEU n 1 106 LYS n 1 107 LYS n 1 108 ILE n 1 109 ALA n 1 110 TRP n 1 111 GLN n 1 112 LEU n 1 113 LYS n 1 114 LYS n 1 115 ILE n 1 116 ALA n 1 117 GLN n 1 118 GLY n 1 119 GLY n 1 120 THR n 1 121 SER n 1 122 GLY n 1 123 GLY n 1 124 GLN n 1 125 LEU n 1 126 GLU n 1 127 GLU n 1 128 ILE n 1 129 ALA n 1 130 GLN n 1 131 GLN n 1 132 LEU n 1 133 GLU n 1 134 GLU n 1 135 GLY n 1 136 ALA n 1 137 LYS n 1 138 GLN n 1 139 ALA n 1 140 LYS n 1 141 LYS n 1 142 THR n 1 143 ALA n 1 144 TRP n 1 145 GLN n 1 146 LEU n 1 147 LYS n 1 148 LYS n 1 149 ILE n 1 150 ALA n 1 151 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 151 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'synthetic construct' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 32630 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -19 ? ? ? A . n A 1 2 GLY 2 -18 ? ? ? A . n A 1 3 SER 3 -17 ? ? ? A . n A 1 4 SER 4 -16 ? ? ? A . n A 1 5 HIS 5 -15 ? ? ? A . n A 1 6 HIS 6 -14 ? ? ? A . n A 1 7 HIS 7 -13 ? ? ? A . n A 1 8 HIS 8 -12 ? ? ? A . n A 1 9 HIS 9 -11 ? ? ? A . n A 1 10 HIS 10 -10 ? ? ? A . n A 1 11 SER 11 -9 ? ? ? A . n A 1 12 SER 12 -8 ? ? ? A . n A 1 13 GLY 13 -7 ? ? ? A . n A 1 14 LEU 14 -6 ? ? ? A . n A 1 15 VAL 15 -5 ? ? ? A . n A 1 16 PRO 16 -4 ? ? ? A . n A 1 17 ARG 17 -3 ? ? ? A . n A 1 18 GLY 18 -2 ? ? ? A . n A 1 19 SER 19 -1 ? ? ? A . n A 1 20 HIS 20 0 ? ? ? A . n A 1 21 MET 21 1 ? ? ? A . n A 1 22 GLN 22 2 2 GLN GLN A . n A 1 23 LEU 23 3 3 LEU LEU A . n A 1 24 GLU 24 4 4 GLU GLU A . n A 1 25 GLU 25 5 5 GLU GLU A . n A 1 26 ILE 26 6 6 ILE ILE A . n A 1 27 ALA 27 7 7 ALA ALA A . n A 1 28 GLN 28 8 8 GLN GLN A . n A 1 29 GLN 29 9 9 GLN GLN A . n A 1 30 SER 30 10 10 SER SER A . n A 1 31 GLU 31 11 11 GLU GLU A . n A 1 32 GLU 32 12 12 GLU GLU A . n A 1 33 GLY 33 13 13 GLY GLY A . n A 1 34 ALA 34 14 14 ALA ALA A . n A 1 35 LYS 35 15 15 LYS LYS A . n A 1 36 GLN 36 16 16 GLN GLN A . n A 1 37 GLY 37 17 17 GLY GLY A . n A 1 38 LYS 38 18 18 LYS LYS A . n A 1 39 LYS 39 19 19 LYS LYS A . n A 1 40 ILE 40 20 20 ILE ILE A . n A 1 41 ALA 41 21 21 ALA ALA A . n A 1 42 TRP 42 22 22 TRP TRP A . n A 1 43 GLN 43 23 23 GLN GLN A . n A 1 44 LEU 44 24 24 LEU LEU A . n A 1 45 LYS 45 25 25 LYS LYS A . n A 1 46 LYS 46 26 26 LYS LYS A . n A 1 47 ILE 47 27 27 ILE ILE A . n A 1 48 ALA 48 28 28 ALA ALA A . n A 1 49 GLN 49 29 29 GLN GLN A . n A 1 50 GLY 50 30 30 GLY GLY A . n A 1 51 GLU 51 31 31 GLU GLU A . n A 1 52 PRO 52 32 32 PRO PRO A . n A 1 53 SER 53 33 33 SER SER A . n A 1 54 ALA 54 34 34 ALA ALA A . n A 1 55 GLN 55 35 35 GLN GLN A . n A 1 56 GLY 56 36 36 GLY GLY A . n A 1 57 GLN 57 37 37 GLN GLN A . n A 1 58 LEU 58 38 38 LEU LEU A . n A 1 59 GLU 59 39 39 GLU GLU A . n A 1 60 GLU 60 40 40 GLU GLU A . n A 1 61 ILE 61 41 41 ILE ILE A . n A 1 62 ALA 62 42 42 ALA ALA A . n A 1 63 GLN 63 43 43 GLN GLN A . n A 1 64 GLN 64 44 44 GLN GLN A . n A 1 65 LEU 65 45 45 LEU LEU A . n A 1 66 GLU 66 46 46 GLU GLU A . n A 1 67 GLU 67 47 47 GLU GLU A . n A 1 68 ILE 68 48 48 ILE ILE A . n A 1 69 ALA 69 49 49 ALA ALA A . n A 1 70 LYS 70 50 50 LYS LYS A . n A 1 71 GLN 71 51 51 GLN GLN A . n A 1 72 SER 72 52 52 SER SER A . n A 1 73 LYS 73 53 53 LYS LYS A . n A 1 74 LYS 74 54 54 LYS LYS A . n A 1 75 ILE 75 55 55 ILE ILE A . n A 1 76 ALA 76 56 56 ALA ALA A . n A 1 77 TRP 77 57 57 TRP TRP A . n A 1 78 GLN 78 58 58 GLN GLN A . n A 1 79 LEU 79 59 59 LEU LEU A . n A 1 80 LYS 80 60 60 LYS LYS A . n A 1 81 LYS 81 61 61 LYS LYS A . n A 1 82 ILE 82 62 62 ILE ILE A . n A 1 83 ALA 83 63 63 ALA ALA A . n A 1 84 GLN 84 64 64 GLN GLN A . n A 1 85 GLY 85 65 65 GLY GLY A . n A 1 86 PRO 86 66 66 PRO PRO A . n A 1 87 ASP 87 67 67 ASP ASP A . n A 1 88 SER 88 68 68 SER SER A . n A 1 89 VAL 89 69 69 VAL VAL A . n A 1 90 GLN 90 70 70 GLN GLN A . n A 1 91 LEU 91 71 71 LEU LEU A . n A 1 92 GLU 92 72 72 GLU GLU A . n A 1 93 GLU 93 73 73 GLU GLU A . n A 1 94 ILE 94 74 74 ILE ILE A . n A 1 95 ALA 95 75 75 ALA ALA A . n A 1 96 GLN 96 76 76 GLN GLN A . n A 1 97 GLN 97 77 77 GLN GLN A . n A 1 98 VAL 98 78 78 VAL VAL A . n A 1 99 GLU 99 79 79 GLU GLU A . n A 1 100 GLU 100 80 80 GLU GLU A . n A 1 101 ILE 101 81 81 ILE ILE A . n A 1 102 ALA 102 82 82 ALA ALA A . n