data_9RPU # _entry.id 9RPU # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.416 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9RPU pdb_00009rpu 10.2210/pdb9rpu/pdb WWPDB D_1292148856 ? ? BMRB 35005 ? 10.13018/BMR35005 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-09-09 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr . _pdbx_database_status.entry_id 9RPU _pdbx_database_status.recvd_initial_deposition_date 2025-06-25 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs . _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category CASD-NMR _pdbx_database_status.pdb_format_compatible Y # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB . 9RPN unspecified BMRB 'PIN1 WW Domain Binding Mode with SPY-tide' 35005 unspecified # loop_ _pdbx_contact_author.id _pdbx_contact_author.email _pdbx_contact_author.name_first _pdbx_contact_author.name_last _pdbx_contact_author.name_mi _pdbx_contact_author.role _pdbx_contact_author.identifier_ORCID 3 pau.creixell@cruk.cam.ac.uk Pau Creixell ? 'principal investigator/group leader' 0000-0001-7529-3029 4 hrm28@cam.ac.uk Helen Mott ? 'principal investigator/group leader' 0000-0002-7890-7097 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Jiang, M.' 1 0000-0002-6046-9439 'Sun, M.' 2 0009-0005-8597-1985 'Mott, H.' 3 0000-0002-7890-7097 'Creixell, P.' 4 0000-0001-7529-3029 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title ;Identifying molecular determinants of epistasis and engineering protein superbinders with combinatorial deep mutational scanning libraries ; _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Jiang, M.' 1 0000-0002-6046-9439 primary 'Sun, M.' 2 0009-0005-8597-1985 primary 'Nuo, C.' 3 0000-0002-2614-8682 primary 'Ord, M.' 4 0000-0003-0454-7241 primary 'Augustin, T.L.' 5 0000-0003-0805-513X primary 'Li, A.' 6 0000-0003-2359-7703 primary 'Shah, N.H.' 7 0000-0002-1186-0626 primary 'Rinehart, J.' 8 0000-0003-4839-4005 primary 'Mott, H.' 9 0000-0002-7890-7097 primary 'Creixell, P.' 10 0000-0001-7529-3029 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1' 4360.806 1 5.2.1.8 ? ? ? 2 polymer man 'SPY-tide SPYpSPFPE' 1141.105 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Peptidyl-prolyl cis-trans isomerase Pin1,PPIase Pin1,Rotamase Pin1' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no EKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNS EKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNS A ? 2 'polypeptide(L)' no yes '(ACE)GSPY(SEP)PFPEG(NH2)' XGSPYSPFPEGX B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLU n 1 2 LYS n 1 3 LEU n 1 4 PRO n 1 5 PRO n 1 6 GLY n 1 7 TRP n 1 8 GLU n 1 9 LYS n 1 10 ARG n 1 11 MET n 1 12 SER n 1 13 ARG n 1 14 SER n 1 15 SER n 1 16 GLY n 1 17 ARG n 1 18 VAL n 1 19 TYR n 1 20 TYR n 1 21 PHE n 1 22 ASN n 1 23 HIS n 1 24 ILE n 1 25 THR n 1 26 ASN n 1 27 ALA n 1 28 SER n 1 29 GLN n 1 30 TRP n 1 31 GLU n 1 32 ARG n 1 33 PRO n 1 34 SER n 1 35 GLY n 1 36 ASN n 1 37 SER n 2 1 ACE n 2 2 GLY n 2 3 SER n 2 4 PRO n 2 5 TYR n 2 6 SEP n 2 7 PRO n 2 8 PHE n 2 9 PRO n 2 10 GLU n 2 11 GLY n 2 12 NH2 n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 37 human ? PIN1 ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 sample 'Biological sequence' 1 12 ? ? ? ? ? ? ? ? ? 'synthetic construct' 32630 ? ? ? ? ? ? ? ? 'synthetic construct' 32630 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ACE non-polymer . 'ACETYL GROUP' ? 'C2 H4 O' 44.053 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NH2 non-polymer . 'AMINO GROUP' ? 