data_9RMD # _entry.id 9RMD # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.415 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9RMD pdb_00009rmd 10.2210/pdb9rmd/pdb WWPDB D_1292148645 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-06-17 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9RMD _pdbx_database_status.recvd_initial_deposition_date 2025-06-18 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email Sebastian.Glatt@vetmeduni.ac.at _pdbx_contact_author.name_first Sebastian _pdbx_contact_author.name_last Glatt _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-2815-7133 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Krutyholowa, R.' 1 0000-0002-8200-5627 'Glatt, S.' 2 0000-0003-2815-7133 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'EMBO reports' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'The EF-hand domain of MINDY3 is a ubiquitin and RAD23 UBL-binding domain' _citation.year 2026 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s44319-026-00825-1 _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Krutyholowa, R.' 1 0000-0002-8200-5627 primary 'Glatt, S.' 2 0000-0003-2815-7133 primary 'Kulathu, Y.' 3 0000-0002-3274-1642 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Ubiquitin carboxyl-terminal hydrolase MINDY-3' 49911.469 1 3.4.19.12 ? ? ;The N-ter "AMA" originates from TEV-cleavage site. No other alteration to the sequence was made. ; 2 water nat water 18.015 14 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Dermal papilla-derived protein 5,Deubiquitinating enzyme MINDY-3,Protein CARP' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;AMASELTKELMELVWGTKSSPGLSDTIFCRWTQGFVFSESEGSALEQFEGGPCAVIAPVQAFLLKKLLFSSEKSSWRDCS EEEQKELLCHTLCDILESACCDHSGSYCLVSWLRGKTTEETASISGSPAESSCQVEHSSALAVEELGFERFHALIQKRSF RSLPELKDAVLDQYSMWGNKFGVLLFLYSVLLTKGIENIKNEIEDASEPLIDPVYGHGSQSLINLLLTGHAVSNVWDGDR ECSGMKLLGIHEQAAVGFLTLMEALRYCKVGSYLKSPKFPIWIVGSETHLTVFFAKDMALVAPEAPSEQARRVFQTYDPE DNGFIPDSLLEDVMKALDLVSDPEYINLMKNKLDPEGLGIILLGPFLQEFFPDQGSSGPESFTVYHYNGLKQSNYNEKVM YVEGTAVVMGFEDPMLQTDDTPIKRCLQTKWPYIELLWTTDRSPSLN ; _entity_poly.pdbx_seq_one_letter_code_can ;AMASELTKELMELVWGTKSSPGLSDTIFCRWTQGFVFSESEGSALEQFEGGPCAVIAPVQAFLLKKLLFSSEKSSWRDCS EEEQKELLCHTLCDILESACCDHSGSYCLVSWLRGKTTEETASISGSPAESSCQVEHSSALAVEELGFERFHALIQKRSF RSLPELKDAVLDQYSMWGNKFGVLLFLYSVLLTKGIENIKNEIEDASEPLIDPVYGHGSQSLINLLLTGHAVSNVWDGDR ECSGMKLLGIHEQAAVGFLTLMEALRYCKVGSYLKSPKFPIWIVGSETHLTVFFAKDMALVAPEAPSEQARRVFQTYDPE DNGFIPDSLLEDVMKALDLVSDPEYINLMKNKLDPEGLGIILLGPFLQEFFPDQGSSGPESFTVYHYNGLKQSNYNEKVM YVEGTAVVMGFEDPMLQTDDTPIKRCLQTKWPYIELLWTTDRSPSLN ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 MET n 1 3 ALA n 1 4 SER n 1 5 GLU n 1 6 LEU n 1 7 THR n 1 8 LYS n 1 9 GLU n 1 10 LEU n 1 11 MET n 1 12 GLU n 1 13 LEU n 1 14 VAL n 1 15 TRP n 1 16 GLY n 1 17 THR n 1 18 LYS n 1 19 SER n 1 20 SER n 1 21 PRO n 1 22 GLY n 1 23 LEU n 1 24 SER n 1 25 ASP n 1 26 THR n 1 27 ILE n 1 28 PHE n 1 29 CYS n 1 30 ARG n 1 31 TRP n 1 32 THR n 1 33 GLN n 1 34 GLY n 1 35 PHE n 1 36 VAL n 1 37 PHE n 1 38 SER n 1 39 GLU n 1 40 SER n 1 41 GLU n 1 42 GLY n 1 43 SER n 1 44 ALA n 1 45 LEU n 1 46 GLU n 1 47 GLN n 1 48 PHE n 1 49 GLU n 1 50 GLY n 1 51 GLY n 1 52 PRO n 1 53 CYS n 1 54 ALA n 1 55 VAL n 1 56 ILE n 1 57 ALA n 1 58 PRO n 1 59 VAL n 1 60 GLN n 1 61 ALA n 1 62 PHE n 1 63 LEU n 1 64 LEU n 1 65 LYS n 1 66 LYS n 1 67 LEU n 1 68 LEU n 1 69 PHE n 1 70 SER n 1 71 SER n 1 72 GLU n 1 73 LYS n 1 74 SER n 1 75 SER n 1 76 TRP n 1 77 ARG n 1 78 ASP n 1 79 CYS n 1 80 SER n 1 81 GLU n 1 82 GLU n 1 83 GLU n 1 84 GLN n 1 85 LYS n 1 86 GLU n 1 87 LEU n 1 88 LEU n 1 89 CYS n 1 90 HIS n 1 91 THR n 1 92 LEU n 1 93 CYS n 1 94 ASP n 1 95 ILE n 1 96 LEU n 1 97 GLU n 1 98 SER n 1 99 ALA n 1 100 CYS n 1 101 CYS n 1 102 ASP n 1 103 HIS n 1 104 SER n 1 105 GLY n 1 106 SER n 1 107 TYR n 1 108 CYS n 1 109 LEU n 1 110 VAL n 1 111 SER n 1 112 TRP n 1 113 LEU n 1 114 ARG n 1 115 GLY n 1 116 LYS n 1 117 THR n 1 118 THR n 1 119 GLU n 1 120 GLU n 1 121 THR n 1 122 ALA n 1 123 SER n 1 124 ILE n 1 125 SER n 1 126 GLY n 1 127 SER n 1 128 PRO n 1 129 ALA n 1 130 GLU n 1 131 SER n 1 132 SER n 1 133 CYS n 1 134 GLN n 1 135 VAL n 1 136 GLU n 1 137 HIS n 1 138 SER n 1 139 SER n 1 140 ALA n 1 141 LEU n 1 142 ALA n 1 143 VAL n 1 144 GLU n 1 145 GLU n 1 146 LEU n 1 147 GLY n 1 148 PHE n 1 149 GLU n 1 150 ARG n 1 151 PHE n 1 152 HIS n 1 153 ALA n 1 154 LEU n 1 155 ILE n 1 156 GLN n 1 157 LYS n 1 158 ARG n 1 159 SER n 1 160 PHE n 1 161 ARG n 1 162 SER n 1 163 LEU n 1 164 PRO n 1 165 GLU n 1 166 LEU n 1 167 LYS n 1 168 ASP n 1 169 ALA n 1 170 VAL n 1 171 LEU n 1 172 ASP n 1 173 GLN n 1 174 TYR n 1 175 SER n 1 176 MET n 1 177 TRP n 1 178 GLY n 1 179 ASN n 1 180 LYS n 1 181 PHE n 1 182 GLY n 1 183 VAL n 1 184 LEU n 1 185 LEU n 1 186 PHE n 1 187 LEU n 1 188 TYR n 1 189 SER n 1 190 VAL n 1 191 LEU n 1 192 LEU n 1 193 THR n 1 194 LYS n 1 195 GLY n 1 196 ILE n 1 197 GLU n 1 