data_9RPN # _entry.id 9RPN # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.416 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9RPN pdb_00009rpn 10.2210/pdb9rpn/pdb WWPDB D_1292148813 ? ? BMRB 35004 ? 10.13018/BMR35004 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-09-09 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr . _pdbx_database_status.entry_id 9RPN _pdbx_database_status.recvd_initial_deposition_date 2025-06-25 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs . _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category CASD-NMR _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'PIN1 WW Domain Binding Mode with LYR-tide' _pdbx_database_related.db_id 35004 _pdbx_database_related.content_type unspecified # loop_ _pdbx_contact_author.id _pdbx_contact_author.email _pdbx_contact_author.name_first _pdbx_contact_author.name_last _pdbx_contact_author.name_mi _pdbx_contact_author.role _pdbx_contact_author.identifier_ORCID 3 pau.creixell@cruk.cam.ac.uk Pau Creixell ? 'principal investigator/group leader' 0000-0001-7529-3029 4 hrm28@cam.ac.uk Helen Mott ? 'principal investigator/group leader' 0000-0002-7890-7097 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Jiang, M.' 1 0000-0002-6046-9439 'Sun, M.' 2 0009-0005-8597-1985 'Mott, H.' 3 0000-0002-7890-7097 'Creixell, P.' 4 0000-0001-7529-3029 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title ;Identifying molecular determinants of epistasis and engineering protein superbinders with combinatorial deep mutational scanning libraries ; _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Jiang, M.' 1 0000-0002-6046-9439 primary 'Sun, M.' 2 0009-0005-8597-1985 primary 'Nuo, C.' 3 0000-0002-2614-8682 primary 'Ord, M.' 4 0000-0003-0454-7241 primary 'Augustin, T.L.' 5 0000-0003-0805-513X primary 'Li, A.' 6 0000-0003-2359-7703 primary 'Shah, N.H.' 7 0000-0002-1186-0626 primary 'Rinehart, J.' 8 0000-0003-4839-4005 primary 'Mott, H.' 9 0000-0002-7890-7097 primary 'Creixell, P.' 10 0000-0001-7529-3029 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1' 4360.806 1 5.2.1.8 ? ? ? 2 polymer syn 'LYR-tide LYRpSPPLP' 1161.249 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Peptidyl-prolyl cis-trans isomerase Pin1,PPIase Pin1,Rotamase Pin1' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no EKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNS EKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNS A ? 2 'polypeptide(L)' no yes '(ACE)GLYR(SEP)PPLPG(NH2)' XGLYRSPPLPGX B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLU n 1 2 LYS n 1 3 LEU n 1 4 PRO n 1 5 PRO n 1 6 GLY n 1 7 TRP n 1 8 GLU n 1 9 LYS n 1 10 ARG n 1 11 MET n 1 12 SER n 1 13 ARG n 1 14 SER n 1 15 SER n 1 16 GLY n 1 17 ARG n 1 18 VAL n 1 19 TYR n 1 20 TYR n 1 21 PHE n 1 22 ASN n 1 23 HIS n 1 24 ILE n 1 25 THR n 1 26 ASN n 1 27 ALA n 1 28 SER n 1 29 GLN n 1 30 TRP n 1 31 GLU n 1 32 ARG n 1 33 PRO n 1 34 SER n 1 35 GLY n 1 36 ASN n 1 37 SER n 2 1 ACE n 2 2 GLY n 2 3 LEU n 2 4 TYR n 2 5 ARG n 2 6 SEP n 2 7 PRO n 2 8 PRO n 2 9 LEU n 2 10 PRO n 2 11 GLY n 2 12 NH2 n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 37 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene PIN1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 12 _pdbx_entity_src_syn.organism_scientific 'synthetic construct' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 32630 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ACE non-polymer . 'ACETYL GROUP' ? 'C2 H4 O' 44.053 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NH2 non-polymer . 'AMINO GROUP' ? 'H2 N' 16.023 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SEP 'L-peptide linking' n PHOSPHOSERINE PHOSPHONOSERINE 'C3 H8 N O6 P' 185.072 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLU 1 5 5 GLU GLU A . n A 1 2 LYS 2 6 6 LYS LYS A . n A 1 3 LEU 3 7 7 LEU LEU A . n A 1 4 PRO 4 8 8 PRO PRO A . n A 1 5 PRO 5 9 9 PRO PRO A . n A 1 6 GLY 6 10 10 GLY GLY A . n A 1 7 TRP 7 11 11 TRP TRP A . n A 1 8 GLU 8 12 12 GLU GLU A . n A 1 9 LYS 9 13 13 LYS LYS A . n A 1 10 ARG 10 14 14 ARG ARG A . n A 1 11 MET 11 15 15 MET MET A . n A 1 12 SER 12 16 16 SER SER A . n A 1 13 ARG 13 17 17 ARG ARG A . n A 1 14 SER 14 18 18 SER SER A . n A 1 15 SER 15 19 19 SER SER A . n A 1 16 GLY 16 20 20 GLY GLY A . n A 1 17 ARG 17 21 21 ARG ARG A . n A 1 18 VAL 18 22 22 VAL VAL A . n A 1 19 TYR 19 23 23 TYR TYR A . n A 1 20 TYR 20 24 24 TYR TYR A . n A 1 21 PHE 21 25 25 PHE PHE A . n A 1 22 ASN 22 26 26 ASN ASN A . n A 1 23 HIS 23 27 27 HIS HIS A . n A 1 24 ILE 24 28 28 ILE ILE A . n A 1 25 THR 25 29 29 THR THR A . n A 1 26 ASN 26 30 30 ASN ASN A . n A 1 27 ALA 27 31 31 ALA ALA A . n A 1 28 SER 28 32 32 SER SER A . n A 1 29 GLN 29 33 33 GLN GLN A . n A 1 30 TRP 30 34 34 TRP TRP A . n A 1 31 GLU 31 35 35 GLU GLU A . n A 1 32 ARG 32 36 36 ARG ARG A . n A 1 33 PRO 33 37 37 PRO PRO A . n A 1 34 SER 34 38 38 SER SER A . n A 1 35 GLY 35 39 39 GLY GLY A . n A 1 36 ASN 36 40 40 ASN ASN A . n A 1 37 SER 37 41 41 SER SER A . n B 2 1 ACE 1 80 80 ACE ACE B . n B 2 2 GLY 2 81 81 GLY GLY B . n B 2 3 LEU 3 82 82 LEU LEU B . n B 2 4 TYR 4 83 83 TYR TYR B . n B 2 5 ARG 5 84 84 ARG ARG B . n B 2 6 SEP 6 85 85 SEP SEP B . n B 2 7 PRO 7 86 86 PRO PRO B . n B 2 8 PRO 8 87 87 PRO PRO B . n B 2 9 LEU 9 88 88 LEU LEU B . n B 2 10 PRO 10 89 89 PRO PRO B . n B 2 11 GLY 11 90 90 GLY GLY B . n B 2 12 NH2 12 91 91 NH2 NH2 B . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id SEP _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id SEP _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9RPN _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 9RPN _struct.title 'PIN1 WW Domain Binding Mode with LYR-tide' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9RPN _struct_keywords.text 'WW Domain, PIN1, Phosphoserine, Epistatic, PROTEIN BINDING' _struct_keywords.pdbx_keywords 'PROTEIN BINDING' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP PIN1_HUMAN Q13526 ? 1 EKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNS 5 2 PDB 9RPN 9RPN ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 9RPN A 1 ? 37 ? Q13526 5 ? 41 ? 5 41 2 2 9RPN B 1 ? 12 ? 9RPN 80 ? 91 ? 80 91 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_auth_evidence.id _pdbx_struct_assembly_auth_evidence.assembly_id _pdbx_struct_assembly_auth_evidence.experimental_support _pdbx_struct_assembly_auth_evidence.details 1 1 'NMR Distance Restraints' 'not applicable' 2 1 none 'Fluorescence polarisation used for measuring kD' 3 1 none 'NMR 1H-15N HSQC titration used for measuring kD' 4 1 none 'FACS enrichment of Bacterially displayed peptides' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0 _pdbx_struct_oper_list.matrix[1][2] 0.0 _pdbx_struct_oper_list.matrix[1][3] 0.0 _pdbx_struct_oper_list.vector[1] 0.0 _pdbx_struct_oper_list.matrix[2][1] 0.0 _pdbx_struct_oper_list.matrix[2][2] 1.0 _pdbx_struct_oper_list.matrix[2][3] 0.0 _pdbx_struct_oper_list.vector[2] 0.0 _pdbx_struct_oper_list.matrix[3][1] 0.0 _pdbx_struct_oper_list.matrix[3][2] 0.0 _pdbx_struct_oper_list.matrix[3][3] 1.0 _pdbx_struct_oper_list.vector[3] 0.0 # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? B ACE 1 C ? ? ? 1_555 B GLY 2 N ? ? B ACE 80 B GLY 81 1_555 ? ? ? ? ? ? ? 1.325 ? ? covale2 covale both ? B ARG 5 C ? ? ? 1_555 B SEP 6 N ? ? B ARG 84 B SEP 85 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale3 covale both ? B SEP 6 C ? ? ? 1_555 B PRO 7 N ? ? B SEP 85 B PRO 86 1_555 ? ? ? ? ? ? ? 1.327 ? ? covale4 covale both ? B GLY 11 C ? ? ? 1_555 B NH2 12 N ? ? B GLY 90 B NH2 91 1_555 ? ? ? ? ? ? ? 1.321 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 SEP B 6 ? . . . . SEP B 85 ? 1_555 . . . . . . . SER 1 SEP Phosphorylation 'Named protein modification' 2 ACE B 1 ? GLY B 2 ? ACE B 80 ? 1_555 GLY B 81 ? 1_555 . . GLY 12 ACE None 'Terminal acetylation' 3 NH2 B 12 ? GLY B 11 ? NH2 B 91 ? 1_555 GLY B 90 ? 1_555 . . GLY 12 NH2 None 'Terminal amidation' # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TRP A 7 ? MET A 11 ? TRP A 11 MET A 15 AA1 2 VAL A 18 ? ASN A 22 ? VAL A 22 ASN A 26 AA1 3 ALA A 27 ? SER A 28 ? ALA A 31 SER A 32 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLU A 8 ? N GLU A 12 O PHE A 21 ? O PHE A 25 AA1 2 3 N ASN A 22 ? N ASN A 26 O ALA A 27 ? O ALA A 31 # _pdbx_entry_details.entry_id 9RPN _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 6 H A GLU 12 ? ? O A PHE 25 ? ? 1.58 2 8 HG3 A PRO 8 ? ? H A GLY 39 ? ? 1.25 3 25 OE1 A GLU 12 ? ? HH21 A ARG 14 ? ? 1.60 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 33 ? ? -142.12 11.67 2 1 TRP A 34 ? ? 68.90 -50.31 3 1 LEU B 82 ? ? 160.77 -41.63 4 1 TYR B 83 ? ? 61.67 99.54 5 2 GLN A 33 ? ? -145.06 10.95 6 2 TRP A 34 ? ? 69.65 -49.28 7 2 LEU B 82 ? ? 73.00 -55.55 8 2 TYR B 83 ? ? 69.98 113.34 9 2 PRO B 89 ? ? -55.72 106.19 10 3 TRP A 34 ? ? 68.23 -49.20 11 4 ASN A 30 ? ? 65.00 62.18 12 4 TRP A 34 ? ? 70.39 -47.56 13 4 SER A 38 ? ? -142.04 27.01 14 4 TYR B 83 ? ? 69.16 111.99 15 5 TRP A 34 ? ? 71.28 -44.77 16 5 LEU B 82 ? ? 72.98 -45.32 17 5 TYR B 83 ? ? 65.29 103.39 18 6 GLN A 33 ? ? -142.56 10.69 19 6 TRP A 34 ? ? 68.68 -45.04 20 6 TYR B 83 ? ? 67.18 128.61 21 7 GLN A 33 ? ? -145.56 10.78 22 7 TRP A 34 ? ? 69.68 -46.12 23 7 ASN A 40 ? ? -154.94 -91.27 24 7 TYR B 83 ? ? 63.82 121.95 25 8 GLN A 33 ? ? -140.61 11.26 26 8 TRP A 34 ? ? 70.56 -50.85 27 8 SER A 38 ? ? -153.61 84.06 28 8 ASN A 40 ? ? -143.92 -86.48 29 9 TRP A 34 ? ? 68.37 -45.65 30 9 SER A 38 ? ? -140.42 -22.45 31 9 ASN A 40 ? ? 73.28 -178.00 32 9 LEU B 82 ? ? 75.89 -48.52 33 9 TYR B 83 ? ? 67.47 102.31 34 9 PRO B 89 ? ? -74.15 42.06 35 10 GLN A 33 ? ? -145.63 10.41 36 10 TRP A 34 ? ? 69.24 -52.16 37 10 ASN A 40 ? ? -132.70 -81.18 38 11 GLN A 33 ? ? -146.27 12.59 39 11 TRP A 34 ? ? 69.49 -49.20 40 11 ASN A 40 ? ? -61.11 -88.71 41 11 TYR B 83 ? ? 64.71 106.37 42 11 PRO B 89 ? ? -69.84 80.60 43 12 GLN A 33 ? ? -144.96 10.69 44 12 TRP A 34 ? ? 69.78 -48.68 45 12 LEU B 82 ? ? 165.91 -49.36 46 12 TYR B 83 ? ? 59.63 102.67 47 13 TRP A 34 ? ? 68.43 -46.54 48 13 ASN A 40 ? ? 66.53 172.55 49 13 LEU B 82 ? ? 173.64 -39.31 50 13 TYR B 83 ? ? 70.55 110.64 51 14 GLN A 33 ? ? -148.35 16.62 52 14 TRP A 34 ? ? 73.82 -43.28 53 14 LEU B 82 ? ? 70.02 -57.19 54 14 TYR B 83 ? ? 71.11 132.43 55 15 TRP A 34 ? ? 68.88 -46.04 56 15 ASN A 40 ? ? 52.07 179.47 57 15 LEU B 82 ? ? 163.78 -41.80 58 15 TYR B 83 ? ? 63.80 119.87 59 16 TRP A 34 ? ? 71.82 -49.01 60 16 LEU B 82 ? ? -159.10 -52.24 61 16 TYR B 83 ? ? 61.23 107.38 62 17 TRP A 34 ? ? 70.06 -46.86 63 17 ASN A 40 ? ? -144.17 -90.62 64 17 TYR B 83 ? ? 59.45 108.60 65 18 TRP A 34 ? ? 70.03 -48.77 66 18 SER A 38 ? ? -149.37 24.63 67 18 LEU B 82 ? ? 68.69 -56.57 68 18 TYR B 83 ? ? 69.90 109.69 69 19 GLN A 33 ? ? -143.42 10.97 70 19 TRP A 34 ? ? 70.90 -48.27 71 19 LEU B 82 ? ? 71.76 -58.90 72 19 TYR B 83 ? ? 66.16 108.08 73 19 PRO B 89 ? ? -68.81 44.17 74 20 GLN A 33 ? ? -144.03 14.26 75 20 TRP A 34 ? ? 70.29 -45.45 76 20 TYR B 83 ? ? 60.13 100.12 77 21 GLN A 33 ? ? -144.99 10.60 78 21 TRP A 34 ? ? 70.65 -49.76 79 21 LEU B 82 ? ? -162.56 -54.38 80 21 TYR B 83 ? ? 72.98 109.26 81 22 TRP A 34 ? ? 68.84 -49.73 82 22 SER A 38 ? ? -153.18 -0.75 83 22 ASN A 40 ? ? 49.37 -179.57 84 23 TRP A 34 ? ? 70.11 -47.03 85 23 ARG B 84 ? ? -171.13 114.22 86 23 PRO B 89 ? ? -59.45 97.99 87 24 GLN A 33 ? ? -143.18 15.89 88 24 TRP A 34 ? ? 73.55 -43.10 89 24 LEU B 82 ? ? 72.16 -57.29 90 24 TYR B 83 ? ? 68.25 113.24 91 25 GLN A 33 ? ? -143.78 12.60 92 25 TRP A 34 ? ? 72.18 -48.41 93 25 SER A 38 ? ? -147.27 20.80 94 25 LEU B 82 ? ? 72.90 -61.37 95 25 TYR B 83 ? ? 67.32 103.04 96 25 PRO B 89 ? ? -73.93 20.92 # _pdbx_nmr_ensemble.entry_id 9RPN _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 25 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 9RPN _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents ;1000 uM Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 (PIN1) WW Domain bound to epistatic LYR-tide, 2000 uM LYR-tide LYRpSPPLP, 100 mM sodium chloride, 50 mM sodium phosphate, 10 % [U-99% 2H] D2O, 90% H2O/10% D2O ; _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label 'PIN1-LYR sample' _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 (PIN1) WW Domain bound to epistatic LYR-tide' 1000 ? uM 'natural abundance' 1 'LYR-tide LYRpSPPLP' 2000 ? uM 'natural abundance' 1 'sodium chloride' 100 ? mM 'natural abundance' 1 'sodium phosphate' 50 ? mM 'natural abundance' 1 D2O 10 ? % '[U-99% 2H]' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7 _pdbx_nmr_exptl_sample_conditions.ionic_strength 200 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label 'PIN1-LYR conditions' _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-1H NOESY' 1 isotropic 2 1 1 '2D 1H-13C HSQC' 1 isotropic 3 1 1 '2D 1H-1H TOCSY' 1 isotropic 4 1 1 '2D DQF-COSY' 1 isotropic 5 1 1 '2D 1H-15N HSQC' 1 isotropic # _pdbx_nmr_refine.entry_id 9RPN _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 5 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'peak picking' 'CcpNmr Analysis' 3.2.10 'Skinner, S.P., Fogh, R.H., Boucher, W., Ragan, T.J., Mureddu, L.G., and Vuister, G.W' 2 collection TopSpin 3.1 'Bruker Biospin' 4 'chemical shift assignment' 'CcpNmr Analysis' 3.2.10 'Skinner, S.P., Fogh, R.H., Boucher, W., Ragan, T.J., Mureddu, L.G., and Vuister, G.W' 5 'structure calculation' ARIA ? ;Linge, O'Donoghue and Nilges ; # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ACE C C N N 1 ACE O O N N 2 ACE CH3 C N N 3 ACE H H N N 4 ACE H1 H N N 5 ACE H2 H N N 6 ACE H3 H N N 7 ALA N N N N 8 ALA CA C N S 9 ALA C C N N 10 ALA O O N N 11 ALA CB C N N 12 ALA OXT O N N 13 ALA H H N N 14 ALA H2 H N N 15 ALA HA H N N 16 ALA HB1 H N N 17 ALA HB2 H N N 18 ALA HB3 H N N 19 ALA HXT H N N 20 ARG N N N N 21 ARG CA C N S 22 ARG C C N N 23 ARG O O N N 24 ARG CB C N N 25 ARG CG C N N 26 ARG CD C N N 27 ARG NE N N N 28 ARG CZ C N N 29 ARG NH1 N N N 30 ARG NH2 N N N 31 ARG OXT O N N 32 ARG H H N N 33 ARG H2 H N N 34 ARG HA H N N 35 ARG HB2 H N N 36 ARG HB3 H N N 37 ARG HG2 H N N 38 ARG HG3 H N N 39 ARG HD2 H N N 40 ARG HD3 H N N 41 ARG HE H N N 42 ARG HH11 H N N 43 ARG HH12 H N N 44 ARG HH21 H N N 45 ARG HH22 H N N 46 ARG HXT H N N 47 ASN N N N N 48 ASN CA C N S 49 ASN C C N N 50 ASN O O N N 51 ASN CB C N N 52 ASN CG C N N 53 ASN OD1 O N N 54 ASN ND2 N N N 55 ASN OXT O N N 56 ASN H H N N 57 ASN H2 H N N 58 ASN HA H N N 59 ASN HB2 H N N 60 ASN HB3 H N N 61 ASN HD21 H N N 62 ASN HD22 H N N 63 ASN HXT H N N 64 GLN N N N N 65 GLN CA C N S 66 GLN C C N N 67 GLN O O N N 68 GLN CB C N N 69 GLN CG C N N 70 GLN CD C N N 71 GLN OE1 O N N 72 GLN NE2 N N N 73 GLN OXT O N N 74 GLN H H N N 75 GLN H2 H N N 76 GLN HA H N N 77 GLN HB2 H N N 78 GLN HB3 H N N 79 GLN HG2 H N N 80 GLN HG3 H N N 81 GLN HE21 H N N 82 GLN HE22 H N N 83 GLN HXT H N N 84 GLU N N N N 85 GLU CA C N S 86 GLU C C N N 87 GLU O O N N 88 GLU CB C N N 89 GLU CG C N N 90 GLU CD C N N 91 GLU OE1 O N N 92 GLU OE2 O N N 93 GLU OXT O N N 94 GLU H H N N 95 GLU H2 H N N 96 GLU HA H N N 97 GLU HB2 H N N 98 GLU HB3 H N N 99 GLU HG2 H N N 100 GLU HG3 H N N 101 GLU HE2 H N N 102 GLU HXT H N N 103 GLY N N N N 104 GLY CA C N N 105 GLY C C N N 106 GLY O O N N 107 GLY OXT O N N 108 GLY H H N N 109 GLY H2 H N N 110 GLY HA2 H N N 111 GLY HA3 H N N 112 GLY HXT H N N 113 HIS N N N N 114 HIS CA C N S 115 HIS C C N N 116 HIS O O N N 117 HIS CB C N N 118 HIS CG C Y N 119 HIS ND1 N Y N 120 HIS CD2 C Y N 121 HIS CE1 C Y N 122 HIS NE2 N Y N 123 HIS OXT O N N 124 HIS H H N N 125 HIS H2 H N N 126 HIS HA H N N 127 HIS HB2 H N N 128 HIS HB3 H N N 129 HIS HD1 H N N 130 HIS HD2 H N N 131 HIS HE1 H N N 132 HIS HE2 H N N 133 HIS HXT H N N 134 ILE N N N N 135 ILE CA C N S 136 ILE C C N N 137 ILE O O N N 138 ILE CB C N S 139 ILE CG1 C N N 140 ILE CG2 C N N 141 ILE CD1 C N N 142 ILE OXT O N N 143 ILE H H N N 144 ILE H2 H N N 145 ILE HA H N N 146 ILE HB H N N 147 ILE HG12 H N N 148 ILE HG13 H N N 149 ILE HG21 H N N 150 ILE HG22 H N N 151 ILE HG23 H N N 152 ILE HD11 H N N 153 ILE HD12 H N N 154 ILE HD13 H N N 155 ILE HXT H N N 156 LEU N N N N 157 LEU CA C N S 158 LEU C C N N 159 LEU O O N N 160 LEU CB C N N 161 LEU CG C N N 162 LEU CD1 C N N 163 LEU CD2 C N N 164 LEU OXT O N N 165 LEU H H N N 166 LEU H2 H N N 167 LEU HA H N N 168 LEU HB2 H N N 169 LEU HB3 H N N 170 LEU HG H N N 171 LEU HD11 H N N 172 LEU HD12 H N N 173 LEU HD13 H N N 174 LEU HD21 H N N 175 LEU HD22 H N N 176 LEU HD23 H N N 177 LEU HXT H N N 178 LYS N N N N 179 LYS CA C N S 180 LYS C C N N 181 LYS O O N N 182 LYS CB C N N 183 LYS CG C N N 184 LYS CD C N N 185 LYS CE C N N 186 LYS NZ N N N 187 LYS OXT O N N 188 LYS H H N N 189 LYS H2 H N N 190 LYS HA H N N 191 LYS HB2 H N N 192 LYS HB3 H N N 193 LYS HG2 H N N 194 LYS HG3 H N N 195 LYS HD2 H N N 196 LYS HD3 H N N 197 LYS HE2 H N N 198 LYS HE3 H N N 199 LYS HZ1 H N N 200 LYS HZ2 H N N 201 LYS HZ3 H N N 202 LYS HXT H N N 203 MET N N N N 204 MET CA C N S 205 MET C C N N 206 MET O O N N 207 MET CB C N N 208 MET CG C N N 209 MET SD S N N 210 MET CE C N N 211 MET OXT O N N 212 MET H H N N 213 MET H2 H N N 214 MET HA H N N 215 MET HB2 H N N 216 MET HB3 H N N 217 MET HG2 H N N 218 MET HG3 H N N 219 MET HE1 H N N 220 MET HE2 H N N 221 MET HE3 H N N 222 MET HXT H N N 223 NH2 N N N N 224 NH2 HN1 H N N 225 NH2 HN2 H N N 226 PHE N N N N 227 PHE CA C N S 228 PHE C C N N 229 PHE O O N N 230 PHE CB C N N 231 PHE CG C Y N 232 PHE CD1 C Y N 233 PHE CD2 C Y N 234 PHE CE1 C Y N 235 PHE CE2 C Y N 236 PHE CZ C Y N 237 PHE OXT O N N 238 PHE H H N N 239 PHE H2 H N N 240 PHE HA H N N 241 PHE HB2 H N N 242 PHE HB3 H N N 243 PHE HD1 H N N 244 PHE HD2 H N N 245 PHE HE1 H N N 246 PHE HE2 H N N 247 PHE HZ H N N 248 PHE HXT H N N 249 PRO N N N N 250 PRO CA C N S 251 PRO C C N N 252 PRO O O N N 253 PRO CB C N N 254 PRO CG C N N 255 PRO CD C N N 256 PRO OXT O N N 257 PRO H H N N 258 PRO HA H N N 259 PRO HB2 H N N 260 PRO HB3 H N N 261 PRO HG2 H N N 262 PRO HG3 H N N 263 PRO HD2 H N N 264 PRO HD3 H N N 265 PRO HXT H N N 266 SEP N N N N 267 SEP CA C N S 268 SEP CB C N N 269 SEP OG O N N 270 SEP C C N N 271 SEP O O N N 272 SEP OXT O N N 273 SEP P P N N 274 SEP O1P O N N 275 SEP O2P O N N 276 SEP O3P O N N 277 SEP H H N N 278 SEP H2 H N N 279 SEP HA H N N 280 SEP HB2 H N N 281 SEP HB3 H N N 282 SEP HXT H N N 283 SEP HOP2 H N N 284 SEP HOP3 H N N 285 SER N N N N 286 SER CA C N S 287 SER C C N N 288 SER O O N N 289 SER CB C N N 290 SER OG O N N 291 SER OXT O N N 292 SER H H N N 293 SER H2 H N N 294 SER HA H N N 295 SER HB2 H N N 296 SER HB3 H N N 297 SER HG H N N 298 SER HXT H N N 299 THR N N N N 300 THR CA C N S 301 THR C C N N 302 THR O O N N 303 THR CB C N R 304 THR OG1 O N N 305 THR CG2 C N N 306 THR OXT O N N 307 THR H H N N 308 THR H2 H N N 309 THR HA H N N 310 THR HB H N N 311 THR HG1 H N N 312 THR HG21 H N N 313 THR HG22 H N N 314 THR HG23 H N N 315 THR HXT H N N 316 TRP N N N N 317 TRP CA C N S 318 TRP C C N N 319 TRP O O N N 320 TRP CB C N N 321 TRP CG C Y N 322 TRP CD1 C Y N 323 TRP CD2 C Y N 324 TRP NE1 N Y N 325 TRP CE2 C Y N 326 TRP CE3 C Y N 327 TRP CZ2 C Y N 328 TRP CZ3 C Y N 329 TRP CH2 C Y N 330 TRP OXT O N N 331 TRP H H N N 332 TRP H2 H N N 333 TRP HA H N N 334 TRP HB2 H N N 335 TRP HB3 H N N 336 TRP HD1 H N N 337 TRP HE1 H N N 338 TRP HE3 H N N 339 TRP HZ2 H N N 340 TRP HZ3 H N N 341 TRP HH2 H N N 342 TRP HXT H N N 343 TYR N N N N 344 TYR CA C N S 345 TYR C C N N 346 TYR O O N N 347 TYR CB C N N 348 TYR CG C Y N 349 TYR CD1 C Y N 350 TYR CD2 C Y N 351 TYR CE1 C Y N 352 TYR CE2 C Y N 353 TYR CZ C Y N 354 TYR OH O N N 355 TYR OXT O N N 356 TYR H H N N 357 TYR H2 H N N 358 TYR HA H N N 359 TYR HB2 H N N 360 TYR HB3 H N N 361 TYR HD1 H N N 362 TYR HD2 H N N 363 TYR HE1 H N N 364 TYR HE2 H N N 365 TYR HH H N N 366 TYR HXT H N N 367 VAL N N N N 368 VAL CA C N S 369 VAL C C N N 370 VAL O O N N 371 VAL CB C N N 372 VAL CG1 C N N 373 VAL CG2 C N N 374 VAL OXT O N N 375 VAL H H N N 376 VAL H2 H N N 377 VAL HA H N N 378 VAL HB H N N 379 VAL HG11 H N N 380 VAL HG12 H N N 381 VAL HG13 H N N 382 VAL HG21 H N N 383 VAL HG22 H N N 384 VAL HG23 H N N 385 VAL HXT H N N 386 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ACE C O doub N N 1 ACE C CH3 sing N N 2 ACE C H sing N N 3 ACE CH3 H1 sing N N 4 ACE CH3 H2 sing N N 5 ACE CH3 H3 sing N N 6 ALA N CA sing N N 7 ALA N H sing N N 8 ALA N H2 sing N N 9 ALA CA C sing N N 10 ALA CA CB sing N N 11 ALA CA HA sing N N 12 ALA C O doub N N 13 ALA C OXT sing N N 14 ALA CB HB1 sing N N 15 ALA CB HB2 sing N N 16 ALA CB HB3 sing N N 17 ALA OXT HXT sing N N 18 ARG N CA sing N N 19 ARG N H sing N N 20 ARG N H2 sing N N 21 ARG CA C sing N N 22 ARG CA CB sing N N 23 ARG CA HA sing N N 24 ARG C O doub N N 25 ARG C OXT sing N N 26 ARG CB CG sing N N 27 ARG CB HB2 sing N N 28 ARG CB HB3 sing N N 29 ARG CG CD sing N N 30 ARG CG HG2 sing N N 31 ARG CG HG3 sing N N 32 ARG CD NE sing N N 33 ARG CD HD2 sing N N 34 ARG CD HD3 sing N N 35 ARG NE CZ sing N N 36 ARG NE HE sing N N 37 ARG CZ NH1 sing N N 38 ARG CZ NH2 doub N N 39 ARG NH1 HH11 sing N N 40 ARG NH1 HH12 sing N N 41 ARG NH2 HH21 sing N N 42 ARG NH2 HH22 sing N N 43 ARG OXT HXT sing N N 44 ASN N CA sing N N 45 ASN N H sing N N 46 ASN N H2 sing N N 47 ASN CA C sing N N 48 ASN CA CB sing N N 49 ASN CA HA sing N N 50 ASN C O doub N N 51 ASN C OXT sing N N 52 ASN CB CG sing N N 53 ASN CB HB2 sing N N 54 ASN CB HB3 sing N N 55 ASN CG OD1 doub N N 56 ASN CG ND2 sing N N 57 ASN ND2 HD21 sing N N 58 ASN ND2 HD22 sing N N 59 ASN OXT HXT sing N N 60 GLN N CA sing N N 61 GLN N H sing N N 62 GLN N H2 sing N N 63 GLN CA C sing N N 64 GLN CA CB sing N N 65 GLN CA HA sing N N 66 GLN C O doub N N 67 GLN C OXT sing N N 68 GLN CB CG sing N N 69 GLN CB HB2 sing N N 70 GLN CB HB3 sing N N 71 GLN CG CD sing N N 72 GLN CG HG2 sing N N 73 GLN CG HG3 sing N N 74 GLN CD OE1 doub N N 75 GLN CD NE2 sing N N 76 GLN NE2 HE21 sing N N 77 GLN NE2 HE22 sing N N 78 