'H2 N' 16.023 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SEP 'L-peptide linking' n PHOSPHOSERINE PHOSPHONOSERINE 'C3 H8 N O6 P' 185.072 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLU 1 5 5 GLU GLU A . n A 1 2 LYS 2 6 6 LYS LYS A . n A 1 3 LEU 3 7 7 LEU LEU A . n A 1 4 PRO 4 8 8 PRO PRO A . n A 1 5 PRO 5 9 9 PRO PRO A . n A 1 6 GLY 6 10 10 GLY GLY A . n A 1 7 TRP 7 11 11 TRP TRP A . n A 1 8 GLU 8 12 12 GLU GLU A . n A 1 9 LYS 9 13 13 LYS LYS A . n A 1 10 ARG 10 14 14 ARG ARG A . n A 1 11 MET 11 15 15 MET MET A . n A 1 12 SER 12 16 16 SER SER A . n A 1 13 ARG 13 17 17 ARG ARG A . n A 1 14 SER 14 18 18 SER SER A . n A 1 15 SER 15 19 19 SER SER A . n A 1 16 GLY 16 20 20 GLY GLY A . n A 1 17 ARG 17 21 21 ARG ARG A . n A 1 18 VAL 18 22 22 VAL VAL A . n A 1 19 TYR 19 23 23 TYR TYR A . n A 1 20 TYR 20 24 24 TYR TYR A . n A 1 21 PHE 21 25 25 PHE PHE A . n A 1 22 ASN 22 26 26 ASN ASN A . n A 1 23 HIS 23 27 27 HIS HIS A . n A 1 24 ILE 24 28 28 ILE ILE A . n A 1 25 THR 25 29 29 THR THR A . n A 1 26 ASN 26 30 30 ASN ASN A . n A 1 27 ALA 27 31 31 ALA ALA A . n A 1 28 SER 28 32 32 SER SER A . n A 1 29 GLN 29 33 33 GLN GLN A . n A 1 30 TRP 30 34 34 TRP TRP A . n A 1 31 GLU 31 35 35 GLU GLU A . n A 1 32 ARG 32 36 36 ARG ARG A . n A 1 33 PRO 33 37 37 PRO PRO A . n A 1 34 SER 34 38 38 SER SER A . n A 1 35 GLY 35 39 39 GLY GLY A . n A 1 36 ASN 36 40 40 ASN ASN A . n A 1 37 SER 37 41 41 SER SER A . n B 2 1 ACE 1 80 80 ACE ACE B . n B 2 2 GLY 2 81 81 GLY GLY B . n B 2 3 SER 3 82 82 SER SER B . n B 2 4 PRO 4 83 83 PRO PRO B . n B 2 5 TYR 5 84 84 TYR TYR B . n B 2 6 SEP 6 85 85 SEP SEP B . n B 2 7 PRO 7 86 86 PRO PRO B . n B 2 8 PHE 8 87 87 PHE PHE B . n B 2 9 PRO 9 88 88 PRO PRO B . n B 2 10 GLU 10 89 89 GLU GLU B . n B 2 11 GLY 11 90 90 GLY GLY B . n B 2 12 NH2 12 91 91 NH2 NH2 B . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id SEP _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id SEP _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9RPU _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 9RPU _struct.title 'PIN1 WW Domain Binding Mode with SPY-tide' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9RPU _struct_keywords.text 'WW Domain, PIN1, Phosphoserine, Epistatic, PROTEIN BINDING' _struct_keywords.pdbx_keywords 'PROTEIN BINDING' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP PIN1_HUMAN Q13526 ? 1 EKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNS 5 2 PDB 9RPU 9RPU ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 9RPU A 1 ? 37 ? Q13526 5 ? 41 ? 5 41 2 2 9RPU B 1 ? 12 ? 9RPU 80 ? 91 ? 80 91 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_auth_evidence.id _pdbx_struct_assembly_auth_evidence.assembly_id _pdbx_struct_assembly_auth_evidence.experimental_support _pdbx_struct_assembly_auth_evidence.details 1 1 'NMR Distance Restraints' 'not applicable' 2 1 none 'Fluorescence polarisation used for measuring kD' 3 1 none 'NMR 1H-15N HSQC titration used for measuring kD' 4 1 none 'FACS enrichment of Bacterially displayed peptides' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0 _pdbx_struct_oper_list.matrix[1][2] 0.0 _pdbx_struct_oper_list.matrix[1][3] 0.0 _pdbx_struct_oper_list.vector[1] 0.0 _pdbx_struct_oper_list.matrix[2][1] 0.0 _pdbx_struct_oper_list.matrix[2][2] 1.0 _pdbx_struct_oper_list.matrix[2][3] 0.0 _pdbx_struct_oper_list.vector[2] 0.0 _pdbx_struct_oper_list.matrix[3][1] 0.0 _pdbx_struct_oper_list.matrix[3][2] 0.0 _pdbx_struct_oper_list.matrix[3][3] 1.0 _pdbx_struct_oper_list.vector[3] 0.0 # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? B ACE 1 C ? ? ? 1_555 B GLY 2 N ? ? B ACE 80 B GLY 81 1_555 ? ? ? ? ? ? ? 1.326 ? ? covale2 covale both ? B TYR 5 C ? ? ? 1_555 B SEP 6 N ? ? B TYR 84 B SEP 85 1_555 ? ? ? ? ? ? ? 1.334 ? ? covale3 covale both ? B SEP 6 C ? ? ? 1_555 B PRO 7 N ? ? B SEP 85 B PRO 86 1_555 ? ? ? ? ? ? ? 1.337 ? ? covale4 covale both ? B GLY 11 C ? ? ? 1_555 B NH2 12 N ? ? B GLY 90 B NH2 91 1_555 ? ? ? ? ? ? ? 1.325 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 SEP B 6 ? . . . . SEP B 85 ? 1_555 . . . . . . . SER 1 SEP Phosphorylation 'Named protein modification' 2 ACE B 1 ? GLY B 2 ? ACE B 80 ? 1_555 GLY B 81 ? 1_555 . . GLY 12 ACE None 'Terminal acetylation' 3 NH2 B 12 ? GLY B 11 ? NH2 B 91 ? 1_555 GLY B 90 ? 