198 ASN n 1 199 ILE n 1 200 LYS n 1 201 ASN n 1 202 GLU n 1 203 ILE n 1 204 GLU n 1 205 ASP n 1 206 ALA n 1 207 SER n 1 208 GLU n 1 209 PRO n 1 210 LEU n 1 211 ILE n 1 212 ASP n 1 213 PRO n 1 214 VAL n 1 215 TYR n 1 216 GLY n 1 217 HIS n 1 218 GLY n 1 219 SER n 1 220 GLN n 1 221 SER n 1 222 LEU n 1 223 ILE n 1 224 ASN n 1 225 LEU n 1 226 LEU n 1 227 LEU n 1 228 THR n 1 229 GLY n 1 230 HIS n 1 231 ALA n 1 232 VAL n 1 233 SER n 1 234 ASN n 1 235 VAL n 1 236 TRP n 1 237 ASP n 1 238 GLY n 1 239 ASP n 1 240 ARG n 1 241 GLU n 1 242 CYS n 1 243 SER n 1 244 GLY n 1 245 MET n 1 246 LYS n 1 247 LEU n 1 248 LEU n 1 249 GLY n 1 250 ILE n 1 251 HIS n 1 252 GLU n 1 253 GLN n 1 254 ALA n 1 255 ALA n 1 256 VAL n 1 257 GLY n 1 258 PHE n 1 259 LEU n 1 260 THR n 1 261 LEU n 1 262 MET n 1 263 GLU n 1 264 ALA n 1 265 LEU n 1 266 ARG n 1 267 TYR n 1 268 CYS n 1 269 LYS n 1 270 VAL n 1 271 GLY n 1 272 SER n 1 273 TYR n 1 274 LEU n 1 275 LYS n 1 276 SER n 1 277 PRO n 1 278 LYS n 1 279 PHE n 1 280 PRO n 1 281 ILE n 1 282 TRP n 1 283 ILE n 1 284 VAL n 1 285 GLY n 1 286 SER n 1 287 GLU n 1 288 THR n 1 289 HIS n 1 290 LEU n 1 291 THR n 1 292 VAL n 1 293 PHE n 1 294 PHE n 1 295 ALA n 1 296 LYS n 1 297 ASP n 1 298 MET n 1 299 ALA n 1 300 LEU n 1 301 VAL n 1 302 ALA n 1 303 PRO n 1 304 GLU n 1 305 ALA n 1 306 PRO n 1 307 SER n 1 308 GLU n 1 309 GLN n 1 310 ALA n 1 311 ARG n 1 312 ARG n 1 313 VAL n 1 314 PHE n 1 315 GLN n 1 316 THR n 1 317 TYR n 1 318 ASP n 1 319 PRO n 1 320 GLU n 1 321 ASP n 1 322 ASN n 1 323 GLY n 1 324 PHE n 1 325 ILE n 1 326 PRO n 1 327 ASP n 1 328 SER n 1 329 LEU n 1 330 LEU n 1 331 GLU n 1 332 ASP n 1 333 VAL n 1 334 MET n 1 335 LYS n 1 336 ALA n 1 337 LEU n 1 338 ASP n 1 339 LEU n 1 340 VAL n 1 341 SER n 1 342 ASP n 1 343 PRO n 1 344 GLU n 1 345 TYR n 1 346 ILE n 1 347 ASN n 1 348 LEU n 1 349 MET n 1 350 LYS n 1 351 ASN n 1 352 LYS n 1 353 LEU n 1 354 ASP n 1 355 PRO n 1 356 GLU n 1 357 GLY n 1 358 LEU n 1 359 GLY n 1 360 ILE n 1 361 ILE n 1 362 LEU n 1 363 LEU n 1 364 GLY n 1 365 PRO n 1 366 PHE n 1 367 LEU n 1 368 GLN n 1 369 GLU n 1 370 PHE n 1 371 PHE n 1 372 PRO n 1 373 ASP n 1 374 GLN n 1 375 GLY n 1 376 SER n 1 377 SER n 1 378 GLY n 1 379 PRO n 1 380 GLU n 1 381 SER n 1 382 PHE n 1 383 THR n 1 384 VAL n 1 385 TYR n 1 386 HIS n 1 387 TYR n 1 388 ASN n 1 389 GLY n 1 390 LEU n 1 391 LYS n 1 392 GLN n 1 393 SER n 1 394 ASN n 1 395 TYR n 1 396 ASN n 1 397 GLU n 1 398 LYS n 1 399 VAL n 1 400 MET n 1 401 TYR n 1 402 VAL n 1 403 GLU n 1 404 GLY n 1 405 THR n 1 406 ALA n 1 407 VAL n 1 408 VAL n 1 409 MET n 1 410 GLY n 1 411 PHE n 1 412 GLU n 1 413 ASP n 1 414 PRO n 1 415 MET n 1 416 LEU n 1 417 GLN n 1 418 THR n 1 419 ASP n 1 420 ASP n 1 421 THR n 1 422 PRO n 1 423 ILE n 1 424 LYS n 1 425 ARG n 1 426 CYS n 1 427 LEU n 1 428 GLN n 1 429 THR n 1 430 LYS n 1 431 TRP n 1 432 PRO n 1 433 TYR n 1 434 ILE n 1 435 GLU n 1 436 LEU n 1 437 LEU n 1 438 TRP n 1 439 THR n 1 440 THR n 1 441 ASP n 1 442 ARG n 1 443 SER n 1 444 PRO n 1 445 SER n 1 446 LEU n 1 447 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 447 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'MINDY3, C10orf97, CARP, DERP5, FAM188A, MSTP126, My042' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ;Escherichia coli 'BL21-Gold(DE3)pLysS AG' ; _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 866768 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain pRARE _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 -1 -1 ALA ALA A . n A 1 2 MET 2 0 0 MET MET A . n A 1 3 ALA 3 1 1 ALA ALA A . n A 1 4 SER 4 2 2 SER SER A . n A 1 5 GLU 5 3 3 GLU GLU A . n A 1 6 LEU 6 4 4 LEU LEU A . n A 1 7 THR 7 5 5 THR THR A . n A 1 8 LYS 8 6 6 LYS LYS A . n A 1 9 GLU 9 7 7 GLU GLU A . n A 1 10 LEU 10 8 8 LEU LEU A . n A 1 11 MET 11 9 9 MET MET A . n A 1 12 GLU 12 10 10 GLU GLU A . n A 1 13 LEU 13 11 11 LEU LEU A . n A 1 14 VAL 14 12 12 VAL VAL A . n A 1 15 TRP 15 13 13 TRP TRP A . n A 1 16 GLY 16 14 14 GLY GLY A . n A 1 17 THR 17 15 15 THR THR A . n A 1 18 LYS 18 16 16 LYS LYS A . n A 1 19 SER 19 17 17 SER SER A . n A 1 20 SER 20 18 18 SER SER A . n A 1 21 PRO 21 19 19 PRO PRO A . n A 1 22 GLY 22 20 20 GLY GLY A . n A 1 23 LEU 23 21 21 LEU LEU A . n A 1 24 SER 24 22 22 SER SER A . n A 1 25 ASP 25 23 23 ASP ASP A . n A 1 26 THR 26 24 24 THR THR A . n A 1 27 ILE 27 25 25 ILE ILE A . n A 1 28 PHE 28 26 26 PHE PHE A . n A 1 29 CYS 29 27 27 CYS CYS A . n A 1 30 ARG 30 28 28 ARG ARG A . n A 1 31 TRP 31 29 29 TRP TRP A . n A 1 32 THR 32 30 30 THR THR A . n A 1 33 GLN 33 31 31 GLN GLN A . n A 1 34 GLY 34 32 32 GLY GLY A . n A 1 35 PHE 35 33 33 PHE PHE A . n A 1 36 VAL 36 34 34 VAL VAL A . n A 1 37 PHE 37 35 35 PHE PHE A . n A 1 38 SER 38 36 36 SER SER A . n A 1 39 GLU 39 37 37 GLU GLU A . n A 1 40 SER 40 38 38 SER SER A . n A 1 41 GLU 41 39 39 GLU GLU A . n A 1 42 GLY 42 40 40 GLY GLY A . n A 1 43 SER 43 41 41 SER SER A . n A 1 44 ALA 44 42 42 ALA ALA A . n A 1 45 