data_9RC0 # _entry.id 9RC0 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.410 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9RC0 pdb_00009rc0 10.2210/pdb9rc0/pdb WWPDB D_1292148159 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-03-04 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9RC0 _pdbx_database_status.recvd_initial_deposition_date 2025-05-27 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name PDB _pdbx_database_related.details . _pdbx_database_related.db_id 9RBZ _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email holger.sondermann@cssb-hamburg.de _pdbx_contact_author.name_first Holger _pdbx_contact_author.name_last Sondermann _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-2211-6234 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Font, M.E.' 1 ? 'Sondermann, H.' 2 0000-0003-2211-6234 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title ;Structural analyses uncover protease-adhesin interactions and c-di-GMP-mediated switching of a HD-GYP domain-containing receptor in sulfate-reducing bacteria ; _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Font, M.E.' 1 ? primary 'Karbelkar, A.A.' 2 ? primary 'Lormand, J.D.' 3 ? primary 'Mortensen, S.' 4 ? primary 'Garcia-Garcia, M.J.' 5 ? primary ;O'Toole, G.A. ; 6 ? primary 'Sondermann, H.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'HD domain/sensory box protein' _entity.formula_weight 35692.520 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;TVIDEQKHLLDSINAAMRDPVSLTDASGVYHFVNHAFGEAVGRKPEDVIGLDVAAVFGFDTARRLTRSDATVIGEGKGQV EQETVFLQSRRHVFQIVKTPMFTSESEHPRGVVSAFRDITELVDAQERSRKLVQQTIDAFITAIETKAPYLAGHSRGMSQ FATAIARQMGLGERDVATVETAANLSQVGKIYVPSRLLTKPGALTAEEKAIVEEHVLHARRTLEHIEFDLPILDAIVQMN EHPDGTGYPEHLKGDAIGIHARILAVANAFCAMVRPRSYRPALGVDAVIGVLRKEGGSFDAGVVDALARLLASPAGERLL ESLDVRQG ; _entity_poly.pdbx_seq_one_letter_code_can ;TVIDEQKHLLDSINAAMRDPVSLTDASGVYHFVNHAFGEAVGRKPEDVIGLDVAAVFGFDTARRLTRSDATVIGEGKGQV EQETVFLQSRRHVFQIVKTPMFTSESEHPRGVVSAFRDITELVDAQERSRKLVQQTIDAFITAIETKAPYLAGHSRGMSQ FATAIARQMGLGERDVATVETAANLSQVGKIYVPSRLLTKPGALTAEEKAIVEEHVLHARRTLEHIEFDLPILDAIVQMN EHPDGTGYPEHLKGDAIGIHARILAVANAFCAMVRPRSYRPALGVDAVIGVLRKEGGSFDAGVVDALARLLASPAGERLL ESLDVRQG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 THR n 1 2 VAL n 1 3 ILE n 1 4 ASP n 1 5 GLU n 1 6 GLN n 1 7 LYS n 1 8 HIS n 1 9 LEU n 1 10 LEU n 1 11 ASP n 1 12 SER n 1 13 ILE n 1 14 ASN n 1 15 ALA n 1 16 ALA n 1 17 MET n 1 18 ARG n 1 19 ASP n 1 20 PRO n 1 21 VAL n 1 22 SER n 1 23 LEU n 1 24 THR n 1 25 ASP n 1 26 ALA n 1 27 SER n 1 28 GLY n 1 29 VAL n 1 30 TYR n 1 31 HIS n 1 32 PHE n 1 33 VAL n 1 34 ASN n 1 35 HIS n 1 36 ALA n 1 37 PHE n 1 38 GLY n 1 39 GLU n 1 40 ALA n 1 41 VAL n 1 42 GLY n 1 43 ARG n 1 44 LYS n 1 45 PRO n 1 46 GLU n 1 47 ASP n 1 48 VAL n 1 49 ILE n 1 50 GLY n 1 51 LEU n 1 52 ASP n 1 53 VAL n 1 54 ALA n 1 55 ALA n 1 56 VAL n 1 57 PHE n 1 58 GLY n 1 59 PHE n 1 60 ASP n 1 61 THR n 1 62 ALA n 1 63 ARG n 1 64 ARG n 1 65 LEU n 1 66 THR n 1 67 ARG n 1 68 SER n 1 69 ASP n 1 70 ALA n 1 71 THR n 1 72 VAL n 1 73 ILE n 1 74 GLY n 1 75 GLU n 1 76 GLY n 1 77 LYS n 1 78 GLY n 1 79 GLN n 1 80 VAL n 1 81 GLU n 1 82 GLN n 1 83 GLU n 1 84 THR n 1 85 VAL n 1 86 PHE n 1 87 LEU n 1 88 GLN n 1 89 SER n 1 90 ARG n 1 91 ARG n 1 92 HIS n 1 93 VAL n 1 94 PHE n 1 95 GLN n 1 96 ILE n 1 97 VAL n 1 98 LYS n 1 99 THR n 1 100 PRO n 1 101 MET n 1 102 PHE n 1 103 THR n 1 104 SER n 1 105 GLU n 1 106 SER n 1 107 GLU n 1 108 HIS n 1 109 PRO n 1 110 ARG n 1 111 GLY n 1 112 VAL n 1 113 VAL n 1 114 SER n 1 115 ALA n 1 116 PHE n 1 117 ARG n 1 118 ASP n 1 119 ILE n 1 120 THR n 1 121 GLU n 1 122 LEU n 1 123 VAL n 1 124 ASP n 1 125 ALA n 1 126 GLN n 1 127 GLU n 1 128 ARG n 1 129 SER n 1 130 ARG n 1 131 LYS n 1 132 LEU n 1 133 VAL n 1 134 GLN n 1 135 GLN n 1 136 THR n 1 137 ILE n 1 138 ASP n 1 139 ALA n 1 140 PHE n 1 141 ILE n 1 142 THR n 1 143 ALA n 1 144 ILE n 1 145 GLU n 1 146 THR n 1 147 LYS n 1 148 ALA n 1 149 PRO n 1 150 TYR n 1 151 LEU n 1 152 ALA n 1 153 GLY n 1 154 HIS n 1 155 SER n 1 156 ARG n 1 157 GLY n 1 158 MET n 1 159 SER n 1 160 GLN n 1 161 PHE n 1 162 ALA n 1 163 THR n 1 164 ALA n 1 165 ILE n 1 166 ALA n 1 167 ARG n 1 168 GLN n 1 169 MET n 1 170 GLY n 1 171 LEU n 1 172 GLY n 1 173 GLU n 1 174 ARG n 1 175 ASP n 1 176 VAL n 1 177 ALA n 1 178 THR n 1 179 VAL n 1 180 GLU n 1 181 