1_555 . . GLY 12 NH2 None 'Terminal amidation' # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TRP A 7 ? MET A 11 ? TRP A 11 MET A 15 AA1 2 VAL A 18 ? ASN A 22 ? VAL A 22 ASN A 26 AA1 3 ALA A 27 ? GLN A 29 ? ALA A 31 GLN A 33 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLU A 8 ? N GLU A 12 O PHE A 21 ? O PHE A 25 AA1 2 3 N TYR A 20 ? N TYR A 24 O GLN A 29 ? O GLN A 33 # _pdbx_entry_details.entry_id 9RPU _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 2 HA3 A GLY 10 ? ? HD13 A ILE 28 ? ? 1.31 2 2 OE1 A GLU 12 ? ? HD1 A HIS 27 ? ? 1.57 3 3 O A SER 18 ? ? HG A SER 19 ? ? 1.57 4 3 OE2 A GLU 12 ? ? HD1 A HIS 27 ? ? 1.60 5 5 OE2 A GLU 12 ? ? HD1 A HIS 27 ? ? 1.59 6 6 OE2 A GLU 12 ? ? HD1 A HIS 27 ? ? 1.58 7 7 OE2 A GLU 12 ? ? HD1 A HIS 27 ? ? 1.59 8 8 OE1 A GLU 12 ? ? HD1 A HIS 27 ? ? 1.59 9 9 OE1 A GLU 12 ? ? HD1 A HIS 27 ? ? 1.58 10 10 O A GLU 12 ? ? H A PHE 25 ? ? 1.60 11 12 HG A SER 16 ? ? HH2 A TRP 34 ? ? 1.30 12 12 OE1 A GLU 12 ? ? HD1 A HIS 27 ? ? 1.57 13 13 OE1 A GLU 12 ? ? HD1 A HIS 27 ? ? 1.60 14 14 HG A SER 16 ? ? HH2 A TRP 34 ? ? 1.29 15 14 OE2 A GLU 12 ? ? HD1 A HIS 27 ? ? 1.60 16 15 HB2 A SER 18 ? ? HB3 B PRO 88 ? ? 1.34 17 15 OE1 A GLU 12 ? ? HD1 A HIS 27 ? ? 1.57 18 16 HA3 A GLY 10 ? ? HD11 A ILE 28 ? ? 1.32 19 17 HH A TYR 23 ? ? O B TYR 84 ? ? 1.55 20 20 HE A ARG 21 ? ? HG3 B GLU 89 ? ? 1.30 21 21 HG A SER 16 ? ? HH2 A TRP 34 ? ? 1.18 22 21 OE2 A GLU 12 ? ? HD1 A HIS 27 ? ? 1.59 23 22 HG A SER 16 ? ? HH2 A TRP 34 ? ? 1.31 24 22 O A SER 18 ? ? HG A SER 19 ? ? 1.57 25 24 OE2 A GLU 12 ? ? HD1 A HIS 27 ? ? 1.59 26 25 HA3 A GLY 10 ? ? HD11 A ILE 28 ? ? 1.26 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 19 ? ? 78.17 111.44 2 1 THR A 29 ? ? -144.51 19.28 3 1 ASN A 30 ? ? 60.71 75.91 4 1 SER B 82 ? ? 62.68 167.68 5 1 TYR B 84 ? ? -111.08 -81.46 6 1 PRO B 86 ? ? -77.51 -162.45 7 1 PHE B 87 ? ? -51.92 98.41 8 2 SER A 19 ? ? 71.01 122.04 9 2 ASN A 30 ? ? 64.21 65.97 10 2 SER B 82 ? ? 63.10 165.88 11 2 TYR B 84 ? ? -109.18 -71.56 12 2 PHE B 87 ? ? -53.09 99.03 13 3 SER A 19 ? ? 69.80 129.59 14 3 ASN A 30 ? ? 62.80 75.27 15 3 SER A 38 ? ? -87.13 37.54 16 3 TYR B 84 ? ? -103.71 -79.42 17 3 PHE B 87 ? ? -54.52 98.63 18 4 SER A 19 ? ? 68.48 104.56 19 4 ASN A 30 ? ? 60.11 73.60 20 4 ASN A 40 ? ? -152.82 -84.93 21 4 SER B 82 ? ? 61.61 166.13 22 4 TYR B 84 ? ? -94.15 -81.49 23 4 PRO B 86 ? ? -76.71 -167.30 24 4 PHE B 87 ? ? -51.90 99.83 25 5 SER A 19 ? ? 70.82 119.23 26 5 ASN A 30 ? ? 62.08 73.66 27 5 ASN A 40 ? ? -144.31 -62.04 28 5 TYR B 84 ? ? -102.33 -78.45 29 5 PHE B 87 ? ? -53.04 97.98 30 5 GLU B 89 ? ? -80.57 -77.41 31 6 SER A 19 ? ? 76.94 124.55 32 6 ASN A 30 ? ? 61.76 70.53 33 6 ASN A 40 ? ? 70.55 111.26 34 6 TYR B 84 ? ? -101.39 -68.59 35 6 PRO B 86 ? ? -76.93 -162.47 36 6 PHE B 87 ? ? -51.82 98.45 37 7 SER A 19 ? ? 72.76 114.25 38 7 THR A 29 ? ? -141.35 15.53 39 7 ASN A 30 ? ? 60.86 80.06 40 7 TYR B 84 ? ? -105.44 -77.42 41 7 PHE B 87 ? ? -53.87 99.71 42 8 SER A 19 ? ? 74.91 124.52 43 8 THR A 29 ? ? -144.75 13.22 44 8 ASN A 30 ? ? 68.61 74.95 45 8 SER B 82 ? ? 64.74 158.56 46 8 TYR B 84 ? ? -104.34 -68.06 47 8 PRO B 86 ? ? -74.98 -166.46 48 8 PHE B 87 ? ? -56.86 99.55 49 9 SER A 19 ? ? 75.20 113.71 50 9 TYR B 84 ? ? -94.53 -74.81 51 9 PRO B 86 ? ? -79.13 -159.28 52 9 PHE B 87 ? ? -52.09 96.56 53 10 SER A 19 ? ? 75.79 130.63 54 10 THR A 29 ? ? -142.00 19.90 55 10 ASN A 40 ? ? -163.84 95.49 56 10 SER B 82 ? ? 59.23 173.42 57 10 TYR B 84 ? ? -105.21 -79.07 58 10 PHE B 87 ? ? -53.74 99.77 59 11 SER A 19 ? ? 76.82 131.75 60 11 THR A 29 ? ? -140.80 17.24 61 11 ASN A 40 ? ? 61.21 -166.07 62 11 SER B 82 ? ? 64.50 164.17 63 11 TYR B 84 ? ? -106.36 -72.79 64 11 PRO B 86 ? ? -67.38 -110.29 65 11 GLU B 89 ? ? -97.34 -73.83 66 12 SER A 19 ? ? 70.90 103.63 67 12 THR A 29 ? ? -145.13 19.88 68 12 ASN A 30 ? ? 57.90 78.74 69 12 SER B 82 ? ? 61.38 171.69 70 12 TYR B 84 ? ? -104.05 -78.72 71 12 PHE B 87 ? ? -55.00 98.82 72 13 SER A 19 ? ? 71.47 114.98 73 13 ASN A 30 ? ? 61.00 69.88 74 13 SER B 82 ? ? 59.33 170.89 75 13 TYR B 84 ? ? -107.33 -75.83 76 13 PHE B 87 ? ? -56.04 100.25 77 14 SER A 19 ? ? 