LEU 45 43 43 LEU LEU A . n A 1 46 GLU 46 44 44 GLU GLU A . n A 1 47 GLN 47 45 45 GLN GLN A . n A 1 48 PHE 48 46 46 PHE PHE A . n A 1 49 GLU 49 47 47 GLU GLU A . n A 1 50 GLY 50 48 48 GLY GLY A . n A 1 51 GLY 51 49 49 GLY GLY A . n A 1 52 PRO 52 50 50 PRO PRO A . n A 1 53 CYS 53 51 51 CYS CYS A . n A 1 54 ALA 54 52 52 ALA ALA A . n A 1 55 VAL 55 53 53 VAL VAL A . n A 1 56 ILE 56 54 54 ILE ILE A . n A 1 57 ALA 57 55 55 ALA ALA A . n A 1 58 PRO 58 56 56 PRO PRO A . n A 1 59 VAL 59 57 57 VAL VAL A . n A 1 60 GLN 60 58 58 GLN GLN A . n A 1 61 ALA 61 59 59 ALA ALA A . n A 1 62 PHE 62 60 60 PHE PHE A . n A 1 63 LEU 63 61 61 LEU LEU A . n A 1 64 LEU 64 62 62 LEU LEU A . n A 1 65 LYS 65 63 63 LYS LYS A . n A 1 66 LYS 66 64 64 LYS LYS A . n A 1 67 LEU 67 65 65 LEU LEU A . n A 1 68 LEU 68 66 66 LEU LEU A . n A 1 69 PHE 69 67 67 PHE PHE A . n A 1 70 SER 70 68 68 SER SER A . n A 1 71 SER 71 69 69 SER SER A . n A 1 72 GLU 72 70 70 GLU GLU A . n A 1 73 LYS 73 71 71 LYS LYS A . n A 1 74 SER 74 72 72 SER SER A . n A 1 75 SER 75 73 73 SER SER A . n A 1 76 TRP 76 74 74 TRP TRP A . n A 1 77 ARG 77 75 75 ARG ARG A . n A 1 78 ASP 78 76 76 ASP ASP A . n A 1 79 CYS 79 77 77 CYS CYS A . n A 1 80 SER 80 78 78 SER SER A . n A 1 81 GLU 81 79 79 GLU GLU A . n A 1 82 GLU 82 80 80 GLU GLU A . n A 1 83 GLU 83 81 81 GLU GLU A . n A 1 84 GLN 84 82 82 GLN GLN A . n A 1 85 LYS 85 83 83 LYS LYS A . n A 1 86 GLU 86 84 84 GLU GLU A . n A 1 87 LEU 87 85 85 LEU LEU A . n A 1 88 LEU 88 86 86 LEU LEU A . n A 1 89 CYS 89 87 87 CYS CYS A . n A 1 90 HIS 90 88 88 HIS HIS A . n A 1 91 THR 91 89 89 THR THR A . n A 1 92 LEU 92 90 90 LEU LEU A . n A 1 93 CYS 93 91 91 CYS CYS A . n A 1 94 ASP 94 92 92 ASP ASP A . n A 1 95 ILE 95 93 93 ILE ILE A . n A 1 96 LEU 96 94 94 LEU LEU A . n A 1 97 GLU 97 95 95 GLU GLU A . n A 1 98 SER 98 96 96 SER SER A . n A 1 99 ALA 99 97 97 ALA ALA A . n A 1 100 CYS 100 98 98 CYS CYS A . n A 1 101 CYS 101 99 99 CYS CYS A . n A 1 102 ASP 102 100 100 ASP ASP A . n A 1 103 HIS 103 101 101 HIS HIS A . n A 1 104 SER 104 102 ? ? ? A . n A 1 105 GLY 105 103 103 GLY GLY A . n A 1 106 SER 106 104 104 SER SER A . n A 1 107 TYR 107 105 105 TYR TYR A . n A 1 108 CYS 108 106 106 CYS CYS A . n A 1 109 LEU 109 107 107 LEU LEU A . n A 1 110 VAL 110 108 108 VAL VAL A . n A 1 111 SER 111 109 109 SER SER A . n A 1 112 TRP 112 110 110 TRP TRP A . n A 1 113 LEU 113 111 ? ? ? A . n A 1 114 ARG 114 112 ? ? ? A . n A 1 115 GLY 115 113 ? ? ? A . n A 1 116 LYS 116 114 ? ? ? A . n A 1 117 THR 117 115 ? ? ? A . n A 1 118 THR 118 116 ? ? ? A . n A 1 119 GLU 119 117 ? ? ? A . n A 1 120 GLU 120 118 ? ? ? A . n A 1 121 THR 121 119 ? ? ? A . n A 1 122 ALA 122 120 ? ? ? A . n A 1 123 SER 123 121 ? ? ? A . n A 1 124 ILE 124 122 ? ? ? A . n A 1 125 SER 125 123 ? ? ? A . n A 1 126 GLY 126 124 ? ? ? A . n A 1 127 SER 127 125 ? ? ? A . n A 1 128 PRO 128 126 ? ? ? A . n A 1 129 ALA 129 127 ? ? ? A . n A 1 130 GLU 130 128 ? ? ? A . n A 1 131 SER 131 129 ? ? ? A . n A 1 132 SER 132 130 ? ? ? A . n A 1 133 CYS 133 131 ? ? ? A . n A 1 134 GLN 134 132 ? ? ? A . n A 1 135 VAL 135 133 ? ? ? A . n A 1 136 GLU 136 134 ? ? ? A . n A 1 137 HIS 137 135 ? ? ? A . n A 1 138 SER 138 136 ? ? ? A . n A 1 139 SER 139 137 ? ? ? A . n A 1 140 ALA 140 138 ? ? ? A . n A 1 141 LEU 141 139 139 LEU LEU A . n A 1 142 ALA 142 140 140 ALA ALA A . n A 1 143 VAL 143 141 141 VAL VAL A . n A 1 144 GLU 144 142 142 GLU GLU A . n A 1 145 GLU 145 143 143 GLU GLU A . n A 1 146 LEU 146 144 144 LEU LEU A . n A 1 147 GLY 147 145 145 GLY GLY A . n A 1 148 PHE 148 146 146 PHE PHE A . n A 1 149 GLU 149 147 147 GLU GLU A . n A 1 150 ARG 150 148 148 ARG ARG A . n A 1 151 PHE 151 149 149 PHE PHE A . n A 1 152 HIS 152 150 150 HIS HIS A . n A 1 153 ALA 153 151 151 ALA ALA A . n A 1 154 LEU 154 152 152 LEU LEU A . n A 1 155 ILE 155 153 153 ILE ILE A . n A 1 156 GLN 156 154 154 GLN GLN A . n A 1 157 LYS 157 155 155 LYS LYS A . n A 1 158 ARG 158 156 156 ARG ARG A . n A 1 159 SER 159 157 157 SER SER A . n A 1 160 PHE 160 158 158 PHE PHE A . n A 1 161 ARG 161 159 159 ARG ARG A . n A 1 162 SER 162 160 160 SER SER A . n A 1 163 LEU 163 161 161 LEU LEU A . n A 1 164 PRO 164 162 162 PRO PRO A . n A 1 165 GLU 165 163 163 GLU GLU A . n A 1 166 LEU 166 164 164 LEU LEU A . n A 1 167 LYS 167 165 165 LYS LYS A . n A 1 168 ASP 168 166 166 ASP ASP A . n A 1 169 ALA 169 167 167 ALA ALA A . n A 1 170 VAL 170 168 168 VAL VAL A . n A 1 171 LEU 171 169 169 LEU LEU A . n A 1 172 ASP 172 170 170 ASP ASP A . n A 1 173 GLN 173 171 171 GLN GLN A . n A 1 174 TYR 174 172 172 TYR TYR A . n A 1 175 SER 175 173 173 SER SER A . n A 1 176 MET 176 174 174 MET MET A . n A 1 177 TRP 177 175 175 TRP TRP A . n A 1 178 GLY 178 176 176 GLY GLY A . n A 1 179 ASN 179 177 177 ASN ASN A . n A 1 180 LYS 180 178 178 LYS LYS A . n A 1 181 PHE 181 179 179 PHE PHE A . n A 1 182 GLY 182 180 180 GLY GLY A . n A 1 183 VAL 183 181 181 VAL VAL A . n A 1 184 LEU 184 