THR n 1 182 ALA n 1 183 ALA n 1 184 ASN n 1 185 LEU n 1 186 SER n 1 187 GLN n 1 188 VAL n 1 189 GLY n 1 190 LYS n 1 191 ILE n 1 192 TYR n 1 193 VAL n 1 194 PRO n 1 195 SER n 1 196 ARG n 1 197 LEU n 1 198 LEU n 1 199 THR n 1 200 LYS n 1 201 PRO n 1 202 GLY n 1 203 ALA n 1 204 LEU n 1 205 THR n 1 206 ALA n 1 207 GLU n 1 208 GLU n 1 209 LYS n 1 210 ALA n 1 211 ILE n 1 212 VAL n 1 213 GLU n 1 214 GLU n 1 215 HIS n 1 216 VAL n 1 217 LEU n 1 218 HIS n 1 219 ALA n 1 220 ARG n 1 221 ARG n 1 222 THR n 1 223 LEU n 1 224 GLU n 1 225 HIS n 1 226 ILE n 1 227 GLU n 1 228 PHE n 1 229 ASP n 1 230 LEU n 1 231 PRO n 1 232 ILE n 1 233 LEU n 1 234 ASP n 1 235 ALA n 1 236 ILE n 1 237 VAL n 1 238 GLN n 1 239 MET n 1 240 ASN n 1 241 GLU n 1 242 HIS n 1 243 PRO n 1 244 ASP n 1 245 GLY n 1 246 THR n 1 247 GLY n 1 248 TYR n 1 249 PRO n 1 250 GLU n 1 251 HIS n 1 252 LEU n 1 253 LYS n 1 254 GLY n 1 255 ASP n 1 256 ALA n 1 257 ILE n 1 258 GLY n 1 259 ILE n 1 260 HIS n 1 261 ALA n 1 262 ARG n 1 263 ILE n 1 264 LEU n 1 265 ALA n 1 266 VAL n 1 267 ALA n 1 268 ASN n 1 269 ALA n 1 270 PHE n 1 271 CYS n 1 272 ALA n 1 273 MET n 1 274 VAL n 1 275 ARG n 1 276 PRO n 1 277 ARG n 1 278 SER n 1 279 TYR n 1 280 ARG n 1 281 PRO n 1 282 ALA n 1 283 LEU n 1 284 GLY n 1 285 VAL n 1 286 ASP n 1 287 ALA n 1 288 VAL n 1 289 ILE n 1 290 GLY n 1 291 VAL n 1 292 LEU n 1 293 ARG n 1 294 LYS n 1 295 GLU n 1 296 GLY n 1 297 GLY n 1 298 SER n 1 299 PHE n 1 300 ASP n 1 301 ALA n 1 302 GLY n 1 303 VAL n 1 304 VAL n 1 305 ASP n 1 306 ALA n 1 307 LEU n 1 308 ALA n 1 309 ARG n 1 310 LEU n 1 311 LEU n 1 312 ALA n 1 313 SER n 1 314 PRO n 1 315 ALA n 1 316 GLY n 1 317 GLU n 1 318 ARG n 1 319 LEU n 1 320 LEU n 1 321 GLU n 1 322 SER n 1 323 LEU n 1 324 ASP n 1 325 VAL n 1 326 ARG n 1 327 GLN n 1 328 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 328 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene DVU_1020 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Nitratidesulfovibrio vulgaris str. Hildenborough' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 882 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 THR 1 374 374 THR THR A . n A 1 2 VAL 2 375 375 VAL VAL A . n A 1 3 ILE 3 376 376 ILE ILE A . n A 1 4 ASP 4 377 377 ASP ASP A . n A 1 5 GLU 5 378 378 GLU GLU A . n A 1 6 GLN 6 379 379 GLN GLN A . n A 1 7 LYS 7 380 380 LYS LYS A . n A 1 8 HIS 8 381 381 HIS HIS A . n A 1 9 LEU 9 382 382 LEU LEU A . n A 1 10 LEU 10 383 383 LEU LEU A . n A 1 11 ASP 11 384 384 ASP ASP A . n A 1 12 SER 12 385 385 SER SER A . n A 1 13 ILE 13 386 386 ILE ILE A . n A 1 14 ASN 14 387 387 ASN ASN A . n A 1 15 ALA 15 388 388 ALA ALA A . n A 1 16 ALA 16 389 389 ALA ALA A . n A 1 17 MET 17 390 390 MET MET A . n A 1 18 ARG 18 391 391 ARG ARG A . n A 1 19 ASP 19 392 392 ASP ASP A . n A 1 20 PRO 20 393 393 PRO PRO A . n A 1 21 VAL 21 394 394 VAL VAL A . n A 1 22 SER 22 395 395 SER SER A . n A 1 23 LEU 23 396 396 LEU LEU A . n A 1 24 THR 24 397 397 THR THR A . n A 1 25 ASP 25 398 398 ASP ASP A . n A 1 26 ALA 26 399 399 ALA ALA A . n A 1 27 SER 27 400 400 SER SER A . n A 1 28 GLY 28 401 401 GLY GLY A . n A 1 29 VAL 29 402 402 VAL VAL A . n A 1 30 TYR 30 403 403 TYR TYR A . n A 1 31 HIS 31 404 404 HIS HIS A . n A 1 32 PHE 32 405 405 PHE PHE A . n A 1 33 VAL 33 406 406 VAL VAL A . n A 1 34 ASN 34 407 407 ASN ASN A . n A 1 35 HIS 35 408 408 HIS HIS A . n A 1 36 ALA 36 409 409 ALA ALA A . n A 1 37 PHE 37 410 410 PHE PHE A . n A 1 38 GLY 38 411 411 GLY GLY A . n A 1 39 GLU 39 412 412 GLU GLU A . n A 1 40 ALA 40 413 413 ALA ALA A . n A 1 41 VAL 41 414 414 VAL VAL A . n A 1 42 GLY 42 415 415 GLY GLY A . n A 1 43 ARG 43 416 416 ARG ARG A . n A 1 44 LYS 44 417 417 LYS LYS A . n A 1 45 PRO 45 418 418 PRO PRO A . n A 1 46 GLU 46 419 419 GLU GLU A . n A 1 47 ASP 47 420 420 ASP ASP A . n A 1 48 VAL 48 421 421 VAL VAL A . n A 1 49 ILE 49 422 422 ILE ILE A . n A 1 50 GLY 50 423 423 GLY GLY A . n A 1 51 LEU 51 424 424 LEU LEU A . n A 1 52 ASP 52 425 425 ASP ASP A . n A 1 53 VAL 53 426 426 VAL VAL A . n A 1 54 ALA 54 427 427 ALA ALA A . n A 1 55 ALA 55 428 428 ALA ALA A . n A 1 56 VAL 56 429 429 VAL VAL A . n A 1 57 PHE 57 430 430 PHE PHE A . n A 1 58 GLY 58 431 431 GLY GLY A . n A 1 59 PHE 59 432 432 PHE PHE A . n A 1 60 ASP 60 433 433 ASP ASP A . n A 1 61 THR 61 434 434 THR THR A . n A 1 62 ALA 62 435 435 ALA ALA A . n