GLN OXT HXT sing N N 79 GLU N CA sing N N 80 GLU N H sing N N 81 GLU N H2 sing N N 82 GLU CA C sing N N 83 GLU CA CB sing N N 84 GLU CA HA sing N N 85 GLU C O doub N N 86 GLU C OXT sing N N 87 GLU CB CG sing N N 88 GLU CB HB2 sing N N 89 GLU CB HB3 sing N N 90 GLU CG CD sing N N 91 GLU CG HG2 sing N N 92 GLU CG HG3 sing N N 93 GLU CD OE1 doub N N 94 GLU CD OE2 sing N N 95 GLU OE2 HE2 sing N N 96 GLU OXT HXT sing N N 97 GLY N CA sing N N 98 GLY N H sing N N 99 GLY N H2 sing N N 100 GLY CA C sing N N 101 GLY CA HA2 sing N N 102 GLY CA HA3 sing N N 103 GLY C O doub N N 104 GLY C OXT sing N N 105 GLY OXT HXT sing N N 106 HIS N CA sing N N 107 HIS N H sing N N 108 HIS N H2 sing N N 109 HIS CA C sing N N 110 HIS CA CB sing N N 111 HIS CA HA sing N N 112 HIS C O doub N N 113 HIS C OXT sing N N 114 HIS CB CG sing N N 115 HIS CB HB2 sing N N 116 HIS CB HB3 sing N N 117 HIS CG ND1 sing Y N 118 HIS CG CD2 doub Y N 119 HIS ND1 CE1 doub Y N 120 HIS ND1 HD1 sing N N 121 HIS CD2 NE2 sing Y N 122 HIS CD2 HD2 sing N N 123 HIS CE1 NE2 sing Y N 124 HIS CE1 HE1 sing N N 125 HIS NE2 HE2 sing N N 126 HIS OXT HXT sing N N 127 ILE N CA sing N N 128 ILE N H sing N N 129 ILE N H2 sing N N 130 ILE CA C sing N N 131 ILE CA CB sing N N 132 ILE CA HA sing N N 133 ILE C O doub N N 134 ILE C OXT sing N N 135 ILE CB CG1 sing N N 136 ILE CB CG2 sing N N 137 ILE CB HB sing N N 138 ILE CG1 CD1 sing N N 139 ILE CG1 HG12 sing N N 140 ILE CG1 HG13 sing N N 141 ILE CG2 HG21 sing N N 142 ILE CG2 HG22 sing N N 143 ILE CG2 HG23 sing N N 144 ILE CD1 HD11 sing N N 145 ILE CD1 HD12 sing N N 146 ILE CD1 HD13 sing N N 147 ILE OXT HXT sing N N 148 LEU N CA sing N N 149 LEU N H sing N N 150 LEU N H2 sing N N 151 LEU CA C sing N N 152 LEU CA CB sing N N 153 LEU CA HA sing N N 154 LEU C O doub N N 155 LEU C OXT sing N N 156 LEU CB CG sing N N 157 LEU CB HB2 sing N N 158 LEU CB HB3 sing N N 159 LEU CG CD1 sing N N 160 LEU CG CD2 sing N N 161 LEU CG HG sing N N 162 LEU CD1 HD11 sing N N 163 LEU CD1 HD12 sing N N 164 LEU CD1 HD13 sing N N 165 LEU CD2 HD21 sing N N 166 LEU CD2 HD22 sing N N 167 LEU CD2 HD23 sing N N 168 LEU OXT HXT sing N N 169 LYS N CA sing N N 170 LYS N H sing N N 171 LYS N H2 sing N N 172 LYS CA C sing N N 173 LYS CA CB sing N N 174 LYS CA HA sing N N 175 LYS C O doub N N 176 LYS C OXT sing N N 177 LYS CB CG sing N N 178 LYS CB HB2 sing N N 179 LYS CB HB3 sing N N 180 LYS CG CD sing N N 181 LYS CG HG2 sing N N 182 LYS CG HG3 sing N N 183 LYS CD CE sing N N 184 LYS CD HD2 sing N N 185 LYS CD HD3 sing N N 186 LYS CE NZ sing N N 187 LYS CE HE2 sing N N 188 LYS CE HE3 sing N N 189 LYS NZ HZ1 sing N N 190 LYS NZ HZ2 sing N N 191 LYS NZ HZ3 sing N N 192 LYS OXT HXT sing N N 193 MET N CA sing N N 194 MET N H sing N N 195 MET N H2 sing N N 196 MET CA C sing N N 197 MET CA CB sing N N 198 MET CA HA sing N N 199 MET C O doub N N 200 MET C OXT sing N N 201 MET CB CG sing N N 202 MET CB HB2 sing N N 203 MET CB HB3 sing N N 204 MET CG SD sing N N 205 MET CG HG2 sing N N 206 MET CG HG3 sing N N 207 MET SD CE sing N N 208 MET CE HE1 sing N N 209 MET CE HE2 sing N N 210 MET CE HE3 sing N N 211 MET OXT HXT sing N N 212 NH2 N HN1 sing N N 213 NH2 N HN2 sing N N 214 PHE N CA sing N N 215 PHE N H sing N N 216 PHE N H2 sing N N 217 PHE CA C sing N N 218 PHE CA CB sing N N 219 PHE CA HA sing N N 220 PHE C O doub N N 221 PHE C OXT sing N N 222 PHE CB CG sing N N 223 PHE CB HB2 sing N N 224 PHE CB HB3 sing N N 225 PHE CG CD1 doub Y N 226 PHE CG CD2 sing Y N 227 PHE CD1 CE1 sing Y N 228 PHE CD1 HD1 sing N N 229 PHE CD2 CE2 doub Y N 230 PHE CD2 HD2 sing N N 231 PHE CE1 CZ doub Y N 232 PHE CE1 HE1 sing N N 233 PHE CE2 CZ sing Y N 234 PHE CE2 HE2 sing N N 235 PHE CZ HZ sing N N 236 PHE OXT HXT sing N N 237 PRO N CA sing N N 238 PRO N CD sing N N 239 PRO N H sing N N 240 PRO CA C sing N N 241 PRO CA CB sing N N 242 PRO CA HA sing N N 243 PRO C O doub N N 244 PRO C OXT sing N N 245 PRO CB CG sing N N 246 PRO CB HB2 sing N N 247 PRO CB HB3 sing N N 248 PRO CG CD sing N N 249 PRO CG HG2 sing N N 250 PRO CG HG3 sing N N 251 PRO CD HD2 sing N N 252 PRO CD HD3 sing N N 253 PRO OXT HXT sing N N 254 SEP N CA sing N N 255 SEP N H sing N N 256 SEP N H2 sing N N 257 SEP CA CB sing N N 258 SEP CA C sing N N 259 SEP CA HA sing N N 260 SEP CB OG sing N N 261 SEP CB HB2 sing N N 262 SEP CB HB3 sing N N 263 SEP OG P sing N N 264 SEP C O doub N N 265 SEP C OXT sing N N 266 SEP OXT HXT sing N N 267 SEP P O1P doub N N 268 SEP P O2P sing N N 269 SEP P O3P sing N N 270 SEP O2P HOP2 sing N N 271 SEP O3P HOP3 sing N N 272 SER N CA sing N N 273 SER N H sing N N 274 SER N H2 sing N N 275 SER CA C sing N N 276 SER CA CB sing N N 277 SER CA HA sing N N 278 SER C O doub N N 279 SER C OXT sing N N 280 SER CB OG sing N N 281 SER CB HB2 sing N N 282 SER CB HB3 sing N N 283 SER OG HG sing N N 284 SER OXT HXT sing N N 285 THR N CA sing N N 286 THR N H sing N N 287 THR N H2 sing N N 288 THR CA C sing N N 289 THR CA CB sing N N 290 THR CA HA sing N N 291 THR C O doub N N 292 THR C OXT sing N N 293 THR CB OG1 sing N N 294 THR CB CG2 sing N N 295 THR CB HB sing N N 296 THR OG1 HG1 sing N N 297 THR CG2 HG21 sing N N 298 THR CG2 HG22 sing N N 299 THR CG2 HG23 sing N N 300 THR OXT HXT sing N N 301 TRP N CA sing N N 302 TRP N H sing N N 303 TRP N H2 sing N N 304 TRP CA C sing N N 305 TRP CA CB sing N N 306 TRP CA HA sing N N 307 TRP C O doub N N 308 TRP C OXT sing N N 309 TRP CB CG sing N N 310 TRP CB HB2 sing N N 311 TRP CB HB3 sing N N 312 TRP CG CD1 doub Y N 313 TRP CG CD2 sing Y N 314 TRP CD1 NE1 sing Y N 315 TRP CD1 HD1 sing N N 316 TRP CD2 CE2 doub Y N 317 TRP CD2 CE3 sing Y N 318 TRP NE1 CE2 sing Y N 319 TRP NE1 HE1 sing N N 320 TRP CE2 CZ2 sing Y N 321 TRP CE3 CZ3 doub Y N 322 TRP CE3 HE3 sing N N 323 TRP CZ2 CH2 doub Y N 324 TRP CZ2 HZ2 sing N N 325 TRP CZ3 CH2 sing Y N 326 TRP CZ3 HZ3 sing N N 327 TRP CH2 HH2 sing N N 328 TRP OXT HXT sing N N 329 TYR N CA sing N N 330 TYR N H sing N N 331 TYR N H2 sing N N 332 TYR CA C sing N N 333 TYR CA CB sing N N 334 TYR CA HA sing N N 335 TYR C O doub N N 336 TYR C OXT sing N N 337 TYR CB CG sing N N 338 TYR CB HB2 sing N N 339 TYR CB HB3 sing N N 340 TYR CG CD1 doub Y N 341 TYR CG CD2 sing Y N 342 TYR CD1 CE1 sing Y N 343 TYR CD1 HD1 sing N N 344 TYR CD2 CE2 doub Y N 345 TYR CD2 HD2 sing N N 346 TYR CE1 CZ doub Y N 347 TYR CE1 HE1 sing N N 348 TYR CE2 CZ sing Y N 349 TYR CE2 HE2 sing N N 350 TYR CZ OH sing N N 351 TYR OH HH sing N N 352 TYR OXT HXT sing N N 353 VAL N CA sing N N 354 VAL N H sing N N 355 VAL N H2 sing N N 356 VAL CA C sing N N 357 VAL CA CB sing N N 358 VAL CA HA sing N N 359 VAL C O doub N N 360 VAL C OXT sing N N 361 VAL CB CG1 sing N N 362 VAL CB CG2 sing N N 363 VAL CB HB sing N N 364 VAL CG1 HG11 sing N N 365 VAL CG1 HG12 sing N N 366 VAL CG1 HG13 sing N N 367 VAL CG2 HG21 sing N N 368 VAL CG2 HG22 sing N N 369 VAL CG2 HG23 sing N N 370 VAL OXT HXT sing N N 371 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Cancer Research UK' 'United Kingdom' 'CRUK C9545/A29580' 1 'Cancer Research UK' 'United Kingdom' C9685/A26398 2 'Human Frontier Science Program (HFSP)' France 'HFSP: RGEC27/2024' 3 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.details ? # _atom_sites.entry_id 9RPN _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O P S # loop_ #