182 182 LEU LEU A . n A 1 185 LEU 185 183 183 LEU LEU A . n A 1 186 PHE 186 184 184 PHE PHE A . n A 1 187 LEU 187 185 185 LEU LEU A . n A 1 188 TYR 188 186 186 TYR TYR A . n A 1 189 SER 189 187 187 SER SER A . n A 1 190 VAL 190 188 188 VAL VAL A . n A 1 191 LEU 191 189 189 LEU LEU A . n A 1 192 LEU 192 190 190 LEU LEU A . n A 1 193 THR 193 191 191 THR THR A . n A 1 194 LYS 194 192 192 LYS LYS A . n A 1 195 GLY 195 193 193 GLY GLY A . n A 1 196 ILE 196 194 194 ILE ILE A . n A 1 197 GLU 197 195 195 GLU GLU A . n A 1 198 ASN 198 196 196 ASN ASN A . n A 1 199 ILE 199 197 197 ILE ILE A . n A 1 200 LYS 200 198 198 LYS LYS A . n A 1 201 ASN 201 199 199 ASN ASN A . n A 1 202 GLU 202 200 200 GLU GLU A . n A 1 203 ILE 203 201 201 ILE ILE A . n A 1 204 GLU 204 202 202 GLU GLU A . n A 1 205 ASP 205 203 203 ASP ASP A . n A 1 206 ALA 206 204 204 ALA ALA A . n A 1 207 SER 207 205 205 SER SER A . n A 1 208 GLU 208 206 206 GLU GLU A . n A 1 209 PRO 209 207 207 PRO PRO A . n A 1 210 LEU 210 208 208 LEU LEU A . n A 1 211 ILE 211 209 209 ILE ILE A . n A 1 212 ASP 212 210 210 ASP ASP A . n A 1 213 PRO 213 211 211 PRO PRO A . n A 1 214 VAL 214 212 212 VAL VAL A . n A 1 215 TYR 215 213 213 TYR TYR A . n A 1 216 GLY 216 214 214 GLY GLY A . n A 1 217 HIS 217 215 215 HIS HIS A . n A 1 218 GLY 218 216 216 GLY GLY A . n A 1 219 SER 219 217 217 SER SER A . n A 1 220 GLN 220 218 218 GLN GLN A . n A 1 221 SER 221 219 219 SER SER A . n A 1 222 LEU 222 220 220 LEU LEU A . n A 1 223 ILE 223 221 221 ILE ILE A . n A 1 224 ASN 224 222 222 ASN ASN A . n A 1 225 LEU 225 223 223 LEU LEU A . n A 1 226 LEU 226 224 224 LEU LEU A . n A 1 227 LEU 227 225 225 LEU LEU A . n A 1 228 THR 228 226 226 THR THR A . n A 1 229 GLY 229 227 227 GLY GLY A . n A 1 230 HIS 230 228 228 HIS HIS A . n A 1 231 ALA 231 229 229 ALA ALA A . n A 1 232 VAL 232 230 230 VAL VAL A . n A 1 233 SER 233 231 231 SER SER A . n A 1 234 ASN 234 232 232 ASN ASN A . n A 1 235 VAL 235 233 233 VAL VAL A . n A 1 236 TRP 236 234 234 TRP TRP A . n A 1 237 ASP 237 235 235 ASP ASP A . n A 1 238 GLY 238 236 236 GLY GLY A . n A 1 239 ASP 239 237 237 ASP ASP A . n A 1 240 ARG 240 238 238 ARG ARG A . n A 1 241 GLU 241 239 239 GLU GLU A . n A 1 242 CYS 242 240 ? ? ? A . n A 1 243 SER 243 241 241 SER SER A . n A 1 244 GLY 244 242 242 GLY GLY A . n A 1 245 MET 245 243 243 MET MET A . n A 1 246 LYS 246 244 244 LYS LYS A . n A 1 247 LEU 247 245 245 LEU LEU A . n A 1 248 LEU 248 246 246 LEU LEU A . n A 1 249 GLY 249 247 247 GLY GLY A . n A 1 250 ILE 250 248 248 ILE ILE A . n A 1 251 HIS 251 249 249 HIS HIS A . n A 1 252 GLU 252 250 250 GLU GLU A . n A 1 253 GLN 253 251 251 GLN GLN A . n A 1 254 ALA 254 252 252 ALA ALA A . n A 1 255 ALA 255 253 253 ALA ALA A . n A 1 256 VAL 256 254 254 VAL VAL A . n A 1 257 GLY 257 255 255 GLY GLY A . n A 1 258 PHE 258 256 256 PHE PHE A . n A 1 259 LEU 259 257 257 LEU LEU A . n A 1 260 THR 260 258 258 THR THR A . n A 1 261 LEU 261 259 259 LEU LEU A . n A 1 262 MET 262 260 260 MET MET A . n A 1 263 GLU 263 261 261 GLU GLU A . n A 1 264 ALA 264 262 262 ALA ALA A . n A 1 265 LEU 265 263 263 LEU LEU A . n A 1 266 ARG 266 264 264 ARG ARG A . n A 1 267 TYR 267 265 265 TYR TYR A . n A 1 268 CYS 268 266 266 CYS CYS A . n A 1 269 LYS 269 267 267 LYS LYS A . n A 1 270 VAL 270 268 268 VAL VAL A . n A 1 271 GLY 271 269 269 GLY GLY A . n A 1 272 SER 272 270 270 SER SER A . n A 1 273 TYR 273 271 271 TYR TYR A . n A 1 274 LEU 274 272 272 LEU LEU A . n A 1 275 LYS 275 273 273 LYS LYS A . n A 1 276 SER 276 274 274 SER SER A . n A 1 277 PRO 277 275 275 PRO PRO A . n A 1 278 LYS 278 276 276 LYS LYS A . n A 1 279 PHE 279 277 277 PHE PHE A . n A 1 280 PRO 280 278 278 PRO PRO A . n A 1 281 ILE 281 279 279 ILE ILE A . n A 1 282 TRP 282 280 280 TRP TRP A . n A 1 283 ILE 283 281 281 ILE ILE A . n A 1 284 VAL 284 282 282 VAL VAL A . n A 1 285 GLY 285 283 283 GLY GLY A . n A 1 286 SER 286 284 284 SER SER A . n A 1 287 GLU 287 285 285 GLU GLU A . n A 1 288 THR 288 286 286 THR THR A . n A 1 289 HIS 289 287 287 HIS HIS A . n A 1 290 LEU 290 288 288 LEU LEU A . n A 1 291 THR 291 289 289 THR THR A . n A 1 292 VAL 292 290 290 VAL VAL A . n A 1 293 PHE 293 291 291 PHE PHE A . n A 1 294 PHE 294 292 292 PHE PHE A . n A 1 295 ALA 295 293 293 ALA ALA A . n A 1 296 LYS 296 294 294 LYS LYS A . n A 1 297 ASP 297 295 295 ASP ASP A . n A 1 298 MET 298 296 296 MET MET A . n A 1 299 ALA 299 297 297 ALA ALA A . n A 1 300 LEU 300 298 298 LEU LEU A . n A 1 301 VAL 301 299 299 VAL VAL A . n A 1 302 ALA 302 300 300 ALA ALA A . n A 1 303 PRO 303 301 301 PRO PRO A . n A 1 304 GLU 304 302 ? ? ? A . n A 1 305 ALA 305 303 ? ? ? A . n A 1 306 PRO 306 304 ? ? ? A . n A 1 307 SER 307 305 ? ? ? A . n A 1 308 GLU 308 306 ? ? ? A . n A 1 309 GLN 309 307 ? ? ? A . n A 1 310 ALA 310 308 ? ? ? A . n A 1 311 ARG 311 309 ? ? ? A . n A 1 312 ARG 312 310 ? ? ? A . n A 1 313 VAL 313 311 ? ? ? A . n A 1 314 PHE 314 312 ? ? ? A . n A 