74.39 121.84 78 14 THR A 29 ? ? -150.37 18.33 79 14 ASN A 30 ? ? 64.21 82.14 80 14 SER B 82 ? ? 59.81 168.55 81 14 TYR B 84 ? ? -111.98 -71.13 82 14 PRO B 86 ? ? -77.98 -161.94 83 14 PHE B 87 ? ? -53.39 97.58 84 15 SER A 19 ? ? 70.92 95.49 85 15 THR A 29 ? ? -144.90 20.56 86 15 TYR B 84 ? ? -106.88 -79.02 87 15 PHE B 87 ? ? -50.83 99.05 88 16 SER A 19 ? ? 72.14 101.45 89 16 ASN A 30 ? ? 59.89 70.38 90 16 SER B 82 ? ? 58.93 178.10 91 16 TYR B 84 ? ? -108.98 -85.05 92 16 PRO B 86 ? ? -79.74 -157.46 93 16 PHE B 87 ? ? -56.37 98.17 94 17 SER A 19 ? ? 73.28 127.36 95 17 ASN A 30 ? ? 61.86 79.51 96 17 ASN A 40 ? ? 175.78 -48.27 97 17 SER B 82 ? ? 67.02 156.27 98 17 TYR B 84 ? ? -99.09 54.89 99 17 SEP B 85 ? ? 163.52 70.61 100 17 PRO B 86 ? ? -76.39 -164.62 101 17 PHE B 87 ? ? -58.42 100.27 102 18 SER A 19 ? ? 82.51 121.60 103 18 ASN A 30 ? ? 61.70 66.99 104 18 ASN A 40 ? ? 69.57 -67.80 105 18 SER B 82 ? ? 65.85 154.19 106 18 PRO B 86 ? ? -74.34 -162.18 107 18 PHE B 87 ? ? -55.54 97.41 108 19 SER A 19 ? ? 69.33 98.34 109 19 THR A 29 ? ? -153.18 22.10 110 19 ASN A 30 ? ? 63.45 86.13 111 19 SER B 82 ? ? 65.00 159.21 112 19 TYR B 84 ? ? -108.67 -78.53 113 19 PRO B 86 ? ? -77.67 -161.84 114 19 PHE B 87 ? ? -54.72 99.63 115 20 SER A 19 ? ? 77.36 111.40 116 20 ASN A 40 ? ? -162.96 -51.01 117 20 SER B 82 ? ? 68.42 166.71 118 20 TYR B 84 ? ? -96.53 -86.19 119 20 PRO B 86 ? ? -75.23 -165.46 120 20 PHE B 87 ? ? -45.49 96.51 121 21 SER A 19 ? ? 72.83 114.36 122 21 THR A 29 ? ? -140.57 12.89 123 21 SER B 82 ? ? 62.58 161.99 124 21 PRO B 86 ? ? -76.57 -163.15 125 21 PHE B 87 ? ? -53.02 98.98 126 21 GLU B 89 ? ? -80.47 -75.78 127 22 SER A 19 ? ? 64.65 128.99 128 22 THR A 29 ? ? -143.47 19.53 129 22 ASN A 40 ? ? -133.63 -53.56 130 22 TYR B 84 ? ? -98.54 -73.46 131 22 PHE B 87 ? ? -52.97 98.77 132 23 SER A 19 ? ? 75.41 125.69 133 23 ASN A 30 ? ? 60.61 75.94 134 23 SER B 82 ? ? 66.02 169.44 135 23 TYR B 84 ? ? -96.74 -89.81 136 23 PRO B 86 ? ? -77.10 -162.72 137 23 PHE B 87 ? ? -50.24 95.87 138 23 GLU B 89 ? ? -79.71 -72.04 139 24 SER A 19 ? ? 72.37 104.58 140 24 THR A 29 ? ? -144.76 20.44 141 24 ASN A 30 ? ? 60.27 79.20 142 24 TYR B 84 ? ? -101.45 -69.12 143 24 PHE B 87 ? ? -53.38 99.38 144 25 SER A 19 ? ? 71.48 107.03 145 25 SER B 82 ? ? 57.11 174.84 146 25 TYR B 84 ? ? -113.54 -81.36 147 25 PRO B 86 ? ? -78.77 -157.22 148 25 PHE B 87 ? ? -55.59 98.11 # _pdbx_nmr_ensemble.entry_id 9RPU _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 25 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 9RPU _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents ;1000 uM Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 (PIN1) WW Domain bound to epistatic SPY-tide, 2000 uM SPY-tide SPYpSPFPE, 100 mM sodium chloride, 50 mM sodium phosphate, 10 % [U-99% 2H] D2O, 90% H2O/10% D2O ; _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label 'PIN1-SPY sample' _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 (PIN1) WW Domain bound to epistatic SPY-tide' 1000 ? uM 'natural abundance' 1 'SPY-tide SPYpSPFPE' 2000 ? uM 'natural abundance' 1 'sodium chloride' 100 ? mM 'natural abundance' 1 'sodium phosphate' 50 ? mM 'natural abundance' 1 D2O 10 ? % '[U-99% 2H]' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7 _pdbx_nmr_exptl_sample_conditions.ionic_strength 200 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label 'PIN1-SPY conditions' _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-1H NOESY' 1 isotropic 2 1 1 '2D 1H-13C HSQC' 1 isotropic 3 1 1 '2D 1H-1H TOCSY' 1 isotropic 4 1 1 '2D DQF-COSY' 1 isotropic 5 1 1 '2D 1H-15N HSQC' 1 isotropic # _pdbx_nmr_refine.entry_id 9RPU _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 5 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'peak picking' 'CcpNmr Analysis' 3.2.10 'Skinner, S.P., Fogh, R.H., Boucher, W., Ragan, T.J., Mureddu, L.G., and Vuister, G.W' 2 collection TopSpin 3.1 'Bruker Biospin' 4 'chemical shift assignment' 'CcpNmr Analysis' 3.2.10 