A 1 63 ARG 63 436 436 ARG ARG A . n A 1 64 ARG 64 437 437 ARG ARG A . n A 1 65 LEU 65 438 438 LEU LEU A . n A 1 66 THR 66 439 439 THR THR A . n A 1 67 ARG 67 440 440 ARG ARG A . n A 1 68 SER 68 441 441 SER SER A . n A 1 69 ASP 69 442 442 ASP ASP A . n A 1 70 ALA 70 443 443 ALA ALA A . n A 1 71 THR 71 444 444 THR THR A . n A 1 72 VAL 72 445 445 VAL VAL A . n A 1 73 ILE 73 446 446 ILE ILE A . n A 1 74 GLY 74 447 447 GLY GLY A . n A 1 75 GLU 75 448 448 GLU GLU A . n A 1 76 GLY 76 449 449 GLY GLY A . n A 1 77 LYS 77 450 450 LYS LYS A . n A 1 78 GLY 78 451 451 GLY GLY A . n A 1 79 GLN 79 452 452 GLN GLN A . n A 1 80 VAL 80 453 453 VAL VAL A . n A 1 81 GLU 81 454 454 GLU GLU A . n A 1 82 GLN 82 455 455 GLN GLN A . n A 1 83 GLU 83 456 456 GLU GLU A . n A 1 84 THR 84 457 457 THR THR A . n A 1 85 VAL 85 458 458 VAL VAL A . n A 1 86 PHE 86 459 459 PHE PHE A . n A 1 87 LEU 87 460 460 LEU LEU A . n A 1 88 GLN 88 461 461 GLN GLN A . n A 1 89 SER 89 462 462 SER SER A . n A 1 90 ARG 90 463 463 ARG ARG A . n A 1 91 ARG 91 464 464 ARG ARG A . n A 1 92 HIS 92 465 465 HIS HIS A . n A 1 93 VAL 93 466 466 VAL VAL A . n A 1 94 PHE 94 467 467 PHE PHE A . n A 1 95 GLN 95 468 468 GLN GLN A . n A 1 96 ILE 96 469 469 ILE ILE A . n A 1 97 VAL 97 470 470 VAL VAL A . n A 1 98 LYS 98 471 471 LYS LYS A . n A 1 99 THR 99 472 472 THR THR A . n A 1 100 PRO 100 473 473 PRO PRO A . n A 1 101 MET 101 474 474 MET MET A . n A 1 102 PHE 102 475 ? ? ? A . n A 1 103 THR 103 476 ? ? ? A . n A 1 104 SER 104 477 ? ? ? A . n A 1 105 GLU 105 478 ? ? ? A . n A 1 106 SER 106 479 ? ? ? A . n A 1 107 GLU 107 480 ? ? ? A . n A 1 108 HIS 108 481 ? ? ? A . n A 1 109 PRO 109 482 ? ? ? A . n A 1 110 ARG 110 483 ? ? ? A . n A 1 111 GLY 111 484 ? ? ? A . n A 1 112 VAL 112 485 485 VAL VAL A . n A 1 113 VAL 113 486 486 VAL VAL A . n A 1 114 SER 114 487 487 SER SER A . n A 1 115 ALA 115 488 488 ALA ALA A . n A 1 116 PHE 116 489 489 PHE PHE A . n A 1 117 ARG 117 490 490 ARG ARG A . n A 1 118 ASP 118 491 491 ASP ASP A . n A 1 119 ILE 119 492 492 ILE ILE A . n A 1 120 THR 120 493 493 THR THR A . n A 1 121 GLU 121 494 494 GLU GLU A . n A 1 122 LEU 122 495 495 LEU LEU A . n A 1 123 VAL 123 496 496 VAL VAL A . n A 1 124 ASP 124 497 497 ASP ASP A . n A 1 125 ALA 125 498 498 ALA ALA A . n A 1 126 GLN 126 499 499 GLN GLN A . n A 1 127 GLU 127 500 500 GLU GLU A . n A 1 128 ARG 128 501 501 ARG ARG A . n A 1 129 SER 129 502 502 SER SER A . n A 1 130 ARG 130 503 503 ARG ARG A . n A 1 131 LYS 131 504 504 LYS LYS A . n A 1 132 LEU 132 505 505 LEU LEU A . n A 1 133 VAL 133 506 506 VAL VAL A . n A 1 134 GLN 134 507 507 GLN GLN A . n A 1 135 GLN 135 508 508 GLN GLN A . n A 1 136 THR 136 509 509 THR THR A . n A 1 137 ILE 137 510 510 ILE ILE A . n A 1 138 ASP 138 511 511 ASP ASP A . n A 1 139 ALA 139 512 512 ALA ALA A . n A 1 140 PHE 140 513 513 PHE PHE A . n A 1 141 ILE 141 514 514 ILE ILE A . n A 1 142 THR 142 515 515 THR THR A . n A 1 143 ALA 143 516 516 ALA ALA A . n A 1 144 ILE 144 517 517 ILE ILE A . n A 1 145 GLU 145 518 518 GLU GLU A . n A 1 146 THR 146 519 519 THR THR A . n A 1 147 LYS 147 520 520 LYS LYS A . n A 1 148 ALA 148 521 521 ALA ALA A . n A 1 149 PRO 149 522 522 PRO PRO A . n A 1 150 TYR 150 523 523 TYR TYR A . n A 1 151 LEU 151 524 524 LEU LEU A . n A 1 152 ALA 152 525 525 ALA ALA A . n A 1 153 GLY 153 526 526 GLY GLY A . n A 1 154 HIS 154 527 527 HIS HIS A . n A 1 155 SER 155 528 528 SER SER A . n A 1 156 ARG 156 529 529 ARG ARG A . n A 1 157 GLY 157 530 530 GLY GLY A . n A 1 158 MET 158 531 531 MET MET A . n A 1 159 SER 159 532 532 SER SER A . n A 1 160 GLN 160 533 533 GLN GLN A . n A 1 161 PHE 161 534 534 PHE PHE A . n A 1 162 ALA 162 535 535 ALA ALA A . n A 1 163 THR 163 536 536 THR THR A . n A 1 164 ALA 164 537 537 ALA ALA A . n A 1 165 ILE 165 538 538 ILE ILE A . n A 1 166 ALA 166 539 539 ALA ALA A . n A 1 167 ARG 167 540 540 ARG ARG A . n A 1 168 GLN 168 541 541 GLN GLN A . n A 1 169 MET 169 542 542 MET MET A . n A 1 170 GLY 170 543 543 GLY GLY A . n A 1 171 LEU 171 544 544 LEU LEU A . n A 1 172 GLY 172 545 545 GLY GLY A . n A 1 173 GLU 173 546 546 GLU GLU A . n A 1 174 ARG 174 547 547 ARG ARG A . n A 1 175 ASP 175 548 548 ASP ASP A . n A 1 176 VAL 176 549 549 VAL VAL A . n A 1 177 ALA 177 550 550 ALA ALA A . n A 1 178 THR 178 551 551 THR THR A . n A 1 179 VAL 179 552 552 VAL VAL A . n A 1 180 GLU 180 553 553 GLU GLU A . n A 1 181 THR 181 554 554 THR THR A . n A 1 182 ALA 182 555 555 ALA ALA A . n A 1 183 ALA 183 556 556 ALA ALA A . n A 1 184 ASN 184 557 557 ASN ASN A . n A 1 185 LEU 185 558 558 LEU LEU A . n A 1 186 SER 186 559 559 SER SER A . n A 1 187 GLN 187 560 560 GLN GLN A . n A 1 188 VAL 188 561 561 VAL VAL A . n A 1 189 GLY 189 562 562 GLY GLY A . n A 1 190 LYS 190 563 563 LYS LYS A . n A 1 191 ILE 191 564 564 ILE ILE A . n A 1 192 TYR 192 565 565 TYR TYR A . n A 1 193 VAL 193 566 566 VAL VAL A . n A 1 194 PRO 194 567 567 PRO PRO A . n A 1 195 SER 195 568 568 SER SER A . n A 1 196 ARG 196 569 ? ? ? A . n A 1 197 LEU 197 570 ? ? ? A . n A 1 198 LEU 198 571 ? ? ? A . n A 1 199 THR 199 572 ? ? ? A . n A 1 200 LYS 200 573 ? ? ? A . n A 1 201 PRO 201 574 ? ? ? A . n A 1 202 GLY 202 575 ? ? ? A . n A 1 203 ALA 203 576 ? ? ? A . n A 1 204 LEU 204 577 ? ? ? A . n A 1 205 THR 205 578 ? ? ? A . n A 1 206 ALA 206 579 579 ALA ALA A . n A 1 207 GLU 207 580 580 GLU GLU A . n A 1 208 GLU 208 581 581 GLU GLU A . n A 1 209 LYS 209 582 582 LYS LYS A . n A 1 210 ALA 210 583 583 ALA ALA A . n A 1 211 ILE 211 584 584 ILE ILE A . n A 1 212 VAL 212 585 585 VAL VAL A . n A 1 213 GLU 213 586 586 GLU GLU A . n A 1 214 GLU 214 587 587 GLU GLU A . n A 1 215 HIS 215 588 588 HIS HIS A . n A 1 216 VAL 216 589 589 VAL VAL A . n A 1 217 LEU 217 590 590 LEU LEU A . n A 1 218 HIS 218 591 591 HIS HIS A . n A 1 219 ALA 219 592 592 ALA ALA A . n A 1 220 ARG 220 593 593 ARG ARG A . n A 1 221 ARG 221 594 594 ARG ARG A . n A 1 222 THR 222 595 595 THR THR A . n A 1 223 LEU 223 596 596 LEU LEU A . n A 1 224 GLU 224 597 597 GLU GLU A . n A 1 225 HIS 225 598 598 HIS HIS A . n A 1 226 ILE 226 599 599 ILE ILE A . n A 1 227 GLU 227 600 600 GLU GLU A . n A 1 228 PHE 228 601 601 PHE PHE A . n A 1 229 ASP 229 602 602 ASP ASP A . n A 1 230 LEU 230 603 603 LEU LEU A . n A 1 231 PRO 231 604 604 PRO PRO A . n A 1 232 ILE 232 605 605 ILE ILE A . n A 1 233 LEU 233 606 606 LEU LEU A . n A 1 234 ASP 234 607 607 ASP ASP A . n A 1 235 ALA 235 608 608 ALA ALA A . n A 1 236 ILE 236 609 609 ILE ILE A . n A 1 237 VAL 237 610 610 VAL VAL A . n A 1 238 GLN 238 611 611 GLN GLN A . n A 1 239 MET 239 612 612 MET MET A . n A 1 240 ASN 240 613 613 ASN ASN A . n A 1 241 GLU 241 614 614 GLU GLU A . n A 1 242 HIS 242 615 615 HIS HIS A . n A 1 243 PRO 243 616 616 PRO PRO A . n A 1 244 ASP 244 617 617 ASP ASP A . n A 1 245 GLY 245 618 618 GLY GLY A . n A 1 246 THR 246 619 619 THR THR A . n A 1 247 GLY 247 620 620 GLY GLY A . n A 1 248 TYR 248 621 621 TYR TYR A . n A 1 249 PRO 249 622 622 PRO PRO A . n A 1 250 GLU 250 623 623 GLU GLU A . n A 1 251 HIS 251 624 624 HIS HIS A . n A 1 252 LEU 252 625 625 LEU LEU A . n A 1 253 LYS 253 626 626 LYS LYS A . n A 1 254 GLY 254 627 627 GLY GLY A . n A 1 255 ASP 255 628 628 ASP ASP A . n A 1 256 ALA 256 629 629 ALA ALA A . n A 1 257 ILE 257 630 630 ILE ILE A . n A 1 258 GLY 258 631 631 GLY GLY A . n A 1 259 ILE 259 632 632 ILE ILE A . n A 1 260 HIS 260 633 633 HIS HIS A . n A 1 261 ALA 261 634 634 ALA ALA A . n A 1 262 ARG 262 635 635 ARG ARG A . n A 1 263 ILE 263 636 636 ILE ILE A . n A 1 264 LEU 264 637 637 LEU LEU A . n A 1 265 ALA 265 638 638 ALA ALA A . n A 1 266 VAL 266 639 639 VAL VAL A . n A 1 267 ALA 267 640 640 ALA ALA A . n A 1 268 ASN 268 641 641 ASN ASN A . n A 1 269 ALA 269 642 642 ALA ALA A . n A 1 270 PHE 270 643 643 PHE PHE A . n A 1 271 CYS 271 644 644 CYS CYS A . n A 1 272 ALA 272 645 645 ALA ALA A . n A 1 273 MET 273 646 646 MET MET A . n A 1 274 VAL 274 647 647 VAL VAL A . n A 1 275 ARG 275 648 648 ARG ARG A . n A 1 276 PRO 276 649 649 PRO PRO A . n A 1 277 ARG 277 650 ? ? ? A . n A 1 278 SER 278 651 ? ? ? A . n A 1 279 TYR 279 652 ? ? ? A . n A 1 280 ARG 280 653 ? ? ? A . n A 1 281 PRO 281 654 ? ? ? A . n A 1 282 ALA 282 655 ? ? ? A . n A 1 283 LEU 283 656 ? ? ? A . n A 1 284 GLY 284 657 657 GLY GLY A . n A 1 285 VAL 285 658 658 VAL VAL A . n A 1 286 ASP 286 659 659 ASP ASP A . n A 1 287 ALA 287 660 660 ALA ALA A . n A 1 288 VAL 288 661 661 VAL VAL A . n A 1 289 ILE 289 662 662 ILE ILE A . n A 1 290 GLY 290 663 663 GLY GLY A . n A 1 291 VAL 291 664 664 VAL VAL A . n A 1 292 LEU 292 665 665 LEU LEU A . n A 1 293 ARG 293 666 666 ARG ARG A . n A 1 294 LYS 294 667 667 LYS LYS A . n A 1 295 GLU 295 668 668 GLU GLU A . n A 1 296 GLY 296 669 669 GLY GLY A . n A 1 297 GLY 297 670 670 GLY GLY A . n A 1 298 SER 298 671 671 SER SER A . n A 1 299 PHE 299 672 672 PHE PHE A . n A 1 300 ASP 300 673 673 ASP ASP A . n A 1 301 ALA 301 674 674 ALA ALA A . n A 1 302 GLY 302 675 675 GLY GLY A . n A 1 303 VAL 303 676 676 VAL VAL A . n A 1 304 VAL 304 677 677 VAL VAL A . n A 1 305 ASP 305 678 678 ASP ASP A . n A 1 306 ALA 306 679 679 ALA ALA A . n A 1 307 LEU 307 680 680 LEU LEU A . n A 1 308 ALA 308 681 681 ALA ALA A . n A 1 309 ARG 309 682 682 ARG ARG A . n A 1 310 LEU 310 683 683 LEU LEU A . n A 1 311 LEU 311 684 684 LEU LEU A . n A 1 312 ALA 312 685 685 ALA ALA A . n A 1 313 SER 313 686 686 SER SER A . n A 1 314 PRO 314 687 687 PRO PRO A . n A 1 315 ALA 315 688 688 ALA ALA A . n A 1 316 GLY 316 689 689 GLY GLY A . n A 1 317 GLU 317 690 690 GLU GLU A . n A 1 318 ARG 318 691 691 ARG ARG A . n A 1 319 LEU 319 692 692 LEU LEU A . n A 1 320 LEU 320 693 693 LEU LEU A . n A 1 321 GLU 321 694 694 GLU GLU A . n A 1 322 SER 322 695 695 SER SER A . n A 1 323 LEU 323 696 696 LEU LEU A . n A 1 324 ASP 324 697 ? ? ? A . n A 1 325 VAL 325 698 ? ? ? A . n A 1 326 ARG 326 699 ? ? ? A . n A 1 327 GLN 327 700 ? ? ? A . n A 1 328 GLY 328 701 ? ? ? A . n # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A THR 374 ? OG1 ? A THR 1 OG1 2 1 Y 1 A THR 374 ? CG2 ? A THR 1 CG2 3 1 Y 1 A LEU 460 ? CG ? A LEU 87 CG 4 1 Y 1 A LEU 460 ? CD1 ? A LEU 87 CD1 5 1 Y 1 A LEU 460 ? CD2 ? A LEU 87 CD2 6 1 Y 1 A ARG 501 ? CG ? A ARG 128 CG 7 1 Y 1 A ARG 501 ? CD ? A ARG 128 CD 8 1 Y 1 A ARG 501 ? NE ? A ARG 128 NE 9 1 Y 1 A ARG 501 ? CZ ? A ARG 128 CZ 10 1 Y 1 A ARG 501 ? NH1 ? A ARG 128 NH1 11 1 Y 1 A ARG 501 ? NH2 ? A ARG 128 NH2 12 1 Y 1 A LYS 504 ? CG ? A LYS 131 CG 13 1 Y 1 A LYS 504 ? CD ? A LYS 131 CD 14 1 Y 1 A LYS 504 ? CE ? A LYS 131 CE 15 1 Y 1 A LYS 504 ? NZ ? A LYS 131 NZ 16 1 Y 1 A GLU 580 ? CG ? A GLU 207 CG 17 1 Y 1 A GLU 580 ? CD ? A GLU 207 CD 18 1 Y 1 A GLU 580 ? OE1 ? A GLU 207 OE1 19 1 Y 1 A GLU 580 ? OE2 ? A GLU 207 OE2 20 1 Y 1 A GLU 587 ? CG ? A GLU 214 CG 21 1 Y 1 A GLU 587 ? CD ? A GLU 214 CD 22 1 Y 1 A GLU 587 ? OE1 ? A GLU 214 OE1 23 1 Y 1 A GLU 587 ? OE2 ? A GLU 214 OE2 24 1 Y 1 A HIS 624 ? CG ? A HIS 251 CG 25 1 Y 1 A HIS 624 ? ND1 ? A HIS 251 ND1 26 1 Y 1 A HIS 624 ? CD2 ? A HIS 251 CD2 27 1 Y 1 A HIS 624 ? CE1 ? A HIS 251 CE1 28 1 Y 1 A HIS 624 ? NE2 ? A HIS 251 NE2 29 1 Y 1 A LYS 626 ? CG ? A LYS 253 CG 30 1 Y 1 A LYS 626 ? CD ? A LYS 253 CD 31 1 Y 1 A LYS 626 ? CE ? A LYS 253 CE 32 1 Y 1 A LYS 626 ? NZ ? A LYS 253 NZ 33 1 Y 1 A ARG 682 ? CD ? A ARG 309 CD 34 1 Y 1 A ARG 682 ? NE ? A ARG 309 NE 35 1 Y 1 A ARG 682 ? CZ ? A ARG 309 CZ 36 1 Y 1 A ARG 682 ? NH1 ? A ARG 309 NH1 37 1 Y 1 A ARG 682 ? NH2 ? A ARG 309 NH2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.20.1_4487 ? 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . ? 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? . ? 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . ? 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 9RC0 _cell.details ? _cell.formula_units_Z ? _cell.length_a 120.931 _cell.length_a_esd ? _cell.length_b 120.931 _cell.length_b_esd ? _cell.length_c 98.395 _cell.length_c_esd ? _cell.volume 1246174.758 _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9RC0 _symmetry.cell_setting ? _symmetry.Int_Tables_number 179 _symmetry.space_group_name_Hall 'P 65 2 (x,y,z+1/12)' _symmetry.space_group_name_H-M 'P 65 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9RC0 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.91 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 57.72 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M Hepes (pH 7.5), 10% (w/v) polyethylene glycol 6000, and 5% (v/v) MPD' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER2 X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-09-06 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0332 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PETRA III, DESY BEAMLINE P11' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0332 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline P11 _diffrn_source.pdbx_synchrotron_site 'PETRA III, DESY' # _reflns.B_iso_Wilson_estimate 121.84 _reflns.entry_id 9RC0 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.4 _reflns.d_resolution_low 46.23 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 10703 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.8 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 21.9 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 9.8 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 3.44 _reflns_shell.d_res_low 3.60 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1338 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.520 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 126.70 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9RC0 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.44 _refine.ls_d_res_low 46.23 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 10693 _refine.ls_number_reflns_R_free 1082 _refine.ls_number_reflns_R_work 9611 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.75 _refine.ls_percent_reflns_R_free 10.12 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.3170 _refine.ls_R_factor_R_free 0.3294 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.3155 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 40.3814 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.6706 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 3.44 _refine_hist.d_res_low 46.23 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 2219 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2219 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0038 ? 2251 ? f_bond_d ? ? ? 'X-RAY DIFFRACTION' ? 0.7345 ? 3050 ? f_angle_d ? ? ? 'X-RAY DIFFRACTION' ? 0.0453 ? 361 ? f_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.0063 ? 402 ? f_plane_restr ? ? ? 'X-RAY DIFFRACTION' ? 5.2039 ? 314 ? f_dihedral_angle_d ? ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 3.44 3.60 . . 135 1200 99.40 . . . . 0.4172 . . . . . . . . . . . . . . . 0.4547 'X-RAY DIFFRACTION' 3.60 3.78 . . 136 1212 99.85 . . . . 0.3827 . . . . . . . . . . . . . . . 0.3797 'X-RAY DIFFRACTION' 3.79 4.02 . . 136 1196 100.00 . . . . 0.3852 . . . . . . . . . . . . . . . 0.3948 'X-RAY DIFFRACTION' 4.02 4.33 . . 136 1199 100.00 . . . . 0.3596 . . . . . . . . . . . . . . . 0.3659 'X-RAY DIFFRACTION' 4.33 4.77 . . 136 1194 100.00 . . . . 0.3326 . . . . . . . . . . . . . . . 0.3699 'X-RAY DIFFRACTION' 4.77 5.46 . . 136 1207 100.00 . . . . 0.3449 . . . . . . . . . . . . . . . 0.3436 'X-RAY DIFFRACTION' 5.46 6.87 . . 132 1192 99.03 . . . . 0.3535 . . . . . . . . . . . . . . . 0.3965 'X-RAY DIFFRACTION' 6.89 46.23 . . 135 1211 99.70 . . . . 0.2299 . . . . . . . . . . . . . . . 0.2276 # _struct.entry_id 9RC0 _struct.title 'DvhD, PAS/HD-GYP domains' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9RC0 _struct_keywords.text 'Biofilm regulator, second messenger signaling, transmembrane, SIGNALING PROTEIN' _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q72DA9_NITV2 _struct_ref.pdbx_db_accession Q72DA9 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;TVIDEQKHLLDSINAAMRDPVSLTDASGVYHFVNHAFGEAVGRKPEDVIGLDVAAVFGFDTARRLTRSDATVIGEGKGQV EQETVFLQSRRHVFQIVKTPMFTSESEHPRGVVSAFRDITELVDAQERSRKLVQQTIDAFITAIETKAPYLAGHSRGMSQ FATAIARQMGLGERDVATVETAANLSQVGKIYVPSRLLTKPGALTAEEKAIVEEHVLHARRTLEHIEFDLPILDAIVQMN EHPDGTGYPEHLKGDAIGIHARILAVANAFCAMVRPRSYRPALGVDAVIGVLRKEGGSFDAGVVDALARLLASPAGERLL ESLDVRQG ; _struct_ref.pdbx_align_begin 374 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9RC0 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 328 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q72DA9 _struct_ref_seq.db_align_beg 374 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 701 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 374 _struct_ref_seq.pdbx_auth_seq_align_end 701 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 5050 ? 1 MORE -46 ? 1 'SSA (A^2)' 30130 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 12_544 x,x-y-1,-z-1/6 0.5000000000 0.8660254038 0.0000000000 60.4655000000 0.8660254038 -0.5000000000 0.0000000000 -104.7293181051 0.0000000000 0.0000000000 -1.0000000000 -16.3991666667 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 1 ? MET A 17 ? THR A 374 MET A 390 1 ? 17 HELX_P HELX_P2 AA2 ASN A 34 ? GLY A 42 ? ASN A 407 GLY A 415 1 ? 9 HELX_P HELX_P3 AA3 LYS A 44 ? ILE A 49 ? LYS A 417 ILE A 422 1 ? 6 HELX_P HELX_P4 AA4 ASP A 52 ? GLY A 58 ? ASP A 425 GLY A 431 1 ? 7 HELX_P HELX_P5 AA5 GLY A 58 ? GLU A 75 ? GLY A 431 GLU A 448 1 ? 18 HELX_P HELX_P6 AA6 ILE A 119 ? ALA A 148 ? ILE A 492 ALA A 521 1 ? 30 HELX_P HELX_P7 AA7 PRO A 149 ? ALA A 152 ? PRO A 522 ALA A 525 5 ? 4 HELX_P HELX_P8 AA8 GLY A 153 ? GLY A 170 ? GLY A 526 GLY A 543 1 ? 18 HELX_P HELX_P9 AA9 GLY A 172 ? LEU A 185 ? GLY A 545 LEU A 558 1 ? 14 HELX_P HELX_P10 AB1 SER A 186 ? TYR A 192 ? SER A 559 TYR A 565 5 ? 7 HELX_P HELX_P11 AB2 VAL A 212 ? THR A 222 ? VAL A 585 THR A 595 1 ? 11 HELX_P HELX_P12 AB3 PRO A 231 ? MET A 239 ? PRO A 604 MET A 612 1 ? 9 HELX_P HELX_P13 AB4 LYS A 253 ? ILE A 257 ? LYS A 626 ILE A 630 5 ? 5 HELX_P HELX_P14 AB5 GLY A 258 ? VAL A 274 ? GLY A 631 VAL A 647 1 ? 17 HELX_P HELX_P15 AB6 VAL A 285 ? GLU A 295 ? VAL A 658 GLU A 668 1 ? 11 HELX_P HELX_P16 AB7 ASP A 300 ? SER A 313 ? ASP A 673 SER A 686 1 ? 14 HELX_P HELX_P17 AB8 SER A 313 ? LEU A 319 ? SER A 686 LEU A 692 1 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id TYR _struct_mon_prot_cis.label_seq_id 248 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id TYR _struct_mon_prot_cis.auth_seq_id 621 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 249 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 622 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 8.74 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TYR A 30 ? VAL A 33 ? TYR A 403 VAL A 406 AA1 2 VAL A 21 ? THR A 24 ? VAL A 394 THR A 397 AA1 3 VAL A 113 ? ASP A 118 ? VAL A 486 ASP A 491 AA1 4 HIS A 92 ? THR A 99 ? HIS A 465 THR A 472 AA1 5 GLN A 79 ? VAL A 85 ? GLN A 452 VAL A 458 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O HIS A 31 ? O HIS A 404 N LEU A 23 ? N LEU A 396 AA1 2 3 N SER A 22 ? N SER A 395 O SER A 114 ? O SER A 487 AA1 3 4 O VAL A 113 ? O VAL A 486 N THR A 99 ? N THR A 472 AA1 4 5 O ILE A 96 ? O ILE A 469 N GLU A 81 ? N GLU A 454 # _pdbx_entry_details.entry_id 9RC0 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification N # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 OG1 _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 THR _pdbx_validate_symm_contact.auth_seq_id_1 519 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 OH _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 TYR _pdbx_validate_symm_contact.auth_seq_id_2 565 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 12_544 _pdbx_validate_symm_contact.dist 2.19 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 448 ? ? -86.31 -76.59 2 1 SER A 462 ? ? 54.06 -101.05 3 1 ARG A 463 ? ? 51.91 -132.59 4 1 ARG A 464 ? ? 179.97 120.09 5 1 PRO A 567 ? ? -107.37 -150.53 6 1 ALA A 583 ? ? -61.12 61.92 7 1 LEU A 596 ? ? 57.94 1.66 8 1 GLU A 597 ? ? -68.82 0.07 9 1 GLU A 600 ? ? -67.73 90.47 10 1 ASP A 602 ? ? -75.94 25.39 11 1 THR A 619 ? ? -72.43 41.68 12 1 HIS A 624 ? ? 55.18 75.51 13 1 VAL A 658 ? ? 38.04 78.37 14 1 GLU A 668 ? ? -91.78 52.41 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x-y,x,z+5/6 3 y,-x+y,z+1/6 4 -y,x-y,z+2/3 5 -x+y,-x,z+1/3 6 x-y,-y,-z 7 -x,-x+y,-z+1/3 8 -x,-y,z+1/2 9 y,x,-z+2/3 10 -y,-x,-z+1/6 11 -x+y,y,-z+1/2 12 x,x-y,-z+5/6 # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 74.8428494087 -16.3994285449 -13.0988043928 0.7837216328 ? -0.0160304408482 ? 0.145140170457 ? 0.737143224767 ? 0.231654819319 ? 0.963979352289 ? 5.13495890279 ? 0.335343790466 ? 2.04949160318 ? 7.83346861313 ? -1.19783314701 ? 9.24620723974 ? -0.38951333445 ? 1.1633564748 ? 1.58246243819 ? 0.0210609474596 ? 0.110471425029 ? -0.474546020625 ? -1.06474923682 ? -0.196765148916 ? 0.175331065842 ? 2 'X-RAY DIFFRACTION' ? refined 41.377477569 -34.9158501133 -7.27754265269 0.836384010219 ? -0.117226388046 ? -0.173700394571 ? 1.14977368232 ? 0.0146881121265 ? 0.899118166584 ? 5.28175241682 ? 6.20437414949 ? -3.0149832266 ? 1.72615317751 ? -2.06247921363 ? -1.07774338819 ? -0.530503594935 ? 0.513575298595 ? 0.103099682929 ? -0.327035237515 ? 0.320495632604 ? 0.0632093431597 ? 0.163622899126 ? 0.339149430515 ? 0.0432942770283 ? 3 'X-RAY DIFFRACTION' ? refined 29.5826636246 -32.0849810775 2.81789381666 1.00665590263 ? -0.070963750707 ? 0.292554110978 ? 0.921467265164 ? -0.0511448715724 ? 0.995114259057 ? 6.39664886852 ? 3.64459230732 ? 7.44702475504 ? 7.97173113043 ? 4.50299968831 ? 8.0181301491 ? -0.135957197864 ? 0.0740273299184 ? 0.662980246752 ? -0.0926700363521 ? -0.79600961994 ? 1.12397039738 ? -0.770553123198 ? -0.422808495909 ? 0.747021486253 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 A 1 A 374 ? A 105 A 488 ? ? '(chain A and resid 374:488)' 2 'X-RAY DIFFRACTION' 2 A 106 A 489 ? A 186 A 579 ? ? '(chain A and resid 489:579)' 3 'X-RAY DIFFRACTION' 3 A 187 A 580 ? A 296 A 696 ? ? '(chain A and resid 580:696)' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A PHE 475 ? A PHE 102 2 1 Y 1 A THR 476 ? A THR 103 3 1 Y 1 A SER 477 ? A SER 104 4 1 Y 1 A GLU 478 ? A GLU 105 5 1 Y 1 A SER 479 ? A SER 106 6 1 Y 1 A GLU 480 ? A GLU 107 7 1 Y 1 A HIS 481 ? A HIS 108 8 1 Y 1 A PRO 482 ? A PRO 109 9 1 Y 1 A ARG 483 ? A ARG 110 10 1 Y 1 A GLY 484 ? A GLY 111 11 1 Y 1 A ARG 569 ? A ARG 196 12 1 Y 1 A LEU 570 ? A LEU 197 13 1 Y 1 A LEU 571 ? A LEU 198 14 1 Y 1 A THR 572 ? A THR 199 15 1 Y 1 A LYS 573 ? A LYS 200 16 1 Y 1 A PRO 574 ? A PRO 201 17 1 Y 1 A GLY 575 ? A GLY 202 18 1 Y 1 A ALA 576 ? A ALA 203 19 1 Y 1 A LEU 577 ? A LEU 204 20 1 Y 1 A THR 578 ? A THR 205 21 1 Y 1 A ARG 650 ? A ARG 277 22 1 Y 1 A SER 651 ? A SER 278 23 1 Y 1 A TYR 652 ? A TYR 279 24 1 Y 1 A ARG 653 ? A ARG 280 25 1 Y 1 A PRO 654 ? A PRO 281 26 1 Y 1 A ALA 655 ? A ALA 282 27 1 Y 1 A LEU 656 ? A LEU 283 28 1 Y 1 A ASP 697 ? A ASP 324 29 1 Y 1 A VAL 698 ? A VAL 325 30 1 Y 1 A ARG 699 ? A ARG 326 31 1 Y 1 A GLN 700 ? A GLN 327 32 1 Y 1 A GLY 701 ? A GLY 328 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TYR N N N N 318 TYR CA C N S 319 TYR C C N N 320 TYR O O N N 321 TYR CB C N N 322 TYR CG C Y N 323 TYR CD1 C Y N 324 TYR CD2 C Y N 325 TYR CE1 C Y N 326 TYR CE2 C Y N 327 TYR CZ C Y N 328 TYR OH O N N 329 TYR OXT O N N 330 TYR H H N N 331 TYR H2 H N N 332 TYR HA H N N 333 TYR HB2 H N N 334 TYR HB3 H N N 335 TYR HD1 H N N 336 TYR HD2 H N N 337 TYR HE1 H N N 338 TYR HE2 H N N 339 TYR HH H N N 340 TYR HXT H N N 341 VAL N N N N 342 VAL CA C N S 343 VAL C C N N 344 VAL O O N N 345 VAL CB C N N 346 VAL CG1 C N N 347 VAL CG2 C N N 348 VAL OXT O N N 349 VAL H H N N 350 VAL H2 H N N 351 VAL HA H N N 352 VAL HB H N N 353 VAL HG11 H N N 354 VAL HG12 H N N 355 VAL HG13 H N N 356 VAL HG21 H N N 357 VAL HG22 H N N 358 VAL HG23 H N N 359 VAL HXT H N N 360 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TYR N CA sing N N 304 TYR N H sing N N 305 TYR N H2 sing N N 306 TYR CA C sing N N 307 TYR CA CB sing N N 308 TYR CA HA sing N N 309 TYR C O doub N N 310 TYR C OXT sing N N 311 TYR CB CG sing N N 312 TYR CB HB2 sing N N 313 TYR CB HB3 sing N N 314 TYR CG CD1 doub Y N 315 TYR CG CD2 sing Y N 316 TYR CD1 CE1 sing Y N 317 TYR CD1 HD1 sing N N 318 TYR CD2 CE2 doub Y N 319 TYR CD2 HD2 sing N N 320 TYR CE1 CZ doub Y N 321 TYR CE1 HE1 sing N N 322 TYR CE2 CZ sing Y N 323 TYR CE2 HE2 sing N N 324 TYR CZ OH sing N N 325 TYR OH HH sing N N 326 TYR OXT HXT sing N N 327 VAL N CA sing N N 328 VAL N H sing N N 329 VAL N H2 sing N N 330 VAL CA C sing N N 331 VAL CA CB sing N N 332 VAL CA HA sing N N 333 VAL C O doub N N 334 VAL C OXT sing N N 335 VAL CB CG1 sing N N 336 VAL CB CG2 sing N N 337 VAL CB HB sing N N 338 VAL CG1 HG11 sing N N 339 VAL CG1 HG12 sing N N 340 VAL CG1 HG13 sing N N 341 VAL CG2 HG21 sing N N 342 VAL CG2 HG22 sing N N 343 VAL CG2 HG23 sing N N 344 VAL OXT HXT sing N N 345 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number 1R01AI168017 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'in silico model' _pdbx_initial_refinement_model.source_name AlphaFold _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'P 65 2 2' _space_group.name_Hall 'P 65 2 (x,y,z+1/12)' _space_group.IT_number 179 _space_group.crystal_system hexagonal _space_group.id 1 # _atom_sites.entry_id 9RC0 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.008269 _atom_sites.fract_transf_matrix[1][2] 0.004774 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009548 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010163 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 5.96793 ? ? ? 14.89577 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 6.96715 ? ? ? 11.43723 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 7.96527 ? ? ? 9.05267 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O1- ? ? 8.95260 ? ? ? 12.67477 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 15.91112 ? ? ? 10.84690 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ # loop_ #