1 315 GLN 315 313 ? ? ? A . n A 1 316 THR 316 314 ? ? ? A . n A 1 317 TYR 317 315 ? ? ? A . n A 1 318 ASP 318 316 ? ? ? A . n A 1 319 PRO 319 317 ? ? ? A . n A 1 320 GLU 320 318 ? ? ? A . n A 1 321 ASP 321 319 ? ? ? A . n A 1 322 ASN 322 320 ? ? ? A . n A 1 323 GLY 323 321 ? ? ? A . n A 1 324 PHE 324 322 ? ? ? A . n A 1 325 ILE 325 323 ? ? ? A . n A 1 326 PRO 326 324 ? ? ? A . n A 1 327 ASP 327 325 ? ? ? A . n A 1 328 SER 328 326 ? ? ? A . n A 1 329 LEU 329 327 ? ? ? A . n A 1 330 LEU 330 328 ? ? ? A . n A 1 331 GLU 331 329 ? ? ? A . n A 1 332 ASP 332 330 ? ? ? A . n A 1 333 VAL 333 331 ? ? ? A . n A 1 334 MET 334 332 ? ? ? A . n A 1 335 LYS 335 333 ? ? ? A . n A 1 336 ALA 336 334 ? ? ? A . n A 1 337 LEU 337 335 ? ? ? A . n A 1 338 ASP 338 336 ? ? ? A . n A 1 339 LEU 339 337 ? ? ? A . n A 1 340 VAL 340 338 ? ? ? A . n A 1 341 SER 341 339 ? ? ? A . n A 1 342 ASP 342 340 ? ? ? A . n A 1 343 PRO 343 341 ? ? ? A . n A 1 344 GLU 344 342 ? ? ? A . n A 1 345 TYR 345 343 ? ? ? A . n A 1 346 ILE 346 344 ? ? ? A . n A 1 347 ASN 347 345 ? ? ? A . n A 1 348 LEU 348 346 ? ? ? A . n A 1 349 MET 349 347 ? ? ? A . n A 1 350 LYS 350 348 ? ? ? A . n A 1 351 ASN 351 349 ? ? ? A . n A 1 352 LYS 352 350 ? ? ? A . n A 1 353 LEU 353 351 ? ? ? A . n A 1 354 ASP 354 352 ? ? ? A . n A 1 355 PRO 355 353 ? ? ? A . n A 1 356 GLU 356 354 ? ? ? A . n A 1 357 GLY 357 355 ? ? ? A . n A 1 358 LEU 358 356 ? ? ? A . n A 1 359 GLY 359 357 ? ? ? A . n A 1 360 ILE 360 358 ? ? ? A . n A 1 361 ILE 361 359 ? ? ? A . n A 1 362 LEU 362 360 ? ? ? A . n A 1 363 LEU 363 361 ? ? ? A . n A 1 364 GLY 364 362 ? ? ? A . n A 1 365 PRO 365 363 ? ? ? A . n A 1 366 PHE 366 364 ? ? ? A . n A 1 367 LEU 367 365 ? ? ? A . n A 1 368 GLN 368 366 ? ? ? A . n A 1 369 GLU 369 367 ? ? ? A . n A 1 370 PHE 370 368 ? ? ? A . n A 1 371 PHE 371 369 ? ? ? A . n A 1 372 PRO 372 370 ? ? ? A . n A 1 373 ASP 373 371 ? ? ? A . n A 1 374 GLN 374 372 ? ? ? A . n A 1 375 GLY 375 373 ? ? ? A . n A 1 376 SER 376 374 ? ? ? A . n A 1 377 SER 377 375 ? ? ? A . n A 1 378 GLY 378 376 ? ? ? A . n A 1 379 PRO 379 377 377 PRO PRO A . n A 1 380 GLU 380 378 378 GLU GLU A . n A 1 381 SER 381 379 379 SER SER A . n A 1 382 PHE 382 380 380 PHE PHE A . n A 1 383 THR 383 381 381 THR THR A . n A 1 384 VAL 384 382 382 VAL VAL A . n A 1 385 TYR 385 383 383 TYR TYR A . n A 1 386 HIS 386 384 384 HIS HIS A . n A 1 387 TYR 387 385 385 TYR TYR A . n A 1 388 ASN 388 386 386 ASN ASN A . n A 1 389 GLY 389 387 387 GLY GLY A . n A 1 390 LEU 390 388 388 LEU LEU A . n A 1 391 LYS 391 389 389 LYS LYS A . n A 1 392 GLN 392 390 390 GLN GLN A . n A 1 393 SER 393 391 391 SER SER A . n A 1 394 ASN 394 392 392 ASN ASN A . n A 1 395 TYR 395 393 393 TYR TYR A . n A 1 396 ASN 396 394 394 ASN ASN A . n A 1 397 GLU 397 395 395 GLU GLU A . n A 1 398 LYS 398 396 396 LYS LYS A . n A 1 399 VAL 399 397 397 VAL VAL A . n A 1 400 MET 400 398 398 MET MET A . n A 1 401 TYR 401 399 399 TYR TYR A . n A 1 402 VAL 402 400 400 VAL VAL A . n A 1 403 GLU 403 401 401 GLU GLU A . n A 1 404 GLY 404 402 402 GLY GLY A . n A 1 405 THR 405 403 403 THR THR A . n A 1 406 ALA 406 404 404 ALA ALA A . n A 1 407 VAL 407 405 405 VAL VAL A . n A 1 408 VAL 408 406 406 VAL VAL A . n A 1 409 MET 409 407 407 MET MET A . n A 1 410 GLY 410 408 408 GLY GLY A . n A 1 411 PHE 411 409 409 PHE PHE A . n A 1 412 GLU 412 410 410 GLU GLU A . n A 1 413 ASP 413 411 411 ASP ASP A . n A 1 414 PRO 414 412 412 PRO PRO A . n A 1 415 MET 415 413 413 MET MET A . n A 1 416 LEU 416 414 414 LEU LEU A . n A 1 417 GLN 417 415 415 GLN GLN A . n A 1 418 THR 418 416 416 THR THR A . n A 1 419 ASP 419 417 417 ASP ASP A . n A 1 420 ASP 420 418 418 ASP ASP A . n A 1 421 THR 421 419 419 THR THR A . n A 1 422 PRO 422 420 420 PRO PRO A . n A 1 423 ILE 423 421 421 ILE ILE A . n A 1 424 LYS 424 422 422 LYS LYS A . n A 1 425 ARG 425 423 423 ARG ARG A . n A 1 426 CYS 426 424 424 CYS CYS A . n A 1 427 LEU 427 425 425 LEU LEU A . n A 1 428 GLN 428 426 426 GLN GLN A . n A 1 429 THR 429 427 427 THR THR A . n A 1 430 LYS 430 428 428 LYS LYS A . n A 1 431 TRP 431 429 429 TRP TRP A . n A 1 432 PRO 432 430 430 PRO PRO A . n A 1 433 TYR 433 431 431 TYR TYR A . n A 1 434 ILE 434 432 432 ILE ILE A . n A 1 435 GLU 435 433 433 GLU GLU A . n A 1 436 LEU 436 434 434 LEU LEU A . n A 1 437 LEU 437 435 435 LEU LEU A . n A 1 438 TRP 438 436 436 TRP TRP A . n A 1 439 THR 439 437 437 THR THR A . n A 1 440 THR 440 438 438 THR THR A . n A 1 441 ASP 441 439 439 ASP ASP A . n A 1 442 ARG 442 440 440 ARG ARG A . n A 1 443 SER 443 441 441 SER SER A . n A 1 444 PRO 444 442 442 PRO PRO A . n A 1 445 SER 445 443 443 SER SER A . n A 1 446 LEU 446 444 444 LEU LEU A . n A 1 447 ASN 447 445 445 ASN ASN A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 501 4 HOH HOH A . B 2 HOH 2 502 9 HOH HOH A . B 2 HOH 3 503 11 HOH HOH A . B 2 HOH 4 504 5 HOH HOH A . B 2 HOH 5 505 3 HOH HOH A . B 2 HOH 6 506 7 HOH HOH A . B 2 HOH 7 507 1 HOH HOH A . B 2 HOH 8 508 2 HOH HOH A . B 2 HOH 9 509 8 HOH HOH A . B 2 HOH 10 510 14 HOH HOH A . B 2 HOH 11 511 10 HOH HOH A . B 2 HOH 12 512 12 HOH HOH A . B 2 HOH 13 513 6 HOH HOH A . B 2 HOH 14 514 13 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.20.1_4487: ???)' ? 