'Skinner, S.P., Fogh, R.H., Boucher, W., Ragan, T.J., Mureddu, L.G., and Vuister, G.W' 5 'structure calculation' ARIA 2.3 ;Linge, O'Donoghue and Nilges ; # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ACE C C N N 1 ACE O O N N 2 ACE CH3 C N N 3 ACE H H N N 4 ACE H1 H N N 5 ACE H2 H N N 6 ACE H3 H N N 7 ALA N N N N 8 ALA CA C N S 9 ALA C C N N 10 ALA O O N N 11 ALA CB C N N 12 ALA OXT O N N 13 ALA H H N N 14 ALA H2 H N N 15 ALA HA H N N 16 ALA HB1 H N N 17 ALA HB2 H N N 18 ALA HB3 H N N 19 ALA HXT H N N 20 ARG N N N N 21 ARG CA C N S 22 ARG C C N N 23 ARG O O N N 24 ARG CB C N N 25 ARG CG C N N 26 ARG CD C N N 27 ARG NE N N N 28 ARG CZ C N N 29 ARG NH1 N N N 30 ARG NH2 N N N 31 ARG OXT O N N 32 ARG H H N N 33 ARG H2 H N N 34 ARG HA H N N 35 ARG HB2 H N N 36 ARG HB3 H N N 37 ARG HG2 H N N 38 ARG HG3 H N N 39 ARG HD2 H N N 40 ARG HD3 H N N 41 ARG HE H N N 42 ARG HH11 H N N 43 ARG HH12 H N N 44 ARG HH21 H N N 45 ARG HH22 H N N 46 ARG HXT H N N 47 ASN N N N N 48 ASN CA C N S 49 ASN C C N N 50 ASN O O N N 51 ASN CB C N N 52 ASN CG C N N 53 ASN OD1 O N N 54 ASN ND2 N N N 55 ASN OXT O N N 56 ASN H H N N 57 ASN H2 H N N 58 ASN HA H N N 59 ASN HB2 H N N 60 ASN HB3 H N N 61 ASN HD21 H N N 62 ASN HD22 H N N 63 ASN HXT H N N 64 GLN N N N N 65 GLN CA C N S 66 GLN C C N N 67 GLN O O N N 68 GLN CB C N N 69 GLN CG C N N 70 GLN CD C N N 71 GLN OE1 O N N 72 GLN NE2 N N N 73 GLN OXT O N N 74 GLN H H N N 75 GLN H2 H N N 76 GLN HA H N N 77 GLN HB2 H N N 78 GLN HB3 H N N 79 GLN HG2 H N N 80 GLN HG3 H N N 81 GLN HE21 H N N 82 GLN HE22 H N N 83 GLN HXT H N N 84 GLU N N N N 85 GLU CA C N S 86 GLU C C N N 87 GLU O O N N 88 GLU CB C N N 89 GLU CG C N N 90 GLU CD C N N 91 GLU OE1 O N N 92 GLU OE2 O N N 93 GLU OXT O N N 94 GLU H H N N 95 GLU H2 H N N 96 GLU HA H N N 97 GLU HB2 H N N 98 GLU HB3 H N N 99 GLU HG2 H N N 100 GLU HG3 H N N 101 GLU HE2 H N N 102 GLU HXT H N N 103 GLY N N N N 104 GLY CA C N N 105 GLY C C N N 106 GLY O O N N 107 GLY OXT O N N 108 GLY H H N N 109 GLY H2 H N N 110 GLY HA2 H N N 111 GLY HA3 H N N 112 GLY HXT H N N 113 HIS N N N N 114 HIS CA C N S 115 HIS C C N N 116 HIS O O N N 117 HIS CB C N N 118 HIS CG C Y N 119 HIS ND1 N Y N 120 HIS CD2 C Y N 121 HIS CE1 C Y N 122 HIS NE2 N Y N 123 HIS OXT O N N 124 HIS H H N N 125 HIS H2 H N N 126 HIS HA H N N 127 HIS HB2 H N N 128 HIS HB3 H N N 129 HIS HD1 H N N 130 HIS HD2 H N N 131 HIS HE1 H N N 132 HIS HE2 H N N 133 HIS HXT H N N 134 ILE N N N N 135 ILE CA C N S 136 ILE C C N N 137 ILE O O N N 138 ILE CB C N S 139 ILE CG1 C N N 140 ILE CG2 C N N 141 ILE CD1 C N N 142 ILE OXT O N N 143 ILE H H N N 144 ILE H2 H N N 145 ILE HA H N N 146 ILE HB H N N 147 ILE HG12 H N N 148 ILE HG13 H N N 149 ILE HG21 H N N 150 ILE HG22 H N N 151 ILE HG23 H N N 152 ILE HD11 H N N 153 ILE HD12 H N N 154 ILE HD13 H N N 155 ILE HXT H N N 156 LEU N N N N 157 LEU CA C N S 158 LEU C C N N 159 LEU O O N N 160 LEU CB C N N 161 LEU CG C N N 162 LEU CD1 C N N 163 LEU CD2 C N N 164 LEU OXT O N N 165 LEU H H N N 166 LEU H2 H N N 167 LEU HA H N N 168 LEU HB2 H N N 169 LEU HB3 H N N 170 LEU HG H N N 171 LEU HD11 H N N 172 LEU HD12 H N N 173 LEU HD13 H N N 174 LEU HD21 H N N 175 LEU HD22 H N N 176 LEU HD23 H N N 177 LEU HXT H N N 178 LYS N N N N 179 LYS CA C N S 180 LYS C C N N 181 LYS O O N N 182 LYS CB C N N 183 LYS CG C N N 184 LYS CD C N N 185 LYS CE C N N 186 LYS NZ N N N 187 LYS OXT O N N 188 LYS H H N N 189 LYS H2 H N N 190 LYS HA H N N 191 LYS HB2 H N N 192 LYS HB3 H N N 193 LYS HG2 H N N 194 LYS HG3 H N N 195 LYS HD2 H N N 196 LYS HD3 H N N 197 LYS HE2 H N N 198 LYS HE3 H N N 199 LYS HZ1 H N N 200 LYS HZ2 H N N 201 LYS HZ3 H N N 202 LYS HXT H N N 203 MET N N N N 204 MET CA C N S 205 MET C C N N 206 MET O O N N 207 MET CB C N N 208 MET CG C N N 209 MET SD S N N 210 MET CE C N N 211 MET OXT O N N 212 MET H H N N 213 MET H2 H N N 214 MET HA H N N 215 MET HB2 H N N 216 MET HB3 H N N 217 MET HG2 H N N 218 MET HG3 H N N 219 MET HE1 H N N 220 MET HE2 H N N 221 MET HE3 H N N 222 MET HXT H N N 223 NH2 N N N N 224 NH2 HN1 H N N 225 NH2 HN2 H N N 226 PHE N N N N 227 PHE CA C N S 228 PHE C C N N 229 PHE O O N N 230 PHE CB C N N 231 PHE CG C Y N 232 PHE CD1 C Y N 233 PHE CD2 C Y N 234 PHE CE1 C Y N 235 PHE CE2 C Y N 236 PHE CZ C Y N 237 PHE OXT O N N 238 PHE H H N N 239 PHE H2 H N N 240 PHE HA H N N 241 PHE HB2 H N N 242 PHE HB3 H N N 243 PHE HD1 H N N 244 PHE HD2 H N N 245 PHE HE1 H N N 246 PHE HE2 H N N 247 PHE HZ H N N 248 PHE HXT H N N 249 PRO N N N N 250 PRO CA C N S 251 PRO C C N N 252 PRO O O N N 253 PRO CB C N N 254 PRO CG C N N 255 PRO CD C N N 256 PRO OXT O N N 257 PRO H H N N 258 PRO HA H N N 259 PRO HB2 H N N 260 PRO HB3 H N N 261 PRO HG2 H N N 262 PRO HG3 H N N 263 PRO HD2 H N N 264 PRO HD3 H N N 265 PRO HXT H N N 266 SEP N N N N 267 SEP CA C N S 268 SEP CB C N N 269 SEP OG O N N 270 SEP C C N N 271 SEP O O N N 272 SEP OXT O N N 273 SEP P P N N 274 SEP O1P O N N 275 SEP O2P O N N 276 SEP O3P O N N 277 SEP H H N N 278 SEP H2 H N N 279 SEP HA H N N 280 SEP HB2 H N N 281 SEP HB3 H N N 282 SEP HXT H N N 283 SEP HOP2 H N N 284 SEP HOP3 H N N 285 SER N N N N 286 SER CA C N S 287 SER C C N N 288 SER O O N N 289 SER CB C N N 290 SER OG O N N 291 SER OXT O N N 292 SER H H N N 293 SER H2 H N N 294 SER HA H N N 295 SER HB2 H N N 296 SER HB3 H N N 297 SER HG H N N 298 SER HXT H N N 299 THR N N N N 300 THR CA C N S 301 THR C C N N 302 THR O O N N 303 THR CB C N R 304 THR OG1 O N N 305 THR CG2 C N N 306 THR OXT O N N 307 THR H H N N 308 THR H2 H N N 309 THR HA H N N 310 THR HB H N N 311 THR HG1 H N N 312 THR HG21 H N N 313 THR HG22 H N N 314 THR HG23 H N N 315 THR HXT H N N 316 TRP N N N N 317 TRP CA C N S 318 TRP C C N N 319 TRP O O N N 320 TRP CB C N N 321 TRP CG C Y N 322 TRP CD1 C Y N 323 TRP CD2 C Y N 324 TRP NE1 N Y N 325 TRP CE2 C Y N 326 TRP CE3 C Y N 327 TRP CZ2 C Y N 328 TRP CZ3 C Y N 329 TRP CH2 C Y N 330 TRP OXT O N N 331 TRP H H N N 332 TRP H2 H N N 333 TRP HA H N N 334 TRP HB2 H N N 335 TRP HB3 H N N 336 TRP HD1 H N N 337 TRP HE1 H N N 338 TRP HE3 H N N 339 TRP HZ2 H N N 340 TRP HZ3 H N N 341 TRP HH2 H N N 342 TRP HXT H N N 343 TYR N N N N 344 TYR CA C N S 345 TYR C C N N 346 TYR O O N N 347 TYR CB C N N 348 TYR CG C Y N 349 TYR CD1 C Y N 350 TYR CD2 C Y N 351 TYR CE1 C Y N 352 TYR CE2 C Y N 353 TYR CZ C Y N 354 TYR OH O N N 355 TYR OXT O N N 356 TYR H H N N 357 TYR H2 H N N 358 TYR HA H N N 359 TYR HB2 H N N 360 TYR HB3 H N N 361 TYR HD1 H N N 362 TYR HD2 H N N 363 TYR HE1 H N N 364 TYR HE2 H N N 365 TYR HH H N N 366 TYR HXT H N N 367 VAL N N N N 368 VAL CA C N S 369 VAL C C N N 370 VAL O O N N 371 VAL CB C N N 372 VAL CG1 C N N 373 VAL CG2 C N N 374 VAL OXT O N N 375 VAL H H N N 376 VAL H2 H N N 377 VAL HA H N N 378 VAL HB H N N 379 VAL HG11 H N N 380 VAL HG12 H N N 381 VAL HG13 H N N 382 VAL HG21 H N N 383 VAL HG22 H N N 384 VAL HG23 H N N 385 VAL HXT H N N 386 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ACE C O doub N N 1 ACE C CH3 sing N N 2 ACE C H sing N N 3 ACE CH3 H1 sing N N 4 ACE CH3 H2 sing N N 5 ACE CH3 H3 sing N N 6 ALA N CA sing N N 7 ALA N H sing N N 8 ALA N H2 sing N N 9 ALA CA C sing N N 10 ALA CA CB sing N N 11 ALA CA HA sing N N 12 ALA C O doub N N 13 ALA C OXT sing N N 14 ALA CB HB1 sing N N 15 ALA CB HB2 sing N N 16 ALA CB HB3 sing N N 17 ALA OXT HXT sing N N 18 ARG N CA sing N N 19 ARG N H sing N N 20 ARG N H2 sing N N 21 ARG CA C sing N N 22 ARG CA CB sing N N 23 ARG CA HA sing N N 24 ARG C O doub N N 25 ARG C OXT sing N N 26 ARG CB CG sing N N 27 ARG CB HB2 sing N N 28 ARG CB HB3 sing N N 29 ARG CG CD sing N N 30 ARG CG HG2 sing N N 31 ARG CG HG3 sing N N 32 ARG CD NE sing N N 33 ARG CD HD2 sing N N 34 ARG CD HD3 sing N N 35 ARG NE CZ sing N N 36 ARG NE HE sing N N 37 ARG CZ NH1 sing N N 38 ARG CZ NH2 doub N N 39 ARG NH1 HH11 sing N N 40 ARG NH1 HH12 sing N N 41 ARG NH2 HH21 sing N N 42 ARG NH2 HH22 sing N N 43 ARG OXT HXT sing N N 44 ASN N CA sing N N 45 ASN N H sing N N 46 ASN N H2 sing N N 47 ASN CA C sing N N 48 ASN CA CB sing N N 49 ASN CA HA sing N N 50 ASN C O doub N N 51 ASN C OXT sing N N 52 ASN CB CG sing N N 53 ASN CB HB2 sing N N 54 ASN CB HB3 sing N N 55 ASN CG OD1 doub N N 56 ASN CG ND2 sing N N 57 ASN ND2 HD21 sing N N 58 ASN ND2 HD22 sing N N 59 ASN OXT HXT sing N N 60 GLN N CA sing N N 61 GLN N H sing N N 62 GLN N H2 sing N N 63 GLN CA C sing N N 64 GLN CA CB sing N N 65 GLN CA HA sing N N 66 GLN C O doub N N 67 GLN C OXT sing N N 68 GLN CB CG sing N N 69 GLN CB HB2 sing N N 70 GLN CB HB3 sing N N 71 GLN CG CD sing N N 72 GLN CG HG2 sing N N 73 GLN CG HG3 sing N N 74 GLN CD OE1 doub N N 75 GLN CD NE2 sing N N 76 GLN NE2 HE21 sing N N 77 GLN NE2 HE22 sing N N 78 GLN OXT HXT sing N N 79 GLU N CA sing N N 80 GLU N H sing N N 81 GLU N H2 sing N N 82 GLU CA C sing N N 83 GLU CA CB sing N N 84 GLU CA HA sing N N 85 GLU C O doub N N 86 GLU C OXT sing N N 87 GLU CB CG sing N N 88 GLU CB HB2 sing N N 89 GLU CB HB3 sing N N 90 GLU CG CD sing N N 91 GLU CG HG2 sing N N 92 GLU CG HG3 sing N N 93 GLU CD OE1 doub N N 94 GLU CD OE2 sing N N 95 GLU OE2 HE2 sing N N 96 GLU OXT HXT sing N N 97 GLY N CA sing N N 98 GLY N H sing N N 99 GLY N H2 sing N N 100 GLY CA C sing N N 101 GLY CA HA2 sing N N 102 GLY CA HA3 sing N N 103 GLY C O doub N N 104 GLY C OXT sing N N 105 GLY OXT HXT sing N N 106 HIS N CA sing N N 107 HIS N H sing N N 108 HIS N H2 sing N N 109 HIS CA C sing N N 110 HIS CA CB sing N N 111 HIS CA HA sing N N 112 HIS C O doub N N 113 HIS C OXT sing N N 114 HIS CB CG sing N N 115 HIS CB HB2 sing N N 116 HIS CB HB3 sing N N 117 HIS CG ND1 sing Y N 118 HIS CG CD2 doub Y N 119 HIS ND1 CE1 doub Y N 120 HIS ND1 HD1 sing N N 121 HIS CD2 NE2 sing Y N 122 HIS CD2 HD2 sing N N 123 HIS CE1 NE2 sing Y N 124 HIS CE1 HE1 sing N N 125 HIS NE2 HE2 sing N N 126 HIS OXT HXT sing N N 127 ILE N CA sing N N 128 ILE N H sing N N 129 ILE N H2 sing N N 130 ILE CA C sing N N 131 ILE CA CB sing N N 132 ILE CA HA sing N N 133 ILE C O doub N N 134 ILE C OXT sing N N 135 ILE CB CG1 sing N N 136 ILE CB CG2 sing N N 137 ILE CB HB sing N N 138 ILE CG1 CD1 sing N N 139 ILE CG1 HG12 sing N N 140 ILE CG1 HG13 sing N N 141 ILE CG2 HG21 sing N N 142 ILE CG2 HG22 sing N N 143 ILE CG2 HG23 sing N N 144 ILE CD1 HD11 sing N N 145 ILE CD1 HD12 sing N N 146 ILE CD1 HD13 sing N N 147 ILE OXT HXT sing N N 148 LEU N CA sing N N 149 LEU N H sing N N 150 LEU N H2 sing N N 151 LEU CA C sing N N 152 LEU CA CB sing N N 153 LEU CA HA sing N N 154 LEU C O doub N N 155 LEU C OXT sing N N 156 LEU CB CG sing N N 157 LEU CB HB2 sing N N 158 LEU CB HB3 sing N N 159 LEU CG CD1 sing N N 160 LEU CG CD2 sing N N 161 LEU CG HG sing N N 162 LEU CD1 HD11 sing N N 163 LEU CD1 HD12 sing N N 164 LEU CD1 HD13 sing N N 165 LEU CD2 HD21 sing N N 166 LEU CD2 HD22 sing N N 167 LEU CD2 HD23 sing N N 168 LEU OXT HXT sing N N 169 LYS N CA sing N N 170 LYS N H sing N N 171 LYS N H2 sing N N 172 LYS CA C sing N N 173 LYS CA CB sing N N 174 LYS CA HA sing N N 175 LYS C O doub N N 176 LYS C OXT sing N N 177 LYS CB CG sing N N 178 LYS CB HB2 sing N N 179 LYS CB HB3 sing N N 180 LYS CG CD sing N N 181 LYS CG HG2 sing N N 182 LYS CG HG3 sing N N 183 LYS CD CE sing N N 184 LYS CD HD2 sing N N 185 LYS CD HD3 sing N N 186 LYS CE NZ sing N N 187 LYS CE HE2 sing N N 188 LYS CE HE3 sing N N 189 LYS NZ HZ1 sing N N 190 LYS NZ HZ2 sing N N 191 LYS NZ HZ3 sing N N 192 LYS OXT HXT sing N N 193 MET N CA sing N N 194 MET N H sing N N 195 MET N H2 sing N N 196 MET CA C sing N N 197 MET CA CB sing N N 198 MET CA HA sing N N 199 MET C O doub N N 200 MET C OXT sing N N 201 MET CB CG sing N N 202 MET CB HB2 sing N N 203 MET CB HB3 sing N N 204 MET CG SD sing N N 205 MET CG HG2 sing N N 206 MET CG HG3 sing N N 207 MET SD CE sing N N 208 MET CE HE1 sing N N 209 MET CE HE2 sing N N 210 MET CE HE3 sing N N 211 MET OXT HXT sing N N 212 NH2 N HN1 sing N N 213 NH2 N HN2 sing N N 214 PHE N CA sing N N 215 PHE N H sing N N 216 PHE N H2 sing N N 217 PHE CA C sing N N 218 PHE CA CB sing N N 219 PHE CA HA sing N N 220 PHE C O doub N N 221 PHE C OXT sing N N 222 PHE CB CG sing N N 223 PHE CB HB2 sing N N 224 PHE CB HB3 sing N N 225 PHE CG CD1 doub Y N 226 PHE CG CD2 sing Y N 227 PHE CD1 CE1 sing Y N 228 PHE CD1 HD1 sing N N 229 PHE CD2 CE2 doub Y N 230 PHE CD2 HD2 sing N N 231 PHE CE1 CZ doub Y N 232 PHE CE1 HE1 sing N N 233 PHE CE2 CZ sing Y N 234 PHE CE2 HE2 sing N N 235 PHE CZ HZ sing N N 236 PHE OXT HXT sing N N 237 PRO N CA sing N N 238 PRO N CD sing N N 239 PRO N H sing N N 240 PRO CA C sing N N 241 PRO CA CB sing N N 242 PRO CA HA sing N N 243 PRO C O doub N N 244 PRO C OXT sing N N 245 PRO CB CG sing N N 246 PRO CB HB2 sing N N 247 PRO CB HB3 sing N N 248 PRO CG CD sing N N 249 PRO CG HG2 sing N N 250 PRO CG HG3 sing N N 251 PRO CD HD2 sing N N 252 PRO CD HD3 sing N N 253 PRO OXT HXT sing N N 254 SEP N CA sing N N 255 SEP N H sing N N 256 SEP N H2 sing N N 257 SEP CA CB sing N N 258 SEP CA C sing N N 259 SEP CA HA sing N N 260 SEP CB OG sing N N 261 SEP CB HB2 sing N N 262 SEP CB HB3 sing N N 263 SEP OG P sing N N 264 SEP C O doub N N 265 SEP C OXT sing N N 266 SEP OXT HXT sing N N 267 SEP P O1P doub N N 268 SEP P O2P sing N N 269 SEP P O3P sing N N 270 SEP O2P HOP2 sing N N 271 SEP O3P HOP3 sing N N 272 SER N CA sing N N 273 SER N H sing N N 274 SER N H2 sing N N 275 SER CA C sing N N 276 SER CA CB sing N N 277 SER CA HA sing N N 278 SER C O doub N N 279 SER C OXT sing N N 280 SER CB OG sing N N 281 SER CB HB2 sing N N 282 SER CB HB3 sing N N 283 SER OG HG sing N N 284 SER OXT HXT sing N N 285 THR N CA sing N N 286 THR N H sing N N 287 THR N H2 sing N N 288 THR CA C sing N N 289 THR CA CB sing N N 290 THR CA HA sing N N 291 THR C O doub N N 292 THR C OXT sing N N 293 THR CB OG1 sing N N 294 THR CB CG2 sing N N 295 THR CB HB sing N N 296 THR OG1 HG1 sing N N 297 THR CG2 HG21 sing N N 298 THR CG2 HG22 sing N N 299 THR CG2 HG23 sing N N 300 THR OXT HXT sing N N 301 TRP N CA sing N N 302 TRP N H sing N N 303 TRP N H2 sing N N 304 TRP CA C sing N N 305 TRP CA CB sing N N 306 TRP CA HA sing N N 307 TRP C O doub N N 308 TRP C OXT sing N N 309 TRP CB CG sing N N 310 TRP CB HB2 sing N N 311 TRP CB HB3 sing N N 312 TRP CG CD1 doub Y N 313 TRP CG CD2 sing Y N 314 TRP CD1 NE1 sing Y N 315 TRP CD1 HD1 sing N N 316 TRP CD2 CE2 doub Y N 317 TRP CD2 CE3 sing Y N 318 TRP NE1 CE2 sing Y N 319 TRP NE1 HE1 sing N N 320 TRP CE2 CZ2 sing Y N 321 TRP CE3 CZ3 doub Y N 322 TRP CE3 HE3 sing N N 323 TRP CZ2 CH2 doub Y N 324 TRP CZ2 HZ2 sing N N 325 TRP CZ3 CH2 sing Y N 326 TRP CZ3 HZ3 sing N N 327 TRP CH2 HH2 sing N N 328 TRP OXT HXT sing N N 329 TYR N CA sing N N 330 TYR N H sing N N 331 TYR N H2 sing N N 332 TYR CA C sing N N 333 TYR CA CB sing N N 334 TYR CA HA sing N N 335 TYR C O doub N N 336 TYR C OXT sing N N 337 TYR CB CG sing N N 338 TYR CB HB2 sing N N 339 TYR CB HB3 sing N N 340 TYR CG CD1 doub Y N 341 TYR CG CD2 sing Y N 342 TYR CD1 CE1 sing Y N 343 TYR CD1 HD1 sing N N 344 TYR CD2 CE2 doub Y N 345 TYR CD2 HD2 sing N N 346 TYR CE1 CZ doub Y N 347 TYR CE1 HE1 sing N N 348 TYR CE2 CZ sing Y N 349 TYR CE2 HE2 sing N N 350 TYR CZ OH sing N N 351 TYR OH HH sing N N 352 TYR OXT HXT sing N N 353 VAL N CA sing N N 354 VAL N H sing N N 355 VAL N H2 sing N N 356 VAL CA C sing N N 357 VAL CA CB sing N N 358 VAL CA HA sing N N 359 VAL C O doub N N 360 VAL C OXT sing N N 361 VAL CB CG1 sing N N 362 VAL CB CG2 sing N N 363 VAL CB HB sing N N 364 VAL CG1 HG11 sing N N 365 VAL CG1 HG12 sing N N 366 VAL CG1 HG13 sing N N 367 VAL CG2 HG21 sing N N 368 VAL CG2 HG22 sing N N 369 VAL CG2 HG23 sing N N 370 VAL OXT HXT sing N N 371 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Cancer Research UK' 'United Kingdom' 'CRUK C9545/A29580' 1 'Cancer Research UK' 'United Kingdom' C9685/A26398 2 'Human Frontier Science Program (HFSP)' France 'HFSP: RGEC27/2024' 3 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.details ? # _atom_sites.entry_id 9RPU _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O P S # loop_ #