A 1 103 LYS 103 83 83 LYS LYS A . n A 1 104 GLN 104 84 84 GLN GLN A . n A 1 105 LEU 105 85 85 LEU LEU A . n A 1 106 LYS 106 86 86 LYS LYS A . n A 1 107 LYS 107 87 87 LYS LYS A . n A 1 108 ILE 108 88 88 ILE ILE A . n A 1 109 ALA 109 89 89 ALA ALA A . n A 1 110 TRP 110 90 90 TRP TRP A . n A 1 111 GLN 111 91 91 GLN GLN A . n A 1 112 LEU 112 92 92 LEU LEU A . n A 1 113 LYS 113 93 93 LYS LYS A . n A 1 114 LYS 114 94 94 LYS LYS A . n A 1 115 ILE 115 95 95 ILE ILE A . n A 1 116 ALA 116 96 96 ALA ALA A . n A 1 117 GLN 117 97 97 GLN GLN A . n A 1 118 GLY 118 98 98 GLY GLY A . n A 1 119 GLY 119 99 99 GLY GLY A . n A 1 120 THR 120 100 100 THR THR A . n A 1 121 SER 121 101 101 SER SER A . n A 1 122 GLY 122 102 102 GLY GLY A . n A 1 123 GLY 123 103 103 GLY GLY A . n A 1 124 GLN 124 104 104 GLN GLN A . n A 1 125 LEU 125 105 105 LEU LEU A . n A 1 126 GLU 126 106 106 GLU GLU A . n A 1 127 GLU 127 107 107 GLU GLU A . n A 1 128 ILE 128 108 108 ILE ILE A . n A 1 129 ALA 129 109 109 ALA ALA A . n A 1 130 GLN 130 110 110 GLN GLN A . n A 1 131 GLN 131 111 111 GLN GLN A . n A 1 132 LEU 132 112 112 LEU LEU A . n A 1 133 GLU 133 113 113 GLU GLU A . n A 1 134 GLU 134 114 114 GLU GLU A . n A 1 135 GLY 135 115 115 GLY GLY A . n A 1 136 ALA 136 116 116 ALA ALA A . n A 1 137 LYS 137 117 117 LYS LYS A . n A 1 138 GLN 138 118 118 GLN GLN A . n A 1 139 ALA 139 119 119 ALA ALA A . n A 1 140 LYS 140 120 120 LYS LYS A . n A 1 141 LYS 141 121 121 LYS LYS A . n A 1 142 THR 142 122 122 THR THR A . n A 1 143 ALA 143 123 123 ALA ALA A . n A 1 144 TRP 144 124 124 TRP TRP A . n A 1 145 GLN 145 125 125 GLN GLN A . n A 1 146 LEU 146 126 126 LEU LEU A . n A 1 147 LYS 147 127 127 LYS LYS A . n A 1 148 LYS 148 128 128 LYS LYS A . n A 1 149 ILE 149 129 129 ILE ILE A . n A 1 150 ALA 150 130 130 ALA ALA A . n A 1 151 GLN 151 131 ? ? ? A . n # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLN 2 ? CG ? A GLN 22 CG 2 1 Y 1 A GLN 2 ? CD ? A GLN 22 CD 3 1 Y 1 A GLN 2 ? OE1 ? A GLN 22 OE1 4 1 Y 1 A GLN 2 ? NE2 ? A GLN 22 NE2 5 1 Y 1 A GLU 4 ? CG ? A GLU 24 CG 6 1 Y 1 A GLU 4 ? CD ? A GLU 24 CD 7 1 Y 1 A GLU 4 ? OE1 ? A GLU 24 OE1 8 1 Y 1 A GLU 4 ? OE2 ? A GLU 24 OE2 9 1 Y 1 A GLU 5 ? CG ? A GLU 25 CG 10 1 Y 1 A GLU 5 ? CD ? A GLU 25 CD 11 1 Y 1 A GLU 5 ? OE1 ? A GLU 25 OE1 12 1 Y 1 A GLU 5 ? OE2 ? A GLU 25 OE2 13 1 Y 1 A GLN 8 ? CG ? A GLN 28 CG 14 1 Y 1 A GLN 8 ? CD ? A GLN 28 CD 15 1 Y 1 A GLN 8 ? OE1 ? A GLN 28 OE1 16 1 Y 1 A GLN 8 ? NE2 ? A GLN 28 NE2 17 1 Y 1 A GLU 11 ? CG ? A GLU 31 CG 18 1 Y 1 A GLU 11 ? CD ? A GLU 31 CD 19 1 Y 1 A GLU 11 ? OE1 ? A GLU 31 OE1 20 1 Y 1 A GLU 11 ? OE2 ? A GLU 31 OE2 21 1 Y 1 A GLU 12 ? CG ? A GLU 32 CG 22 1 Y 1 A GLU 12 ? CD ? A GLU 32 CD 23 1 Y 1 A GLU 12 ? OE1 ? A GLU 32 OE1 24 1 Y 1 A GLU 12 ? OE2 ? A GLU 32 OE2 25 1 Y 1 A LYS 15 ? CD ? A LYS 35 CD 26 1 Y 1 A LYS 15 ? CE ? A LYS 35 CE 27 1 Y 1 A LYS 15 ? NZ ? A LYS 35 NZ 28 1 Y 1 A LYS 18 ? CG ? A LYS 38 CG 29 1 Y 1 A LYS 18 ? CD ? A LYS 38 CD 30 1 Y 1 A LYS 18 ? CE ? A LYS 38 CE 31 1 Y 1 A LYS 18 ? NZ ? A LYS 38 NZ 32 1 Y 1 A LYS 19 ? CD ? A LYS 39 CD 33 1 Y 1 A LYS 19 ? CE ? A LYS 39 CE 34 1 Y 1 A LYS 19 ? NZ ? A LYS 39 NZ 35 1 Y 1 A LYS 26 ? CD ? A LYS 46 CD 36 1 Y 1 A LYS 26 ? CE ? A LYS 46 CE 37 1 Y 1 A LYS 26 ? NZ ? A LYS 46 NZ 38 1 Y 1 A GLN 29 ? CG ? A GLN 49 CG 39 1 Y 1 A GLN 29 ? CD ? A GLN 49 CD 40 1 Y 1 A GLN 29 ? OE1 ? A GLN 49 OE1 41 1 Y 1 A GLN 29 ? NE2 ? A GLN 49 NE2 42 1 Y 1 A GLU 31 ? CD ? A GLU 51 CD 43 1 Y 1 A GLU 31 ? OE1 ? A GLU 51 OE1 44 1 Y 1 A GLU 31 ? OE2 ? A GLU 51 OE2 45 1 Y 1 A GLN 35 ? CG ? A GLN 55 CG 46 1 Y 1 A GLN 35 ? CD ? A GLN 55 CD 47 1 Y 1 A GLN 35 ? OE1 ? A GLN 55 OE1 48 1 Y 1 A GLN 35 ? NE2 ? A GLN 55 NE2 49 1 Y 1 A GLU 39 ? CG ? A GLU 59 CG 50 1 Y 1 A GLU 39 ? CD ? A GLU 59 CD 51 1 Y 1 A GLU 39 ? OE1 ? A GLU 59 OE1 52 1 Y 1 A GLU 39 ? OE2 ? A GLU 59 OE2 53 1 Y 1 A GLU 40 ? CG ? A GLU 60 CG 54 1 Y 1 A GLU 40 ? CD ? A GLU 60 CD 55 1 Y 1 A GLU 40 ? OE1 ? A GLU 60 OE1 56 1 Y 1 A GLU 40 ? OE2 ? A GLU 60 OE2 57 1 Y 1 A GLN 43 ? CG ? A GLN 63 CG 58 1 Y 1 A GLN 43 ? CD ? A GLN 63 CD 59 1 Y 1 A GLN 43 ? OE1 ? A GLN 63 OE1 60 1 Y 1 A GLN 43 ? NE2 ? A GLN 63 NE2 61 1 Y 1 A GLU 46 ? CG ? A GLU 66 CG 62 1 Y 1 A GLU 46 ? CD ? A GLU 66 CD 63 1 Y 1 A GLU 46 ? OE1 ? A GLU 66 OE1 64 1 Y 1 A GLU 46 ? OE2 ? A GLU 66 OE2 65 1 Y 1 A GLU 47 ? CG ? A GLU 67 CG 66 1 Y 1 A GLU 47 ? CD ? A GLU 67 CD 67 1 Y 1 A GLU 47 ? OE1 ? A GLU 67 OE1 68 1 Y 1 A GLU 47 ? OE2 ? A GLU 67 OE2 69 1 Y 1 A LYS 53 ? CD ? A LYS 73 CD 70 1 Y 1 A LYS 53 ? CE ? A LYS 73 CE 71 1 Y 1 A LYS 53 ? NZ ? A LYS 73 NZ 72 1 Y 1 A LYS 54 ? CG ? A LYS 74 CG 73 1 Y 1 A LYS 54 ? CD ? A LYS 74 CD 74 1 Y 1 A LYS 54 ? CE ? A LYS 74 CE 75 1 Y 1 A LYS 54 ? NZ ? A LYS 74 NZ 76 1 Y 1 A TRP 57 ? CG ? A TRP 77 CG 77 1 Y 1 A TRP 57 ? CD1 ? A TRP 77 CD1 78 1 Y 1 A TRP 57 ? CD2 ? A TRP 77 CD2 79 1 Y 1 A TRP 57 ? NE1 ? A TRP 77 NE1 80 1 Y 1 A TRP 57 ? CE2 ? A TRP 77 CE2 81 1 Y 1 A TRP 57 ? CE3 ? A TRP 77 CE3 82 1 Y 1 A TRP 57 ? CZ2 ? A TRP 77 CZ2 83 1 Y 1 A TRP 57 ? CZ3 ? A TRP 77 CZ3 84 1 Y 1 A TRP 57 ? CH2 ? A TRP 77 CH2 85 1 Y 1 A LYS 61 ? CG ? A LYS 81 CG 86 1 Y 1 A LYS 61 ? CD ? A LYS 81 CD 87 1 Y 1 A LYS 61 ? CE ? A LYS 81 CE 88 1 Y 1 A LYS 61 ? NZ ? A LYS 81 NZ 89 1 Y 1 A GLN 64 ? CG ? A GLN 84 CG 90 1 Y 1 A GLN 64 ? CD ? A GLN 84 CD 91 1 Y 1 A GLN 64 ? OE1 ? A GLN 84 OE1 92 1 Y 1 A GLN 64 ? NE2 ? A GLN 84 NE2 93 1 Y 1 A ASP 67 ? CG ? A ASP 87 CG 94 1 Y 1 A ASP 67 ? OD1 ? A ASP 87 OD1 95 1 Y 1 A ASP 67 ? OD2 ? A ASP 87 OD2 96 1 Y 1 A SER 68 ? OG ? A SER 88 OG 97 1 Y 1 A VAL 69 ? CG1 ? A VAL 89 CG1 98 1 Y 1 A VAL 69 ? CG2 ? A VAL 89 CG2 99 1 Y 1 A GLN 70 ? CG ? A GLN 90 CG 100 1 Y 1 A GLN 70 ? CD ? A GLN 90 CD 101 1 Y 1 A GLN 70 ? OE1 ? A GLN 90 OE1 102 1 Y 1 A GLN 70 ? NE2 ? A GLN 90 NE2 103 1 Y 1 A GLU 72 ? CG ? A GLU 92 CG 104 1 Y 1 A GLU 72 ? CD ? A GLU 92 CD 105 1 Y 1 A GLU 72 ? OE1 ? A GLU 92 OE1 106 1 Y 1 A GLU 72 ? OE2 ? A GLU 92 OE2 107 1 Y 1 A GLU 73 ? CG ? A GLU 93 CG 108 1 Y 1 A GLU 73 ? CD ? A GLU 93 CD 109 1 Y 1 A GLU 73 ? OE1 ? A GLU 93 OE1 110 1 Y 1 A GLU 73 ? OE2 ? A GLU 93 OE2 111 1 Y 1 A GLN 76 ? CG ? A GLN 96 CG 112 1 Y 1 A GLN 76 ? CD ? A GLN 96 CD 113 1 Y 1 A GLN 76 ? OE1 ? A GLN 96 OE1 114 1 Y 1 A GLN 76 ? NE2 ? A GLN 96 NE2 115 1 Y 1 A GLN 77 ? CD ? A GLN 97 CD 116 1 Y 1 A GLN 77 ? OE1 ? A GLN 97 OE1 117 1 Y 1 A GLN 77 ? NE2 ? A GLN 97 NE2 118 1 Y 1 A GLU 79 ? CG ? A GLU 99 CG 119 1 Y 1 A GLU 79 ? CD ? A GLU 99 CD 120 1 Y 1 A GLU 79 ? OE1 ? A GLU 99 OE1 121 1 Y 1 A GLU 79 ? OE2 ? A GLU 99 OE2 122 1 Y 1 A GLU 80 ? CG ? A GLU 100 CG 123 1 Y 1 A GLU 80 ? CD ? A GLU 100 CD 124 1 Y 1 A GLU 80 ? OE1 ? A GLU 100 OE1 125 1 Y 1 A GLU 80 ? OE2 ? A GLU 100 OE2 126 1 Y 1 A LYS 83 ? CG ? A LYS 103 CG 127 1 Y 1 A LYS 83 ? CD ? A LYS 103 CD 128 1 Y 1 A LYS 83 ? CE ? A LYS 103 CE 129 1 Y 1 A LYS 83 ? NZ ? A LYS 103 NZ 130 1 Y 1 A GLN 84 ? CD ? A GLN 104 CD 131 1 Y 1 A GLN 84 ? OE1 ? A GLN 104 OE1 132 1 Y 1 A GLN 84 ? NE2 ? A GLN 104 NE2 133 1 Y 1 A LYS 86 ? CG ? A LYS 106 CG 134 1 Y 1 A LYS 86 ? CD ? A LYS 106 CD 135 1 Y 1 A LYS 86 ? CE ? A LYS 106 CE 136 1 Y 1 A LYS 86 ? NZ ? A LYS 106 NZ 137 1 Y 1 A LYS 87 ? CG ? A LYS 107 CG 138 1 Y 1 A LYS 87 ? CD ? A LYS 107 CD 139 1 Y 1 A LYS 87 ? CE ? A LYS 107 CE 140 1 Y 1 A LYS 87 ? NZ ? A LYS 107 NZ 141 1 Y 1 A LYS 94 ? CD ? A LYS 114 CD 142 1 Y 1 A LYS 94 ? CE ? A LYS 114 CE 143 1 Y 1 A LYS 94 ? NZ ? A LYS 114 NZ 144 1 Y 1 A THR 100 ? OG1 ? A THR 120 OG1 145 1 Y 1 A THR 100 ? CG2 ? A THR 120 CG2 146 1 Y 1 A GLN 104 ? CG ? A GLN 124 CG 147 1 Y 1 A GLN 104 ? CD ? A GLN 124 CD 148 1 Y 1 A GLN 104 ? OE1 ? A GLN 124 OE1 149 1 Y 1 A GLN 104 ? NE2 ? A GLN 124 NE2 150 1 Y 1 A GLU 106 ? CG ? A GLU 126 CG 151 1 Y 1 A GLU 106 ? CD ? A GLU 126 CD 152 1 Y 1 A GLU 106 ? OE1 ? A GLU 126 OE1 153 1 Y 1 A GLU 106 ? OE2 ? A GLU 126 OE2 154 1 Y 1 A GLU 107 ? CG ? A GLU 127 CG 155 1 Y 1 A GLU 107 ? CD ? A GLU 127 CD 156 1 Y 1 A GLU 107 ? OE1 ? A GLU 127 OE1 157 1 Y 1 A GLU 107 ? OE2 ? A GLU 127 OE2 158 1 Y 1 A GLN 110 ? CG ? A GLN 130 CG 159 1 Y 1 A GLN 110 ? CD ? A GLN 130 CD 160 1 Y 1 A GLN 110 ? OE1 ? A GLN 130 OE1 161 1 Y 1 A GLN 110 ? NE2 ? A GLN 130 NE2 162 1 Y 1 A GLU 113 ? CD ? A GLU 133 CD 163 1 Y 1 A GLU 113 ? OE1 ? A GLU 133 OE1 164 1 Y 1 A GLU 113 ? OE2 ? A GLU 133 OE2 165 1 Y 1 A GLU 114 ? CG ? A GLU 134 CG 166 1 Y 1 A GLU 114 ? CD ? A GLU 134 CD 167 1 Y 1 A GLU 114 ? OE1 ? A GLU 134 OE1 168 1 Y 1 A GLU 114 ? OE2 ? A GLU 134 OE2 169 1 Y 1 A LYS 117 ? CG ? A LYS 137 CG 170 1 Y 1 A LYS 117 ? CD ? A LYS 137 CD 171 1 Y 1 A LYS 117 ? CE ? A LYS 137 CE 172 1 Y 1 A LYS 117 ? NZ ? A LYS 137 NZ 173 1 Y 1 A GLN 118 ? CD ? A GLN 138 CD 174 1 Y 1 A GLN 118 ? OE1 ? A GLN 138 OE1 175 1 Y 1 A GLN 118 ? NE2 ? A GLN 138 NE2 176 1 Y 1 A LYS 121 ? CG ? A LYS 141 CG 177 1 Y 1 A LYS 121 ? CD ? A LYS 141 CD 178 1 Y 1 A LYS 121 ? CE ? A LYS 141 CE 179 1 Y 1 A LYS 121 ? NZ ? A LYS 141 NZ 180 1 Y 1 A LYS 127 ? CD ? A LYS 147 CD 181 1 Y 1 A LYS 127 ? CE ? A LYS 147 CE 182 1 Y 1 A LYS 127 ? NZ ? A LYS 147 NZ 183 1 Y 1 A LYS 128 ? CG ? A LYS 148 CG 184 1 Y 1 A LYS 128 ? CD ? A LYS 148 CD 185 1 Y 1 A LYS 128 ? CE ? A LYS 148 CE 186 1 Y 1 A LYS 128 ? NZ ? A LYS 148 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.20.1_4487 ? 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . ? 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . ? 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . ? 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 100.170 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 9R1M _cell.details ? _cell.formula_units_Z ? _cell.length_a 28.047 _cell.length_a_esd ? _cell.length_b 38.260 _cell.length_b_esd ? _cell.length_c 55.455 _cell.length_c_esd ? _cell.volume 58572.582 _cell.volume_esd ? _cell.Z_PDB 2 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9R1M _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall 'P 2yb' _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9R1M _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.75 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M Potassium nitrate, 20% w/v Polyethylene glycol 3,350' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER2 X CdTe 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2024-12-14 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9999 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I24' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9999 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I24 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate 50.63 _reflns.entry_id 9R1M _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.4 _reflns.d_resolution_low 31.33 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 4572 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.62 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 1.9 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 3.90 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.984 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.4 _reflns_shell.d_res_low 2.486 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.45 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 431 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.612 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 63.97 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9R1M _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.40 _refine.ls_d_res_low 31.33 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 4570 _refine.ls_number_reflns_R_free 235 _refine.ls_number_reflns_R_work 4335 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.64 _refine.ls_percent_reflns_R_free 5.14 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2292 _refine.ls_R_factor_R_free 0.2339 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2289 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 22.8535 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1888 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.40 _refine_hist.d_res_low 31.33 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 821 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 821 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0038 ? 828 ? f_bond_d ? ? ? 'X-RAY DIFFRACTION' ? 0.5377 ? 1130 ? f_angle_d ? ? ? 'X-RAY DIFFRACTION' ? 0.0332 ? 145 ? f_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.0031 ? 144 ? f_plane_restr ? ? ? 'X-RAY DIFFRACTION' ? 3.5010 ? 128 ? f_dihedral_angle_d ? ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.40 3.02 . . 108 2139 98.34 . . . . 0.2801 . . . . . . . . . . . . . . . 0.2677 'X-RAY DIFFRACTION' 3.02 31.33 . . 127 2196 98.94 . . . . 0.2142 . . . . . . . . . . . . . . . 0.2259 # _struct.entry_id 9R1M _struct.title 'X-ray crystal structure of a de novo designed lumiflavin binder, sc-apCC-4-LMF-1' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9R1M _struct_keywords.text 'de novo, coiled-coil, DE NOVO PROTEIN' _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 9R1M _struct_ref.pdbx_db_accession 9R1M _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9R1M _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 151 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 9R1M _struct_ref_seq.db_align_beg -19 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 131 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg -19 _struct_ref_seq.pdbx_auth_seq_align_end 131 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 6380 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLN A 22 ? GLN A 49 ? GLN A 2 GLN A 29 1 ? 28 HELX_P HELX_P2 AA2 ALA A 54 ? ALA A 83 ? ALA A 34 ALA A 63 1 ? 30 HELX_P HELX_P3 AA3 ASP A 87 ? GLN A 117 ? ASP A 67 GLN A 97 1 ? 31 HELX_P HELX_P4 AA4 SER A 121 ? ALA A 150 ? SER A 101 ALA A 130 1 ? 30 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _pdbx_entry_details.entry_id 9R1M _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification N # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id SER _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 101 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -93.15 _pdbx_validate_torsion.psi 59.31 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -x,y+1/2,-z # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 10.3450986831 2.52182405841 7.45540511473 0.750848325417 ? -0.0913565291692 ? -0.0838855393504 ? 0.448121895527 ? 0.127954556487 ? 0.565050123765 ? 4.80797032826 ? 4.0672718444 ? 4.06259508109 ? 10.4403463069 ? 8.27071717544 ? 4.9209821093 ? 0.0299881837102 ? 0.0397433697206 ? 0.0231111859183 ? -1.2129904028 ? -0.115113917319 ? 0.0158390618235 ? -0.450492511723 ? 0.042825621251 ? 0.205101425054 ? 2 'X-RAY DIFFRACTION' ? refined 17.1771663288 -1.12730288855 16.6666638159 0.404367672371 ? 0.0561541633948 ? 0.0924406974725 ? 0.41390277845 ? 0.00911754285824 ? 0.594974324891 ? 5.7813622877 ? 3.49889469444 ? 4.40833890644 ? 7.10193889788 ? 6.62464760556 ? 8.44398901856 ? -0.26778025189 ? 0.717565630084 ? -0.068000097913 ? 0.0214582515061 ? 0.595836191847 ? -0.202194142421 ? 0.342248616157 ? 1.4645200894 ? -0.637500866669 ? 3 'X-RAY DIFFRACTION' ? refined 9.96169953514 -2.36752682103 19.2987551562 0.393822284007 ? -2.07216867474e-05 ? -0.0835617106628 ? 0.290894175146 ? 0.0292782663943 ? 0.594019579177 ? 6.64038759751 ? 3.1731941376 ? 0.941770147359 ? 3.81953987178 ? 3.42071914268 ? 6.27851286581 ? -0.367573705994 ? 0.278243339214 ? 0.00926714539415 ? -1.61949067729 ? 0.390972886128 ? 1.46678311964 ? -1.2681546411 ? 0.0799509338304 ? 0.303809289708 ? 4 'X-RAY DIFFRACTION' ? refined 5.19970405354 1.23525515687 12.1053885271 0.321833305655 ? 0.0743021145518 ? -0.111752316691 ? 0.416090533591 ? -0.0374871575845 ? 0.678793412351 ? 5.70333972786 ? 5.44584571061 ? 2.97505527677 ? 5.78269086585 ? 3.07383893489 ? 8.64878513787 ? -0.242620247329 ? -0.0905854434298 ? 0.0708466859703 ? -1.01354316977 ? -0.318809250576 ? 0.802280999358 ? -0.519602372711 ? -0.116132888377 ? 0.494962075029 ? 5 'X-RAY DIFFRACTION' ? refined 20.4156234156 19.782123237 21.4240443268 1.99965700256 ? -1.31488427243 ? 1.14786255723 ? -1.29076079483 ? 0.932568534154 ? 1.56962837036 ? 1.81635463507 ? -3.66424831255 ? -0.612195531181 ? 7.68355881378 ? 0.939818748247 ? 0.577257161587 ? -0.0685903934864 ? -0.833228024331 ? 0.808370490877 ? 0.862600770543 ? 0.329633391407 ? -1.99910378417 ? 0.423971560655 ? 0.440530197128 ? 0.316563990054 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 A 101 A 102 ? A 129 A 130 ? ? ;chain 'A' and (resid 102 through 130 ) ; 2 'X-RAY DIFFRACTION' 2 A 1 A 2 ? A 30 A 31 ? ? ;chain 'A' and (resid 2 through 31 ) ; 3 'X-RAY DIFFRACTION' 3 A 31 A 32 ? A 62 A 63 ? ? ;chain 'A' and (resid 32 through 63 ) ; 4 'X-RAY DIFFRACTION' 4 A 63 A 64 ? A 95 A 96 ? ? ;chain 'A' and (resid 64 through 96 ) ; 5 'X-RAY DIFFRACTION' 5 A 96 A 97 ? A 100 A 101 ? ? ;chain 'A' and (resid 97 through 101 ) ; # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -19 ? A MET 1 2 1 Y 1 A GLY -18 ? A GLY 2 3 1 Y 1 A SER -17 ? A SER 3 4 1 Y 1 A SER -16 ? A SER 4 5 1 Y 1 A HIS -15 ? A HIS 5 6 1 Y 1 A HIS -14 ? A HIS 6 7 1 Y 1 A HIS -13 ? A HIS 7 8 1 Y 1 A HIS -12 ? A HIS 8 9 1 Y 1 A HIS -11 ? A HIS 9 10 1 Y 1 A HIS -10 ? A HIS 10 11 1 Y 1 A SER -9 ? A SER 11 12 1 Y 1 A SER -8 ? A SER 12 13 1 Y 1 A GLY -7 ? A GLY 13 14 1 Y 1 A LEU -6 ? A LEU 14 15 1 Y 1 A VAL -5 ? A VAL 15 16 1 Y 1 A PRO -4 ? A PRO 16 17 1 Y 1 A ARG -3 ? A ARG 17 18 1 Y 1 A GLY -2 ? A GLY 18 19 1 Y 1 A SER -1 ? A SER 19 20 1 Y 1 A HIS 0 ? A HIS 20 21 1 Y 1 A MET 1 ? A MET 21 22 1 Y 1 A GLN 131 ? A GLN 151 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASP N N N N 41 ASP CA C N S 42 ASP C C N N 43 ASP O O N N 44 ASP CB C N N 45 ASP CG C N N 46 ASP OD1 O N N 47 ASP OD2 O N N 48 ASP OXT O N N 49 ASP H H N N 50 ASP H2 H N N 51 ASP HA H N N 52 ASP HB2 H N N 53 ASP HB3 H N N 54 ASP HD2 H N N 55 ASP HXT H N N 56 GLN N N N N 57 GLN CA C N S 58 GLN C C N N 59 GLN O O N N 60 GLN CB C N N 61 GLN CG C N N 62 GLN CD C N N 63 GLN OE1 O N N 64 GLN NE2 N N N 65 GLN OXT O N N 66 GLN H H N N 67 GLN H2 H N N 68 GLN HA H N N 69 GLN HB2 H N N 70 GLN HB3 H N N 71 GLN HG2 H N N 72 GLN HG3 H N N 73 GLN HE21 H N N 74 GLN HE22 H N N 75 GLN HXT H N N 76 GLU N N N N 77 GLU CA C N S 78 GLU C C N N 79 GLU O O N N 80 GLU CB C N N 81 GLU CG C N N 82 GLU CD C N N 83 GLU OE1 O N N 84 GLU OE2 O N N 85 GLU OXT O N N 86 GLU H H N N 87 GLU H2 H N N 88 GLU HA H N N 89 GLU HB2 H N N 90 GLU HB3 H N N 91 GLU HG2 H N N 92 GLU HG3 H N N 93 GLU HE2 H N N 94 GLU HXT H N N 95 GLY N N N N 96 GLY CA C N N 97 GLY C C N N 98 GLY O O N N 99 GLY OXT O N N 100 GLY H H N N 101 GLY H2 H N N 102 GLY HA2 H N N 103 GLY HA3 H N N 104 GLY HXT H N N 105 HIS N N N N 106 HIS CA C N S 107 HIS C C N N 108 HIS O O N N 109 HIS CB C N N 110 HIS CG C Y N 111 HIS ND1 N Y N 112 HIS CD2 C Y N 113 HIS CE1 C Y N 114 HIS NE2 N Y N 115 HIS OXT O N N 116 HIS H H N N 117 HIS H2 H N N 118 HIS HA H N N 119 HIS HB2 H N N 120 HIS HB3 H N N 121 HIS HD1 H N N 122 HIS HD2 H N N 123 HIS HE1 H N N 124 HIS HE2 H N N 125 HIS HXT H N N 126 ILE N N N N 127 ILE CA C N S 128 ILE C C N N 129 ILE O O N N 130 ILE CB C N S 131 ILE CG1 C N N 132 ILE CG2 C N N 133 ILE CD1 C N N 134 ILE OXT O N N 135 ILE H H N N 136 ILE H2 H N N 137 ILE HA H N N 138 ILE HB H N N 139 ILE HG12 H N N 140 ILE HG13 H N N 141 ILE HG21 H N N 142 ILE HG22 H N N 143 ILE HG23 H N N 144 ILE HD11 H N N 145 ILE HD12 H N N 146 ILE HD13 H N N 147 ILE HXT H N N 148 LEU N N N N 149 LEU CA C N S 150 LEU C C N N 151 LEU O O N N 152 LEU CB C N N 153 LEU CG C N N 154 LEU CD1 C N N 155 LEU CD2 C N N 156 LEU OXT O N N 157 LEU H H N N 158 LEU H2 H N N 159 LEU HA H N N 160 LEU HB2 H N N 161 LEU HB3 H N N 162 LEU HG H N N 163 LEU HD11 H N N 164 LEU HD12 H N N 165 LEU HD13 H N N 166 LEU HD21 H N N 167 LEU HD22 H N N 168 LEU HD23 H N N 169 LEU HXT H N N 170 LYS N N N N 171 LYS CA C N S 172 LYS C C N N 173 LYS O O N N 174 LYS CB C N N 175 LYS CG C N N 176 LYS CD C N N 177 LYS CE C N N 178 LYS NZ N N N 179 LYS OXT O N N 180 LYS H H N N 181 LYS H2 H N N 182 LYS HA H N N 183 LYS HB2 H N N 184 LYS HB3 H N N 185 LYS HG2 H N N 186 LYS HG3 H N N 187 LYS HD2 H N N 188 LYS HD3 H N N 189 LYS HE2 H N N 190 LYS HE3 H N N 191 LYS HZ1 H N N 192 LYS HZ2 H N N 193 LYS HZ3 H N N 194 LYS HXT H N N 195 MET N N N N 196 MET CA C N S 197 MET C C N N 198 MET O O N N 199 MET CB C N N 200 MET CG C N N 201 MET SD S N N 202 MET CE C N N 203 MET OXT O N N 204 MET H H N N 205 MET H2 H N N 206 MET HA H N N 207 MET HB2 H N N 208 MET HB3 H N N 209 MET HG2 H N N 210 MET HG3 H N N 211 MET HE1 H N N 212 MET HE2 H N N 213 MET HE3 H N N 214 MET HXT H N N 215 PRO N N N N 216 PRO CA C N S 217 PRO C C N N 218 PRO O O N N 219 PRO CB C N N 220 PRO CG C N N 221 PRO CD C N N 222 PRO OXT O N N 223 PRO H H N N 224 PRO HA H N N 225 PRO HB2 H N N 226 PRO HB3 H N N 227 PRO HG2 H N N 228 PRO HG3 H N N 229 PRO HD2 H N N 230 PRO HD3 H N N 231 PRO HXT H N N 232 SER N N N N 233 SER CA C N S 234 SER C C N N 235 SER O O N N 236 SER CB C N N 237 SER OG O N N 238 SER OXT O N N 239 SER H H N N 240 SER H2 H N N 241 SER HA H N N 242 SER HB2 H N N 243 SER HB3 H N N 244 SER HG H N N 245 SER HXT H N N 246 THR N N N N 247 THR CA C N S 248 THR C C N N 249 THR O O N N 250 THR CB C N R 251 THR OG1 O N N 252 THR CG2 C N N 253 THR OXT O N N 254 THR H H N N 255 THR H2 H N N 256 THR HA H N N 257 THR HB H N N 258 THR HG1 H N N 259 THR HG21 H N N 260 THR HG22 H N N 261 THR HG23 H N N 262 THR HXT H N N 263 TRP N N N N 264 TRP CA C N S 265 TRP C C N N 266 TRP O O N N 267 TRP CB C N N 268 TRP CG C Y N 269 TRP CD1 C Y N 270 TRP CD2 C Y N 271 TRP NE1 N Y N 272 TRP CE2 C Y N 273 TRP CE3 C Y N 274 TRP CZ2 C Y N 275 TRP CZ3 C Y N 276 TRP CH2 C Y N 277 TRP OXT O N N 278 TRP H H N N 279 TRP H2 H N N 280 TRP HA H N N 281 TRP HB2 H N N 282 TRP HB3 H N N 283 TRP HD1 H N N 284 TRP HE1 H N N 285 TRP HE3 H N N 286 TRP HZ2 H N N 287 TRP HZ3 H N N 288 TRP HH2 H N N 289 TRP HXT H N N 290 VAL N N N N 291 VAL CA C N S 292 VAL C C N N 293 VAL O O N N 294 VAL CB C N N 295 VAL CG1 C N N 296 VAL CG2 C N N 297 VAL OXT O N N 298 VAL H H N N 299 VAL H2 H N N 300 VAL HA H N N 301 VAL HB H N N 302 VAL HG11 H N N 303 VAL HG12 H N N 304 VAL HG13 H N N 305 VAL HG21 H N N 306 VAL HG22 H N N 307 VAL HG23 H N N 308 VAL HXT H N N 309 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASP N CA sing N N 39 ASP N H sing N N 40 ASP N H2 sing N N 41 ASP CA C sing N N 42 ASP CA CB sing N N 43 ASP CA HA sing N N 44 ASP C O doub N N 45 ASP C OXT sing N N 46 ASP CB CG sing N N 47 ASP CB HB2 sing N N 48 ASP CB HB3 sing N N 49 ASP CG OD1 doub N N 50 ASP CG OD2 sing N N 51 ASP OD2 HD2 sing N N 52 ASP OXT HXT sing N N 53 GLN N CA sing N N 54 GLN N H sing N N 55 GLN N H2 sing N N 56 GLN CA C sing N N 57 GLN CA CB sing N N 58 GLN CA HA sing N N 59 GLN C O doub N N 60 GLN C OXT sing N N 61 GLN CB CG sing N N 62 GLN CB HB2 sing N N 63 GLN CB HB3 sing N N 64 GLN CG CD sing N N 65 GLN CG HG2 sing N N 66 GLN CG HG3 sing N N 67 GLN CD OE1 doub N N 68 GLN CD NE2 sing N N 69 GLN NE2 HE21 sing N N 70 GLN NE2 HE22 sing N N 71 GLN OXT HXT sing N N 72 GLU N CA sing N N 73 GLU N H sing N N 74 GLU N H2 sing N N 75 GLU CA C sing N N 76 GLU CA CB sing N N 77 GLU CA HA sing N N 78 GLU C O doub N N 79 GLU C OXT sing N N 80 GLU CB CG sing N N 81 GLU CB HB2 sing N N 82 GLU CB HB3 sing N N 83 GLU CG CD sing N N 84 GLU CG HG2 sing N N 85 GLU CG HG3 sing N N 86 GLU CD OE1 doub N N 87 GLU CD OE2 sing N N 88 GLU OE2 HE2 sing N N 89 GLU OXT HXT sing N N 90 GLY N CA sing N N 91 GLY N H sing N N 92 GLY N H2 sing N N 93 GLY CA C sing N N 94 GLY CA HA2 sing N N 95 GLY CA HA3 sing N N 96 GLY C O doub N N 97 GLY C OXT sing N N 98 GLY OXT HXT sing N N 99 HIS N CA sing N N 100 HIS N H sing N N 101 HIS N H2 sing N N 102 HIS CA C sing N N 103 HIS CA CB sing N N 104 HIS CA HA sing N N 105 HIS C O doub N N 106 HIS C OXT sing N N 107 HIS CB CG sing N N 108 HIS CB HB2 sing N N 109 HIS CB HB3 sing N N 110 HIS CG ND1 sing Y N 111 HIS CG CD2 doub Y N 112 HIS ND1 CE1 doub Y N 113 HIS ND1 HD1 sing N N 114 HIS CD2 NE2 sing Y N 115 HIS CD2 HD2 sing N N 116 HIS CE1 NE2 sing Y N 117 HIS CE1 HE1 sing N N 118 HIS NE2 HE2 sing N N 119 HIS OXT HXT sing N N 120 ILE N CA sing N N 121 ILE N H sing N N 122 ILE N H2 sing N N 123 ILE CA C sing N N 124 ILE CA CB sing N N 125 ILE CA HA sing N N 126 ILE C O doub N N 127 ILE C OXT sing N N 128 ILE CB CG1 sing N N 129 ILE CB CG2 sing N N 130 ILE CB HB sing N N 131 ILE CG1 CD1 sing N N 132 ILE CG1 HG12 sing N N 133 ILE CG1 HG13 sing N N 134 ILE CG2 HG21 sing N N 135 ILE CG2 HG22 sing N N 136 ILE CG2 HG23 sing N N 137 ILE CD1 HD11 sing N N 138 ILE CD1 HD12 sing N N 139 ILE CD1 HD13 sing N N 140 ILE OXT HXT sing N N 141 LEU N CA sing N N 142 LEU N H sing N N 143 LEU N H2 sing N N 144 LEU CA C sing N N 145 LEU CA CB sing N N 146 LEU CA HA sing N N 147 LEU C O doub N N 148 LEU C OXT sing N N 149 LEU CB CG sing N N 150 LEU CB HB2 sing N N 151 LEU CB HB3 sing N N 152 LEU CG CD1 sing N N 153 LEU CG CD2 sing N N 154 LEU CG HG sing N N 155 LEU CD1 HD11 sing N N 156 LEU CD1 HD12 sing N N 157 LEU CD1 HD13 sing N N 158 LEU CD2 HD21 sing N N 159 LEU CD2 HD22 sing N N 160 LEU CD2 HD23 sing N N 161 LEU OXT HXT sing N N 162 LYS N CA sing N N 163 LYS N H sing N N 164 LYS N H2 sing N N 165 LYS CA C sing N N 166 LYS CA CB sing N N 167 LYS CA HA sing N N 168 LYS C O doub N N 169 LYS C OXT sing N N 170 LYS CB CG sing N N 171 LYS CB HB2 sing N N 172 LYS CB HB3 sing N N 173 LYS CG CD sing N N 174 LYS CG HG2 sing N N 175 LYS CG HG3 sing N N 176 LYS CD CE sing N N 177 LYS CD HD2 sing N N 178 LYS CD HD3 sing N N 179 LYS CE NZ sing N N 180 LYS CE HE2 sing N N 181 LYS CE HE3 sing N N 182 LYS NZ HZ1 sing N N 183 LYS NZ HZ2 sing N N 184 LYS NZ HZ3 sing N N 185 LYS OXT HXT sing N N 186 MET N CA sing N N 187 MET N H sing N N 188 MET N H2 sing N N 189 MET CA C sing N N 190 MET CA CB sing N N 191 MET CA HA sing N N 192 MET C O doub N N 193 MET C OXT sing N N 194 MET CB CG sing N N 195 MET CB HB2 sing N N 196 MET CB HB3 sing N N 197 MET CG SD sing N N 198 MET CG HG2 sing N N 199 MET CG HG3 sing N N 200 MET SD CE sing N N 201 MET CE HE1 sing N N 202 MET CE HE2 sing N N 203 MET CE HE3 sing N N 204 MET OXT HXT sing N N 205 PRO N CA sing N N 206 PRO N CD sing N N 207 PRO N H sing N N 208 PRO CA C sing N N 209 PRO CA CB sing N N 210 PRO CA HA sing N N 211 PRO C O doub N N 212 PRO C OXT sing N N 213 PRO CB CG sing N N 214 PRO CB HB2 sing N N 215 PRO CB HB3 sing N N 216 PRO CG CD sing N N 217 PRO CG HG2 sing N N 218 PRO CG HG3 sing N N 219 PRO CD HD2 sing N N 220 PRO CD HD3 sing N N 221 PRO OXT HXT sing N N 222 SER N CA sing N N 223 SER N H sing N N 224 SER N H2 sing N N 225 SER CA C sing N N 226 SER CA CB sing N N 227 SER CA HA sing N N 228 SER C O doub N N 229 SER C OXT sing N N 230 SER CB OG sing N N 231 SER CB HB2 sing N N 232 SER CB HB3 sing N N 233 SER OG HG sing N N 234 SER OXT HXT sing N N 235 THR N CA sing N N 236 THR N H sing N N 237 THR N H2 sing N N 238 THR CA C sing N N 239 THR CA CB sing N N 240 THR CA HA sing N N 241 THR C O doub N N 242 THR C OXT sing N N 243 THR CB OG1 sing N N 244 THR CB CG2 sing N N 245 THR CB HB sing N N 246 THR OG1 HG1 sing N N 247 THR CG2 HG21 sing N N 248 THR CG2 HG22 sing N N 249 THR CG2 HG23 sing N N 250 THR OXT HXT sing N N 251 TRP N CA sing N N 252 TRP N H sing N N 253 TRP N H2 sing N N 254 TRP CA C sing N N 255 TRP CA CB sing N N 256 TRP CA HA sing N N 257 TRP C O doub N N 258 TRP C OXT sing N N 259 TRP CB CG sing N N 260 TRP CB HB2 sing N N 261 TRP CB HB3 sing N N 262 TRP CG CD1 doub Y N 263 TRP CG CD2 sing Y N 264 TRP CD1 NE1 sing Y N 265 TRP CD1 HD1 sing N N 266 TRP CD2 CE2 doub Y N 267 TRP CD2 CE3 sing Y N 268 TRP NE1 CE2 sing Y N 269 TRP NE1 HE1 sing N N 270 TRP CE2 CZ2 sing Y N 271 TRP CE3 CZ3 doub Y N 272 TRP CE3 HE3 sing N N 273 TRP CZ2 CH2 doub Y N 274 TRP CZ2 HZ2 sing N N 275 TRP CZ3 CH2 sing Y N 276 TRP CZ3 HZ3 sing N N 277 TRP CH2 HH2 sing N N 278 TRP OXT HXT sing N N 279 VAL N CA sing N N 280 VAL N H sing N N 281 VAL N H2 sing N N 282 VAL CA C sing N N 283 VAL CA CB sing N N 284 VAL CA HA sing N N 285 VAL C O doub N N 286 VAL C OXT sing N N 287 VAL CB CG1 sing N N 288 VAL CB CG2 sing N N 289 VAL CB HB sing N N 290 VAL CG1 HG11 sing N N 291 VAL CG1 HG12 sing N N 292 VAL CG1 HG13 sing N N 293 VAL CG2 HG21 sing N N 294 VAL CG2 HG22 sing N N 295 VAL CG2 HG23 sing N N 296 VAL OXT HXT sing N N 297 # _pdbx_audit_support.funding_organization 'Biotechnology and Biological Sciences Research Council (BBSRC)' _pdbx_audit_support.country 'United Kingdom' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'in silico model' _pdbx_initial_refinement_model.source_name AlphaFold _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'P 1 21 1' _space_group.name_Hall 'P 2yb' _space_group.IT_number 4 _space_group.crystal_system monoclinic _space_group.id 1 # _atom_sites.entry_id 9R1M _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.035654 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.006396 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.026137 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.018320 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ # loop_ #