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . ? 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . ? 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? AutoSol ? ? ? . ? 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 9RMD _cell.details ? _cell.formula_units_Z ? _cell.length_a 112.800 _cell.length_a_esd ? _cell.length_b 112.800 _cell.length_b_esd ? _cell.length_c 72.080 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9RMD _symmetry.cell_setting ? _symmetry.Int_Tables_number 154 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 32 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9RMD _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.65 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 53.62 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '20% (v/v) PEG 6000 and MES pH 6.0' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293.15 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 S 2M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-07-11 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9184 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'BESSY BEAMLINE 14.2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9184 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 14.2 _diffrn_source.pdbx_synchrotron_site BESSY # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 9RMD _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.3 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 23779 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.5 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 8.1 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 12.04 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.30 _reflns_shell.d_res_low 2.36 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 23705 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 6.8 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.461 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 96.5 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9RMD _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.30 _refine.ls_d_res_low 24.42 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 23779 _refine.ls_number_reflns_R_free 1220 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.54 _refine.ls_percent_reflns_R_free 5.13 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2398 _refine.ls_R_factor_R_free 0.2643 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2385 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.10 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 34.01 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.37 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.30 _refine_hist.d_res_low 24.42 _refine_hist.number_atoms_solvent 14 _refine_hist.number_atoms_total 2720 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2706 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.005 ? 2769 ? f_bond_d ? ? ? 'X-RAY DIFFRACTION' ? 0.872 ? 3747 ? f_angle_d ? ? ? 'X-RAY DIFFRACTION' ? 17.297 ? 1000 ? f_dihedral_angle_d ? ? ? 'X-RAY DIFFRACTION' ? 0.051 ? 416 ? f_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.007 ? 470 ? f_plane_restr ? ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.30 2.39 . . 105 2461 98.00 . . . . 0.3730 . . . . . . . . . . . . . . . 0.3951 'X-RAY DIFFRACTION' 2.39 2.50 . . 131 2481 100.00 . . . . 0.3164 . . . . . . . . . . . . . . . 0.3548 'X-RAY DIFFRACTION' 2.50 2.63 . . 145 2488 100.00 . . . . 0.3189 . . . . . . . . . . . . . . . 0.3825 'X-RAY DIFFRACTION' 2.63 2.79 . . 172 2445 100.00 . . . . 0.3163 . . . . . . . . . . . . . . . 0.3458 'X-RAY DIFFRACTION' 2.79 3.01 . . 148 2495 100.00 . . . . 0.3248 . . . . . . . . . . . . . . . 0.3521 'X-RAY DIFFRACTION' 3.01 3.31 . . 126 2509 100.00 . . . . 0.2928 . . . . . . . . . . . . . . . 0.3451 'X-RAY DIFFRACTION' 3.31 3.79 . . 123 2508 99.00 . . . . 0.2593 . . . . . . . . . . . . . . . 0.2712 'X-RAY DIFFRACTION' 3.79 4.77 . . 139 2535 100.00 . . . . 0.1979 . . . . . . . . . . . . . . . 0.2058 'X-RAY DIFFRACTION' 4.77 24.42 . . 131 2637 100.00 . . . . 0.1913 . . . . . . . . . . . . . . . 0.2212 # _struct.entry_id 9RMD _struct.title 'Human MINDY3 deubiquitinase (FAM188A)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9RMD _struct_keywords.text 'Ubiquitin hydrolase, MINDY3, K48, deubiquitinase, FAM188A, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MINY3_HUMAN _struct_ref.pdbx_db_accession Q9H8M7 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SELTKELMELVWGTKSSPGLSDTIFCRWTQGFVFSESEGSALEQFEGGPCAVIAPVQAFLLKKLLFSSEKSSWRDCSEEE QKELLCHTLCDILESACCDHSGSYCLVSWLRGKTTEETASISGSPAESSCQVEHSSALAVEELGFERFHALIQKRSFRSL PELKDAVLDQYSMWGNKFGVLLFLYSVLLTKGIENIKNEIEDASEPLIDPVYGHGSQSLINLLLTGHAVSNVWDGDRECS GMKLLGIHEQAAVGFLTLMEALRYCKVGSYLKSPKFPIWIVGSETHLTVFFAKDMALVAPEAPSEQARRVFQTYDPEDNG FIPDSLLEDVMKALDLVSDPEYINLMKNKLDPEGLGIILLGPFLQEFFPDQGSSGPESFTVYHYNGLKQSNYNEKVMYVE GTAVVMGFEDPMLQTDDTPIKRCLQTKWPYIELLWTTDRSPSLN ; _struct_ref.pdbx_align_begin 2 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9RMD _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 447 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9H8M7 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 445 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 445 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9RMD ALA A 1 ? UNP Q9H8M7 ? ? 'expression tag' -1 1 1 9RMD MET A 2 ? UNP Q9H8M7 ? ? 'expression tag' 0 2 1 9RMD ALA A 3 ? UNP Q9H8M7 ? ? 'expression tag' 1 3 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ALA A 3 ? GLY A 16 ? ALA A 1 GLY A 14 1 ? 14 HELX_P HELX_P2 AA2 THR A 26 ? TRP A 31 ? THR A 24 TRP A 29 1 ? 6 HELX_P HELX_P3 AA3 PRO A 52 ? SER A 70 ? PRO A 50 SER A 68 1 ? 19 HELX_P HELX_P4 AA4 SER A 80 ? CYS A 100 ? SER A 78 CYS A 98 1 ? 21 HELX_P HELX_P5 AA5 GLY A 147 ? ALA A 153 ? GLY A 145 ALA A 151 1 ? 7 HELX_P HELX_P6 AA6 SER A 162 ? GLN A 173 ? SER A 160 GLN A 171 1 ? 12 HELX_P HELX_P7 AA7 GLN A 173 ? ASN A 179 ? GLN A 171 ASN A 177 1 ? 7 HELX_P HELX_P8 AA8 PHE A 181 ? GLY A 195 ? PHE A 179 GLY A 193 1 ? 15 HELX_P HELX_P9 AA9 GLY A 195 ? ILE A 203 ? GLY A 193 ILE A 201 1 ? 9 HELX_P HELX_P10 AB1 SER A 219 ? GLY A 229 ? SER A 217 GLY A 227 1 ? 11 HELX_P HELX_P11 AB2 LEU A 261 ? LEU A 265 ? LEU A 259 LEU A 263 1 ? 5 HELX_P HELX_P12 AB3 GLY A 271 ? SER A 276 ? GLY A 269 SER A 274 1 ? 6 HELX_P HELX_P13 AB4 ASP A 297 ? ALA A 302 ? ASP A 295 ALA A 300 5 ? 6 HELX_P HELX_P14 AB5 LEU A 390 ? LYS A 398 ? LEU A 388 LYS A 396 5 ? 9 HELX_P HELX_P15 AB6 THR A 421 ? THR A 429 ? THR A 419 THR A 427 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 2 ? AA3 ? 6 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA3 4 5 ? anti-parallel AA3 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 36 ? SER A 38 ? VAL A 34 SER A 36 AA1 2 GLU A 41 ? GLU A 46 ? GLU A 39 GLU A 44 AA2 1 CYS A 108 ? SER A 111 ? CYS A 106 SER A 109 AA2 2 GLN A 156 ? SER A 159 ? GLN A 154 SER A 157 AA3 1 GLY A 257 ? THR A 260 ? GLY A 255 THR A 258 AA3 2 ILE A 281 ? GLY A 285 ? ILE A 279 GLY A 283 AA3 3 LEU A 290 ? ALA A 295 ? LEU A 288 ALA A 293 AA3 4 SER A 381 ? TYR A 387 ? SER A 379 TYR A 385 AA3 5 VAL A 402 ? VAL A 407 ? VAL A 400 VAL A 405 AA3 6 GLU A 435 ? TRP A 438 ? GLU A 433 TRP A 436 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N VAL A 36 ? N VAL A 34 O GLU A 46 ? O GLU A 44 AA2 1 2 N LEU A 109 ? N LEU A 107 O ARG A 158 ? O ARG A 156 AA3 1 2 N GLY A 257 ? N GLY A 255 O ILE A 281 ? O ILE A 279 AA3 2 3 N TRP A 282 ? N TRP A 280 O PHE A 293 ? O PHE A 291 AA3 3 4 N VAL A 292 ? N VAL A 290 O TYR A 387 ? O TYR A 385 AA3 4 5 N PHE A 382 ? N PHE A 380 O ALA A 406 ? O ALA A 404 AA3 5 6 N THR A 405 ? N THR A 403 O LEU A 437 ? O LEU A 435 # _pdbx_entry_details.entry_id 9RMD _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification N # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 N _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ALA _pdbx_validate_close_contact.auth_seq_id_1 -1 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 OE1 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 GLN _pdbx_validate_close_contact.auth_seq_id_2 154 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.19 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 CA _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 CYS _pdbx_validate_rmsd_angle.auth_seq_id_1 51 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CB _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 CYS _pdbx_validate_rmsd_angle.auth_seq_id_2 51 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 SG _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 CYS _pdbx_validate_rmsd_angle.auth_seq_id_3 51 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 123.42 _pdbx_validate_rmsd_angle.angle_target_value 114.20 _pdbx_validate_rmsd_angle.angle_deviation 9.22 _pdbx_validate_rmsd_angle.angle_standard_deviation 1.10 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 15 ? ? -79.55 -170.00 2 1 GLU A 39 ? ? -162.52 94.84 3 1 PRO A 50 ? ? -81.72 35.02 4 1 SER A 68 ? ? -149.88 10.59 5 1 GLU A 70 ? ? 73.50 -1.03 6 1 TYR A 105 ? ? -139.87 -109.37 7 1 ALA A 229 ? ? -87.28 38.84 8 1 SER A 284 ? ? -94.43 -142.68 9 1 THR A 286 ? ? -141.53 -27.11 10 1 GLU A 378 ? ? 70.84 -4.70 11 1 THR A 438 ? ? 38.19 48.53 12 1 ASP A 439 ? ? 58.68 11.59 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 102 ? A SER 104 2 1 Y 1 A LEU 111 ? A LEU 113 3 1 Y 1 A ARG 112 ? A ARG 114 4 1 Y 1 A GLY 113 ? A GLY 115 5 1 Y 1 A LYS 114 ? A LYS 116 6 1 Y 1 A THR 115 ? A THR 117 7 1 Y 1 A THR 116 ? A THR 118 8 1 Y 1 A GLU 117 ? A GLU 119 9 1 Y 1 A GLU 118 ? A GLU 120 10 1 Y 1 A THR 119 ? A THR 121 11 1 Y 1 A ALA 120 ? A ALA 122 12 1 Y 1 A SER 121 ? A SER 123 13 1 Y 1 A ILE 122 ? A ILE 124 14 1 Y 1 A SER 123 ? A SER 125 15 1 Y 1 A GLY 124 ? A GLY 126 16 1 Y 1 A SER 125 ? A SER 127 17 1 Y 1 A PRO 126 ? A PRO 128 18 1 Y 1 A ALA 127 ? A ALA 129 19 1 Y 1 A GLU 128 ? A GLU 130 20 1 Y 1 A SER 129 ? A SER 131 21 1 Y 1 A SER 130 ? A SER 132 22 1 Y 1 A CYS 131 ? A CYS 133 23 1 Y 1 A GLN 132 ? A GLN 134 24 1 Y 1 A VAL 133 ? A VAL 135 25 1 Y 1 A GLU 134 ? A GLU 136 26 1 Y 1 A HIS 135 ? A HIS 137 27 1 Y 1 A SER 136 ? A SER 138 28 1 Y 1 A SER 137 ? A SER 139 29 1 Y 1 A ALA 138 ? A ALA 140 30 1 Y 1 A CYS 240 ? A CYS 242 31 1 Y 1 A GLU 302 ? A GLU 304 32 1 Y 1 A ALA 303 ? A ALA 305 33 1 Y 1 A PRO 304 ? A PRO 306 34 1 Y 1 A SER 305 ? A SER 307 35 1 Y 1 A GLU 306 ? A GLU 308 36 1 Y 1 A GLN 307 ? A GLN 309 37 1 Y 1 A ALA 308 ? A ALA 310 38 1 Y 1 A ARG 309 ? A ARG 311 39 1 Y 1 A ARG 310 ? A ARG 312 40 1 Y 1 A VAL 311 ? A VAL 313 41 1 Y 1 A PHE 312 ? A PHE 314 42 1 Y 1 A GLN 313 ? A GLN 315 43 1 Y 1 A THR 314 ? A THR 316 44 1 Y 1 A TYR 315 ? A TYR 317 45 1 Y 1 A ASP 316 ? A ASP 318 46 1 Y 1 A PRO 317 ? A PRO 319 47 1 Y 1 A GLU 318 ? A GLU 320 48 1 Y 1 A ASP 319 ? A ASP 321 49 1 Y 1 A ASN 320 ? A ASN 322 50 1 Y 1 A GLY 321 ? A GLY 323 51 1 Y 1 A PHE 322 ? A PHE 324 52 1 Y 1 A ILE 323 ? A ILE 325 53 1 Y 1 A PRO 324 ? A PRO 326 54 1 Y 1 A ASP 325 ? A ASP 327 55 1 Y 1 A SER 326 ? A SER 328 56 1 Y 1 A LEU 327 ? A LEU 329 57 1 Y 1 A LEU 328 ? A LEU 330 58 1 Y 1 A GLU 329 ? A GLU 331 59 1 Y 1 A ASP 330 ? A ASP 332 60 1 Y 1 A VAL 331 ? A VAL 333 61 1 Y 1 A MET 332 ? A MET 334 62 1 Y 1 A LYS 333 ? A LYS 335 63 1 Y 1 A ALA 334 ? A ALA 336 64 1 Y 1 A LEU 335 ? A LEU 337 65 1 Y 1 A ASP 336 ? A ASP 338 66 1 Y 1 A LEU 337 ? A LEU 339 67 1 Y 1 A VAL 338 ? A VAL 340 68 1 Y 1 A SER 339 ? A SER 341 69 1 Y 1 A ASP 340 ? A ASP 342 70 1 Y 1 A PRO 341 ? A PRO 343 71 1 Y 1 A GLU 342 ? A GLU 344 72 1 Y 1 A TYR 343 ? A TYR 345 73 1 Y 1 A ILE 344 ? A ILE 346 74 1 Y 1 A ASN 345 ? A ASN 347 75 1 Y 1 A LEU 346 ? A LEU 348 76 1 Y 1 A MET 347 ? A MET 349 77 1 Y 1 A LYS 348 ? A LYS 350 78 1 Y 1 A ASN 349 ? A ASN 351 79 1 Y 1 A LYS 350 ? A LYS 352 80 1 Y 1 A LEU 351 ? A LEU 353 81 1 Y 1 A ASP 352 ? A ASP 354 82 1 Y 1 A PRO 353 ? A PRO 355 83 1 Y 1 A GLU 354 ? A GLU 356 84 1 Y 1 A GLY 355 ? A GLY 357 85 1 Y 1 A LEU 356 ? A LEU 358 86 1 Y 1 A GLY 357 ? A GLY 359 87 1 Y 1 A ILE 358 ? A ILE 360 88 1 Y 1 A ILE 359 ? A ILE 361 89 1 Y 1 A LEU 360 ? A LEU 362 90 1 Y 1 A LEU 361 ? A LEU 363 91 1 Y 1 A GLY 362 ? A GLY 364 92 1 Y 1 A PRO 363 ? A PRO 365 93 1 Y 1 A PHE 364 ? A PHE 366 94 1 Y 1 A LEU 365 ? A LEU 367 95 1 Y 1 A GLN 366 ? A GLN 368 96 1 Y 1 A GLU 367 ? A GLU 369 97 1 Y 1 A PHE 368 ? A PHE 370 98 1 Y 1 A PHE 369 ? A PHE 371 99 1 Y 1 A PRO 370 ? A PRO 372 100 1 Y 1 A ASP 371 ? A ASP 373 101 1 Y 1 A GLN 372 ? A GLN 374 102 1 Y 1 A GLY 373 ? A GLY 375 103 1 Y 1 A SER 374 ? A SER 376 104 1 Y 1 A SER 375 ? A SER 377 105 1 Y 1 A GLY 376 ? A GLY 378 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TRP N N N N 321 TRP CA C N S 322 TRP C C N N 323 TRP O O N N 324 TRP CB C N N 325 TRP CG C Y N 326 TRP CD1 C Y N 327 TRP CD2 C Y N 328 TRP NE1 N Y N 329 TRP CE2 C Y N 330 TRP CE3 C Y N 331 TRP CZ2 C Y N 332 TRP CZ3 C Y N 333 TRP CH2 C Y N 334 TRP OXT O N N 335 TRP H H N N 336 TRP H2 H N N 337 TRP HA H N N 338 TRP HB2 H N N 339 TRP HB3 H N N 340 TRP HD1 H N N 341 TRP HE1 H N N 342 TRP HE3 H N N 343 TRP HZ2 H N N 344 TRP HZ3 H N N 345 TRP HH2 H N N 346 TRP HXT H N N 347 TYR N N N N 348 TYR CA C N S 349 TYR C C N N 350 TYR O O N N 351 TYR CB C N N 352 TYR CG C Y N 353 TYR CD1 C Y N 354 TYR CD2 C Y N 355 TYR CE1 C Y N 356 TYR CE2 C Y N 357 TYR CZ C Y N 358 TYR OH O N N 359 TYR OXT O N N 360 TYR H H N N 361 TYR H2 H N N 362 TYR HA H N N 363 TYR HB2 H N N 364 TYR HB3 H N N 365 TYR HD1 H N N 366 TYR HD2 H N N 367 TYR HE1 H N N 368 TYR HE2 H N N 369 TYR HH H N N 370 TYR HXT H N N 371 VAL N N N N 372 VAL CA C N S 373 VAL C C N N 374 VAL O O N N 375 VAL CB C N N 376 VAL CG1 C N N 377 VAL CG2 C N N 378 VAL OXT O N N 379 VAL H H N N 380 VAL H2 H N N 381 VAL HA H N N 382 VAL HB H N N 383 VAL HG11 H N N 384 VAL HG12 H N N 385 VAL HG13 H N N 386 VAL HG21 H N N 387 VAL HG22 H N N 388 VAL HG23 H N N 389 VAL HXT H N N 390 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # _pdbx_audit_support.funding_organization 'Polish National Science Centre' _pdbx_audit_support.country Poland _pdbx_audit_support.grant_number 2022/47/B/NZ1/01941 _pdbx_audit_support.ordinal 1 # _atom_sites.entry_id 9RMD _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.008865 _atom_sites.fract_transf_matrix[1][2] 0.005118 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010237 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013873 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ #