data_9S1T # _entry.id 9S1T # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.416 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9S1T pdb_00009s1t 10.2210/pdb9s1t/pdb WWPDB D_1292149573 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-07-29 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9S1T _pdbx_database_status.recvd_initial_deposition_date 2025-07-21 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email gustav.oberdorfer@tugraz.at _pdbx_contact_author.name_first Gustav _pdbx_contact_author.name_last Oberdorfer _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-6144-9114 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Oberdorfer, G.' 1 0000-0002-6144-9114 'Elaily, W.' 2 0000-0003-4169-9199 'Stoll, D.' 3 0009-0007-9431-915X 'Chakatok, M.' 4 0009-0002-7346-0350 'Grill, B.' 5 0000-0003-1084-3063 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'De novo design of a thermostable helical barrel protein for rapid biocatalytic functionalization' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Elaily, W.' 1 0000-0003-4169-9199 primary 'Stoll, D.' 2 0009-0007-9431-915X primary 'Chakatok, M.' 3 0009-0002-7346-0350 primary 'Aleotti, M.' 4 0000-0002-6016-0175 primary 'Grill, B.' 5 0000-0003-1084-3063 primary 'Lechner, H.' 6 0000-0002-2177-2611 primary 'Oberdorfer, G.' 7 0000-0002-6144-9114 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'De novo designed helical barrel - 6H5L' 38000.582 1 ? ? ? ? 2 non-polymer syn '(2S)-2-hydroxybutanedioic acid' 134.087 2 ? ? ? ? 3 non-polymer syn GLYCEROL 92.094 3 ? ? ? ? 4 non-polymer syn 'PHOSPHATE ION' 94.971 1 ? ? ? ? 5 water nat water 18.015 29 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSSHHHHHHSSGENLYFQGSHMTCEVVKKILYMAKKLVEQKKEVVKQILKMAKELVEKKKEVVYKALEAAEKGLDTKKI AKLLLEMLEHELELAEQIAKLLLEMLEEELQLAEKIAQLMLESGISEEVVKQILYMAKQLVEKKKEVVKKILYMAKELVE KKKEVVQKALEAAEKGLDTKQIAKLLLEMLEHELELAEKIAQLLLEMLEEELKLAEKIAKLMLESGISEEVVKKILQMAK KLVEKKKEVVQKILYMAQELVEKKQEVVKKALEAAEYGLDTKKIAQLLLEMLEHELELAEKIAKLLLEMLEEELKLAEKI AKLMEEQCK ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSSGENLYFQGSHMTCEVVKKILYMAKKLVEQKKEVVKQILKMAKELVEKKKEVVYKALEAAEKGLDTKKI AKLLLEMLEHELELAEQIAKLLLEMLEEELQLAEKIAQLMLESGISEEVVKQILYMAKQLVEKKKEVVKKILYMAKELVE KKKEVVQKALEAAEKGLDTKQIAKLLLEMLEHELELAEKIAQLLLEMLEEELKLAEKIAKLMLESGISEEVVKKILQMAK KLVEKKKEVVQKILYMAQELVEKKQEVVKKALEAAEYGLDTKKIAQLLLEMLEHELELAEKIAKLLLEMLEEELKLAEKI AKLMEEQCK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '(2S)-2-hydroxybutanedioic acid' LMR 3 GLYCEROL GOL 4 'PHOSPHATE ION' PO4 5 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 GLU n 1 15 ASN n 1 16 LEU n 1 17 TYR n 1 18 PHE n 1 19 GLN n 1 20 GLY n 1 21 SER n 1 22 HIS n 1 23 MET n 1 24 THR n 1 25 CYS n 1 26 GLU n 1 27 VAL n 1 28 VAL n 1 29 LYS n 1 30 LYS n 1 31 ILE n 1 32 LEU n 1 33 TYR n 1 34 MET n 1 35 ALA n 1 36 LYS n 1 37 LYS n 1 38 LEU n 1 39 VAL n 1 40 GLU n 1 41 GLN n 1 42 LYS n 1 43 LYS n 1 44 GLU n 1 45 VAL n 1 46 VAL n 1 47 LYS n 1 48 GLN n 1 49 ILE n 1 50 LEU n 1 51 LYS n 1 52 MET n 1 53 ALA n 1 54 LYS n 1 55 GLU n 1 56 LEU n 1 57 VAL n 1 58 GLU n 1 59 LYS n 1 60 LYS n 1 61 LYS n 1 62 GLU n 1 63 VAL n 1 64 VAL n 1 65 TYR n 1 66 LYS n 1 67 ALA n 1 68 LEU n 1 69 GLU n 1 70 ALA n 1 71 ALA n 1 72 GLU n 1 73 LYS n 1 74 GLY n 1 75 LEU n 1 76 ASP n 1 77 THR n 1 78 LYS n 1 79 LYS n 1 80 ILE n 1 81 ALA n 1 82 LYS n 1 83 LEU n 1 84 LEU n 1 85 LEU n 1 86 GLU n 1 87 MET n 1 88 LEU n 1 89 GLU n 1 90 HIS n 1 91 GLU n 1 92 LEU n 1 93 GLU n 1 94 LEU n 1 95 ALA n 1 96 GLU n 1 97 GLN n 1 98 ILE n 1 99 ALA n 1 100 LYS n 1 101 LEU n 1 102 LEU n 1 103 LEU n 1 104 GLU n 1 105 MET n 1 106 LEU n 1 107 GLU n 1 108 GLU n 1 109 GLU n 1 110 LEU n 1 111 GLN n 1 112 LEU n 1 113 ALA n 1 114 GLU n 1 115 LYS n 1 116 ILE n 1 117 ALA n 1 118 GLN n 1 119 LEU n 1 120 MET n 1 121 LEU n 1 122 GLU n 1 123 SER n 1 124 GLY n 1 125 ILE n 1 126 SER n 1 127 GLU n 1 128 GLU n 1 129 VAL n 1 130 VAL n 1 131 LYS n 1 132 GLN n 1 133 ILE n 1 134 LEU n 1 135 TYR n 1 136 MET n 1 137 ALA n 1 138 LYS n 1 139 GLN n 1 140 LEU n 1 141 VAL n 1 142 GLU n 1 143 LYS n 1 144 LYS n 1 145 LYS n 1 146 GLU n 1 147 VAL n 1 148 VAL n 1 149 LYS n 1 150 LYS n 1 151 ILE n 1 152 LEU n 1 153 TYR n 1 154 MET n 1 155 ALA n 1 156 LYS n 1 157 GLU n 1 158 LEU n 1 159 VAL n 1 160 GLU n 1 161 LYS n 1 162 LYS n 1 163 LYS n 1 164 GLU n 1 165 VAL n 1 166 VAL n 1 167 GLN n 1 168 LYS n 1 169 ALA n 1 170 LEU n 1 171 GLU n 1 172 ALA n 1 173 ALA n 1 174 GLU n 1 175 LYS n 1 176 GLY n 1 177 LEU n 1 178 ASP n 1 179 THR n 1 180 LYS n 1 181 GLN n 1 182 ILE n 1 183 ALA n 1 184 LYS n 1 185 LEU n 1 186 LEU n 1 187 LEU n 1 188 GLU n 1 189 MET n 1 190 LEU n 1 191 GLU n 1 192 HIS n 1 193 GLU n 1 194 LEU n 1 195 GLU n 1 196 LEU n 1 197 ALA n 1 198 GLU n 1 199 LYS n 1 200 ILE n 1 201 ALA n 1 202 GLN n 1 203 LEU n 1 204 LEU n 1 205 LEU n 1 206 GLU n 1 207 MET n 1 208 LEU n 1 209 GLU n 1 210 GLU n 1 211 GLU n 1 212 LEU n 1 213 LYS n 1 214 LEU n 1 215 ALA n 1 216 GLU n 1 217 LYS n 1 218 ILE n 1 219 ALA n 1 220 LYS n 1 221 LEU n 1 222 MET n 1 223 LEU n 1 224 GLU n 1 225 SER n 1 226 GLY n 1 227 ILE n 1 228 SER n 1 229 GLU n 1 230 GLU n 1 231 VAL n 1 232 VAL n 1 233 LYS n 1 234 LYS n 1 235 ILE n 1 236 LEU n 1 237 GLN n 1 238 MET n 1 239 ALA n 1 240 LYS n 1 241 LYS n 1 242 LEU n 1 243 VAL n 1 244 GLU n 1 245 LYS n 1 246 LYS n 1 247 LYS n 1 248 GLU n 1 249 VAL n 1 250 VAL n 1 251 GLN n 1 252 LYS n 1 253 ILE n 1 254 LEU n 1 255 TYR n 1 256 MET n 1 257 ALA n 1 258 GLN n 1 259 GLU n 1 260 LEU n 1 261 VAL n 1 262 GLU n 1 263 LYS n 1 264 LYS n 1 265 GLN n 1 266 GLU n 1 267 VAL n 1 268 VAL n 1 269 LYS n 1 270 LYS n 1 271 ALA n 1 272 LEU n 1 273 GLU n 1 274 ALA n 1 275 ALA n 1 276 GLU n 1 277 TYR n 1 278 GLY n 1 279 LEU n 1 280 ASP n 1 281 THR n 1 282 LYS n 1 283 LYS n 1 284 ILE n 1 285 ALA n 1 286 GLN n 1 287 LEU n 1 288 LEU n 1 289 LEU n 1 290 GLU n 1 291 MET n 1 292 LEU n 1 293 GLU n 1 294 HIS n 1 295 GLU n 1 296 LEU n 1 297 GLU n 1 298 LEU n 1 299 ALA n 1 300 GLU n 1 301 LYS n 1 302 ILE n 1 303 ALA n 1 304 LYS n 1 305 LEU n 1 306 LEU n 1 307 LEU n 1 308 GLU n 1 309 MET n 1 310 LEU n 1 311 GLU n 1 312 GLU n 1 313 GLU n 1 314 LEU n 1 315 LYS n 1 316 LEU n 1 317 ALA n 1 318 GLU n 1 319 LYS n 1 320 ILE n 1 321 ALA n 1 322 LYS n 1 323 LEU n 1 324 MET n 1 325 GLU n 1 326 GLU n 1 327 GLN n 1 328 CYS n 1 329 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 329 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'synthetic construct' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 32630 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LMR non-polymer . '(2S)-2-hydroxybutanedioic acid' L-Malate 'C4 H6 O5' 134.087 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PO4 non-polymer . 'PHOSPHATE ION' ? 'O4 P -3' 94.971 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -22 ? ? ? A . n A 1 2 GLY 2 -21 ? ? ? A . n A 1 3 SER 3 -20 ? ? ? A . n A 1 4 SER 4 -19 ? ? ? A . n A 1 5 HIS 5 -18 ? ? ? A . n A 1 6 HIS 6 -17 ? ? ? A . n A 1 7 HIS 7 -16 ? ? ? A . n A 1 8 HIS 8 -15 ? ? ? A . n A 1 9 HIS 9 -14 ? ? ? A . n A 1 10 HIS 10 -13 ? ? ? A . n A 1 11 SER 11 -12 ? ? ? A . n A 1 12 SER 12 -11 ? ? ? A . n A 1 13 GLY 13 -10 ? ? ? A . n A 1 14 GLU 14 -9 ? ? ? A . n A 1 15 ASN 15 -8 ? ? ? A . n A 1 16 LEU 16 -7 ? ? ? A . n A 1 17 TYR 17 -6 ? ? ? A . n A 1 18 PHE 18 -5 ? ? ? A . n A 1 19 GLN 19 -4 ? ? ? A . n A 1 20 GLY 20 -3 ? ? ? A . n A 1 21 SER 21 -2 ? ? ? A . n A 1 22 HIS 22 -1 ? ? ? A . n A 1 23 MET 23 0 ? ? ? A . n A 1 24 THR 24 1 1 THR THR A . n A 1 25 CYS 25 2 2 CYS CYS A . n A 1 26 GLU 26 3 3 GLU GLU A . n A 1 27 VAL 27 4 4 VAL VAL A . n A 1 28 VAL 28 5 5 VAL VAL A . n A 1 29 LYS 29 6 6 LYS LYS A . n A 1 30 LYS 30 7 7 LYS LYS A . n A 1 31 ILE 31 8 8 ILE ILE A . n A 1 32 LEU 32 9 9 LEU LEU A . n A 1 33 TYR 33 10 10 TYR TYR A . n A 1 34 MET 34 11 11 MET MET A . n A 1 35 ALA 35 12 12 ALA ALA A . n A 1 36 LYS 36 13 13 LYS LYS A . n A 1 37 LYS 37 14 14 LYS LYS A . n A 1 38 LEU 38 15 15 LEU LEU A . n A 1 39 VAL 39 16 16 VAL VAL A . n A 1 40 GLU 40 17 17 GLU GLU A . n A 1 41 GLN 41 18 18 GLN GLN A . n A 1 42 LYS 42 19 19 LYS LYS A . n A 1 43 LYS 43 20 20 LYS LYS A . n A 1 44 GLU 44 21 21 GLU GLU A . n A 1 45 VAL 45 22 22 VAL VAL A . n A 1 46 VAL 46 23 23 VAL VAL A . n A 1 47 LYS 47 24 24 LYS LYS A . n A 1 48 GLN 48 25 25 GLN GLN A . n A 1 49 ILE 49 26 26 ILE ILE A . n A 1 50 LEU 50 27 27 LEU LEU A . n A 1 51 LYS 51 28 28 LYS LYS A . n A 1 52 MET 52 29 29 MET MET A . n A 1 53 ALA 53 30 30 ALA ALA A . n A 1 54 LYS 54 31 31 LYS LYS A . n A 1 55 GLU 55 32 32 GLU GLU A . n A 1 56 LEU 56 33 33 LEU LEU A . n A 1 57 VAL 57 34 34 VAL VAL A . n A 1 58 GLU 58 35 35 GLU GLU A . n A 1 59 LYS 59 36 36 LYS LYS A . n A 1 60 LYS 60 37 37 LYS LYS A . n A 1 61 LYS 61 38 38 LYS LYS A . n A 1 62 GLU 62 39 39 GLU GLU A . n A 1 63 VAL 63 40 40 VAL VAL A . n A 1 64 VAL 64 41 41 VAL VAL A . n A 1 65 TYR 65 42 42 TYR TYR A . n A 1 66 LYS 66 43 43 LYS LYS A . n A 1 67 ALA 67 44 44 ALA ALA A . n A 1 68 LEU 68 45 45 LEU LEU A . n A 1 69 GLU 69 46 46 GLU GLU A . n A 1 70 ALA 70 47 47 ALA ALA A . n A 1 71 ALA 71 48 48 ALA ALA A . n A 1 72 GLU 72 49 ? ? ? A . n A 1 73 LYS 73 50 ? ? ? A . n A 1 74 GLY 74 51 ? ? ? A . n A 1 75 LEU 75 52 ? ? ? A . n A 1 76 ASP 76 53 ? ? ? A . n A 1 77 THR 77 54 ? ? ? A . n A 1 78 LYS 78 55 ? ? ? A . n A 1 79 LYS 79 56 56 LYS LYS A . n A 1 80 ILE 80 57 57 ILE ILE A . n A 1 81 ALA 81 58 58 ALA ALA A . n A 1 82 LYS 82 59 59 LYS LYS A . n A 1 83 LEU 83 60 60 LEU LEU A . n A 1 84 LEU 84 61 61 LEU LEU A . n A 1 85 LEU 85 62 62 LEU LEU A . n A 1 86 GLU 86 63 63 GLU GLU A . n A 1 87 MET 87 64 64 MET MET A . n A 1 88 LEU 88 65 65 LEU LEU A . n A 1 89 GLU 89 66 66 GLU GLU A . n A 1 90 HIS 90 67 67 HIS HIS A . n A 1 91 GLU 91 68 68 GLU GLU A . n A 1 92 LEU 92 69 69 LEU LEU A . n A 1 93 GLU 93 70 70 GLU GLU A . n A 1 94 LEU 94 71 71 LEU LEU A . n A 1 95 ALA 95 72 72 ALA ALA A . n A 1 96 GLU 96 73 73 GLU GLU A . n A 1 97 GLN 97 74 74 GLN GLN A . n A 1 98 ILE 98 75 75 ILE ILE A . n A 1 99 ALA 99 76 76 ALA ALA A . n A 1 100 LYS 100 77 77 LYS LYS A . n A 1 101 LEU 101 78 78 LEU LEU A . n A 1 102 LEU 102 79 79 LEU LEU A . n A 1 103 LEU 103 80 80 LEU LEU A . n A 1 104 GLU 104 81 81 GLU GLU A . n A 1 105 MET 105 82 82 MET MET A . n A 1 106 LEU 106 83 83 LEU LEU A . n A 1 107 GLU 107 84 84 GLU GLU A . n A 1 108 GLU 108 85 85 GLU GLU A . n A 1 109 GLU 109 86 86 GLU GLU A . n A 1 110 LEU 110 87 87 LEU LEU A . n A 1 111 GLN 111 88 88 GLN GLN A . n A 1 112 LEU 112 89 89 LEU LEU A . n A 1 113 ALA 113 90 90 ALA ALA A . n A 1 114 GLU 114 91 91 GLU GLU A . n A 1 115 LYS 115 92 92 LYS LYS A . n A 1 116 ILE 116 93 93 ILE ILE A . n A 1 117 ALA 117 94 94 ALA ALA A . n A 1 118 GLN 118 95 95 GLN GLN A . n A 1 119 LEU 119 96 96 LEU LEU A . n A 1 120 MET 120 97 97 MET MET A . n A 1 121 LEU 121 98 98 LEU LEU A . n A 1 122 GLU 122 99 99 GLU GLU A . n A 1 123 SER 123 100 100 SER SER A . n A 1 124 GLY 124 101 101 GLY GLY A . n A 1 125 ILE 125 102 102 ILE ILE A . n A 1 126 SER 126 103 103 SER SER A . n A 1 127 GLU 127 104 104 GLU GLU A . n A 1 128 GLU 128 105 105 GLU GLU A . n A 1 129 VAL 129 106 106 VAL VAL A . n A 1 130 VAL 130 107 107 VAL VAL A . n A 1 131 LYS 131 108 108 LYS LYS A . n A 1 132 GLN 132 109 109 GLN GLN A . n A 1 133 ILE 133 110 110 ILE ILE A . n A 1 134 LEU 134 111 111 LEU LEU A . n A 1 135 TYR 135 112 112 TYR TYR A . n A 1 136 MET 136 113 113 MET MET A . n A 1 137 ALA 137 114 114 ALA ALA A . n A 1 138 LYS 138 115 115 LYS LYS A . n A 1 139 GLN 139 116 116 GLN GLN A . n A 1 140 LEU 140 117 117 LEU LEU A . n A 1 141 VAL 141 118 118 VAL VAL A . n A 1 142 GLU 142 119 119 GLU GLU A . n A 1 143 LYS 143 120 120 LYS LYS A . n A 1 144 LYS 144 121 121 LYS LYS A . n A 1 145 LYS 145 122 122 LYS LYS A . n A 1 146 GLU 146 123 123 GLU GLU A . n A 1 147 VAL 147 124 124 VAL VAL A . n A 1 148 VAL 148 125 125 VAL VAL A . n A 1 149 LYS 149 126 126 LYS LYS A . n A 1 150 LYS 150 127 127 LYS LYS A . n A 1 151 ILE 151 128 128 ILE ILE A . n A 1 152 LEU 152 129 129 LEU LEU A . n A 1 153 TYR 153 130 130 TYR TYR A . n A 1 154 MET 154 131 131 MET MET A . n A 1 155 ALA 155 132 132 ALA ALA A . n A 1 156 LYS 156 133 133 LYS LYS A . n A 1 157 GLU 157 134 134 GLU GLU A . n A 1 158 LEU 158 135 135 LEU LEU A . n A 1 159 VAL 159 136 136 VAL VAL A . n A 1 160 GLU 160 137 137 GLU GLU A . n A 1 161 LYS 161 138 138 LYS LYS A . n A 1 162 LYS 162 139 139 LYS LYS A . n A 1 163 LYS 163 140 140 LYS LYS A . n A 1 164 GLU 164 141 141 GLU GLU A . n A 1 165 VAL 165 142 142 VAL VAL A . n A 1 166 VAL 166 143 143 VAL VAL A . n A 1 167 GLN 167 144 144 GLN GLN A . n A 1 168 LYS 168 145 145 LYS LYS A . n A 1 169 ALA 169 146 146 ALA ALA A . n A 1 170 LEU 170 147 147 LEU LEU A . n A 1 171 GLU 171 148 148 GLU GLU A . n A 1 172 ALA 172 149 149 ALA ALA A . n A 1 173 ALA 173 150 150 ALA ALA A . n A 1 174 GLU 174 151 ? ? ? A . n A 1 175 LYS 175 152 ? ? ? A . n A 1 176 GLY 176 153 ? ? ? A . n A 1 177 LEU 177 154 ? ? ? A . n A 1 178 ASP 178 155 ? ? ? A . n A 1 179 THR 179 156 ? ? ? A . n A 1 180 LYS 180 157 ? ? ? A . n A 1 181 GLN 181 158 158 GLN GLN A . n A 1 182 ILE 182 159 159 ILE ILE A . n A 1 183 ALA 183 160 160 ALA ALA A . n A 1 184 LYS 184 161 161 LYS LYS A . n A 1 185 LEU 185 162 162 LEU LEU A . n A 1 186 LEU 186 163 163 LEU LEU A . n A 1 187 LEU 187 164 164 LEU LEU A . n A 1 188 GLU 188 165 165 GLU GLU A . n A 1 189 MET 189 166 166 MET MET A . n A 1 190 LEU 190 167 167 LEU LEU A . n A 1 191 GLU 191 168 168 GLU GLU A . n A 1 192 HIS 192 169 169 HIS HIS A . n A 1 193 GLU 193 170 170 GLU GLU A . n A 1 194 LEU 194 171 171 LEU LEU A . n A 1 195 GLU 195 172 172 GLU GLU A . n A 1 196 LEU 196 173 173 LEU LEU A . n A 1 197 ALA 197 174 174 ALA ALA A . n A 1 198 GLU 198 175 175 GLU GLU A . n A 1 199 LYS 199 176 176 LYS LYS A . n A 1 200 ILE 200 177 177 ILE ILE A . n A 1 201 ALA 201 178 178 ALA ALA A . n A 1 202 GLN 202 179 179 GLN GLN A . n A 1 203 LEU 203 180 180 LEU LEU A . n A 1 204 LEU 204 181 181 LEU LEU A . n A 1 205 LEU 205 182 182 LEU LEU A . n A 1 206 GLU 206 183 183 GLU GLU A . n A 1 207 MET 207 184 184 MET MET A . n A 1 208 LEU 208 185 185 LEU LEU A . n A 1 209 GLU 209 186 186 GLU GLU A . n A 1 210 GLU 210 187 187 GLU GLU A . n A 1 211 GLU 211 188 188 GLU GLU A . n A 1 212 LEU 212 189 189 LEU LEU A . n A 1 213 LYS 213 190 190 LYS LYS A . n A 1 214 LEU 214 191 191 LEU LEU A . n A 1 215 ALA 215 192 192 ALA ALA A . n A 1 216 GLU 216 193 193 GLU GLU A . n A 1 217 LYS 217 194 194 LYS LYS A . n A 1 218 ILE 218 195 195 ILE ILE A . n A 1 219 ALA 219 196 196 ALA ALA A . n A 1 220 LYS 220 197 197 LYS LYS A . n A 1 221 LEU 221 198 198 LEU LEU A . n A 1 222 MET 222 199 199 MET MET A . n A 1 223 LEU 223 200 200 LEU LEU A . n A 1 224 GLU 224 201 201 GLU GLU A . n A 1 225 SER 225 202 202 SER SER A . n A 1 226 GLY 226 203 203 GLY GLY A . n A 1 227 ILE 227 204 204 ILE ILE A . n A 1 228 SER 228 205 205 SER SER A . n A 1 229 GLU 229 206 206 GLU GLU A . n A 1 230 GLU 230 207 207 GLU GLU A . n A 1 231 VAL 231 208 208 VAL VAL A . n A 1 232 VAL 232 209 209 VAL VAL A . n A 1 233 LYS 233 210 210 LYS LYS A . n A 1 234 LYS 234 211 211 LYS LYS A . n A 1 235 ILE 235 212 212 ILE ILE A . n A 1 236 LEU 236 213 213 LEU LEU A . n A 1 237 GLN 237 214 214 GLN GLN A . n A 1 238 MET 238 215 215 MET MET A . n A 1 239 ALA 239 216 216 ALA ALA A . n A 1 240 LYS 240 217 217 LYS LYS A . n A 1 241 LYS 241 218 218 LYS LYS A . n A 1 242 LEU 242 219 219 LEU LEU A . n A 1 243 VAL 243 220 220 VAL VAL A . n A 1 244 GLU 244 221 221 GLU GLU A . n A 1 245 LYS 245 222 222 LYS LYS A . n A 1 246 LYS 246 223 223 LYS LYS A . n A 1 247 LYS 247 224 224 LYS LYS A . n A 1 248 GLU 248 225 225 GLU GLU A . n A 1 249 VAL 249 226 226 VAL VAL A . n A 1 250 VAL 250 227 227 VAL VAL A . n A 1 251 GLN 251 228 228 GLN GLN A . n A 1 252 LYS 252 229 229 LYS LYS A . n A 1 253 ILE 253 230 230 ILE ILE A . n A 1 254 LEU 254 231 231 LEU LEU A . n A 1 255 TYR 255 232 232 TYR TYR A . n A 1 256 MET 256 233 233 MET MET A . n A 1 257 ALA 257 234 234 ALA ALA A . n A 1 258 GLN 258 235 235 GLN GLN A . n A 1 259 GLU 259 236 236 GLU GLU A . n A 1 260 LEU 260 237 237 LEU LEU A . n A 1 261 VAL 261 238 238 VAL VAL A . n A 1 262 GLU 262 239 239 GLU GLU A . n A 1 263 LYS 263 240 240 LYS LYS A . n A 1 264 LYS 264 241 241 LYS LYS A . n A 1 265 GLN 265 242 242 GLN GLN A . n A 1 266 GLU 266 243 243 GLU GLU A . n A 1 267 VAL 267 244 244 VAL VAL A . n A 1 268 VAL 268 245 245 VAL VAL A . n A 1 269 LYS 269 246 246 LYS LYS A . n A 1 270 LYS 270 247 247 LYS LYS A . n A 1 271 ALA 271 248 248 ALA ALA A . n A 1 272 LEU 272 249 249 LEU LEU A . n A 1 273 GLU 273 250 250 GLU GLU A . n A 1 274 ALA 274 251 251 ALA ALA A . n A 1 275 ALA 275 252 252 ALA ALA A . n A 1 276 GLU 276 253 253 GLU GLU A . n A 1 277 TYR 277 254 ? ? ? A . n A 1 278 GLY 278 255 ? ? ? A . n A 1 279 LEU 279 256 ? ? ? A . n A 1 280 ASP 280 257 ? ? ? A . n A 1 281 THR 281 258 ? ? ? A . n A 1 282 LYS 282 259 259 LYS LYS A . n A 1 283 LYS 283 260 260 LYS LYS A . n A 1 284 ILE 284 261 261 ILE ILE A . n A 1 285 ALA 285 262 262 ALA ALA A . n A 1 286 GLN 286 263 263 GLN GLN A . n A 1 287 LEU 287 264 264 LEU LEU A . n A 1 288 LEU 288 265 265 LEU LEU A . n A 1 289 LEU 289 266 266 LEU LEU A . n A 1 290 GLU 290 267 267 GLU GLU A . n A 1 291 MET 291 268 268 MET MET A . n A 1 292 LEU 292 269 269 LEU LEU A . n A 1 293 GLU 293 270 270 GLU GLU A . n A 1 294 HIS 294 271 271 HIS HIS A . n A 1 295 GLU 295 272 272 GLU GLU A . n A 1 296 LEU 296 273 273 LEU LEU A . n A 1 297 GLU 297 274 274 GLU GLU A . n A 1 298 LEU 298 275 275 LEU LEU A . n A 1 299 ALA 299 276 276 ALA ALA A . n A 1 300 GLU 300 277 277 GLU GLU A . n A 1 301 LYS 301 278 278 LYS LYS A . n A 1 302 ILE 302 279 279 ILE ILE A . n A 1 303 ALA 303 280 280 ALA ALA A . n A 1 304 LYS 304 281 281 LYS LYS A . n A 1 305 LEU 305 282 282 LEU LEU A . n A 1 306 LEU 306 283 283 LEU LEU A . n A 1 307 LEU 307 284 284 LEU LEU A . n A 1 308 GLU 308 285 285 GLU GLU A . n A 1 309 MET 309 286 286 MET MET A . n A 1 310 LEU 310 287 287 LEU LEU A . n A 1 311 GLU 311 288 288 GLU GLU A . n A 1 312 GLU 312 289 289 GLU GLU A . n A 1 313 GLU 313 290 290 GLU GLU A . n A 1 314 LEU 314 291 291 LEU LEU A . n A 1 315 LYS 315 292 292 LYS LYS A . n A 1 316 LEU 316 293 293 LEU LEU A . n A 1 317 ALA 317 294 294 ALA ALA A . n A 1 318 GLU 318 295 295 GLU GLU A . n A 1 319 LYS 319 296 296 LYS LYS A . n A 1 320 ILE 320 297 297 ILE ILE A . n A 1 321 ALA 321 298 298 ALA ALA A . n A 1 322 LYS 322 299 299 LYS LYS A . n A 1 323 LEU 323 300 300 LEU LEU A . n A 1 324 MET 324 301 301 MET MET A . n A 1 325 GLU 325 302 302 GLU GLU A . n A 1 326 GLU 326 303 303 GLU GLU A . n A 1 327 GLN 327 304 304 GLN GLN A . n A 1 328 CYS 328 305 305 CYS CYS A . n A 1 329 LYS 329 306 306 LYS LYS A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 LMR 1 401 402 LMR LMR A . C 2 LMR 1 402 404 LMR LMR A . D 3 GOL 1 403 1 GOL GOL A . E 3 GOL 1 404 2 GOL GOL A . F 3 GOL 1 405 3 GOL GOL A . G 4 PO4 1 406 1 PO4 PO4 A . H 5 HOH 1 501 37 HOH HOH A . H 5 HOH 2 502 40 HOH HOH A . H 5 HOH 3 503 5 HOH HOH A . H 5 HOH 4 504 18 HOH HOH A . H 5 HOH 5 505 24 HOH HOH A . H 5 HOH 6 506 28 HOH HOH A . H 5 HOH 7 507 54 HOH HOH A . H 5 HOH 8 508 29 HOH HOH A . H 5 HOH 9 509 10 HOH HOH A . H 5 HOH 10 510 45 HOH HOH A . H 5 HOH 11 511 13 HOH HOH A . H 5 HOH 12 512 25 HOH HOH A . H 5 HOH 13 513 43 HOH HOH A . H 5 HOH 14 514 6 HOH HOH A . H 5 HOH 15 515 31 HOH HOH A . H 5 HOH 16 516 2 HOH HOH A . H 5 HOH 17 517 30 HOH HOH A . H 5 HOH 18 518 3 HOH HOH A . H 5 HOH 19 519 1 HOH HOH A . H 5 HOH 20 520 14 HOH HOH A . H 5 HOH 21 521 8 HOH HOH A . H 5 HOH 22 522 53 HOH HOH A . H 5 HOH 23 523 49 HOH HOH A . H 5 HOH 24 524 7 HOH HOH A . H 5 HOH 25 525 4 HOH HOH A . H 5 HOH 26 526 42 HOH HOH A . H 5 HOH 27 527 27 HOH HOH A . H 5 HOH 28 528 9 HOH HOH A . H 5 HOH 29 529 41 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.21.1_5286 ? 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . ? 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . ? 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . ? 4 # _cell.angle_alpha 101.108 _cell.angle_alpha_esd ? _cell.angle_beta 93.988 _cell.angle_beta_esd ? _cell.angle_gamma 101.919 _cell.angle_gamma_esd ? _cell.entry_id 9S1T _cell.details ? _cell.formula_units_Z ? _cell.length_a 36.567 _cell.length_a_esd ? _cell.length_b 38.600 _cell.length_b_esd ? _cell.length_c 59.452 _cell.length_c_esd ? _cell.volume 80044.166 _cell.volume_esd ? _cell.Z_PDB 1 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9S1T _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 _symmetry.space_group_name_Hall 'P 1' _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9S1T _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.33 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 47.1 _exptl_crystal.description 'large plate-like shard' _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '17.5% PEG 3350, pH = 7.8, 150 mM L-Malic Acid' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER2 X 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2023-02-15 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.8856 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE ID30B' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.8856 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ID30B _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate 63.25 _reflns.entry_id 9S1T _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.8 _reflns.d_resolution_low 36.91 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 14388 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 96.33 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 1.8 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 8.23 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.994 _reflns.pdbx_CC_star 0.999 _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.8 _reflns_shell.d_res_low 3.01 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 2910 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.986 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.11 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 75.52 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9S1T _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.80 _refine.ls_d_res_low 36.91 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 7353 _refine.ls_number_reflns_R_free 739 _refine.ls_number_reflns_R_work 6614 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 96.34 _refine.ls_percent_reflns_R_free 10.05 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2690 _refine.ls_R_factor_R_free 0.3188 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2634 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 2.07 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 38.3589 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3171 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.80 _refine_hist.d_res_low 36.91 _refine_hist.number_atoms_solvent 29 _refine_hist.number_atoms_total 2386 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2316 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 41 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0011 ? 2355 ? f_bond_d ? ? ? 'X-RAY DIFFRACTION' ? 0.2730 ? 3119 ? f_angle_d ? ? ? 'X-RAY DIFFRACTION' ? 0.0272 ? 385 ? f_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.0008 ? 370 ? f_plane_restr ? ? ? 'X-RAY DIFFRACTION' ? 10.1613 ? 985 ? f_dihedral_angle_d ? ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.80 3.01 . . 146 1315 97.01 . . . . 0.2542 . . . . . . . . . . . . . . . 0.3248 'X-RAY DIFFRACTION' 3.01 3.32 . . 149 1354 97.72 . . . . 0.2726 . . . . . . . . . . . . . . . 0.3179 'X-RAY DIFFRACTION' 3.32 3.80 . . 151 1342 97.26 . . . . 0.2522 . . . . . . . . . . . . . . . 0.3495 'X-RAY DIFFRACTION' 3.80 4.78 . . 149 1318 96.51 . . . . 0.2340 . . . . . . . . . . . . . . . 0.3064 'X-RAY DIFFRACTION' 4.78 36.91 . . 144 1285 93.22 . . . . 0.2993 . . . . . . . . . . . . . . . 0.3131 # _struct.entry_id 9S1T _struct.title 'X-ray crystal structure of a de novo designed six-helix barrel' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9S1T _struct_keywords.text 'Parametric design, de novo design, helix barrel, DE NOVO PROTEIN' _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 3 ? F N N 3 ? G N N 4 ? H N N 5 ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 9S1T _struct_ref.pdbx_db_accession 9S1T _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9S1T _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 329 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 9S1T _struct_ref_seq.db_align_beg -22 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 306 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg -22 _struct_ref_seq.pdbx_auth_seq_align_end 306 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLU A 26 ? ALA A 67 ? GLU A 3 ALA A 44 1 ? 42 HELX_P HELX_P2 AA2 ILE A 80 ? SER A 123 ? ILE A 57 SER A 100 1 ? 44 HELX_P HELX_P3 AA3 SER A 126 ? ALA A 172 ? SER A 103 ALA A 149 1 ? 47 HELX_P HELX_P4 AA4 ILE A 182 ? SER A 225 ? ILE A 159 SER A 202 1 ? 44 HELX_P HELX_P5 AA5 SER A 228 ? ALA A 275 ? SER A 205 ALA A 252 1 ? 48 HELX_P HELX_P6 AA6 LYS A 283 ? GLN A 327 ? LYS A 260 GLN A 304 1 ? 45 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 25 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 328 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 2 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 305 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.033 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id CYS _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 25 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 328 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id CYS _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 2 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 305 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom SG _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id . _pdbx_modification_feature.ref_pcm_id . _pdbx_modification_feature.ref_comp_id . _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Disulfide bridge' # _pdbx_entry_details.entry_id 9S1T _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 90 ? ? 63.44 -53.14 2 1 GLN A 304 ? ? -105.12 68.89 3 1 CYS A 305 ? ? -76.49 48.42 # _space_group_symop.id 1 _space_group_symop.operation_xyz x,y,z # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -22 ? A MET 1 2 1 Y 1 A GLY -21 ? A GLY 2 3 1 Y 1 A SER -20 ? A SER 3 4 1 Y 1 A SER -19 ? A SER 4 5 1 Y 1 A HIS -18 ? A HIS 5 6 1 Y 1 A HIS -17 ? A HIS 6 7 1 Y 1 A HIS -16 ? A HIS 7 8 1 Y 1 A HIS -15 ? A HIS 8 9 1 Y 1 A HIS -14 ? A HIS 9 10 1 Y 1 A HIS -13 ? A HIS 10 11 1 Y 1 A SER -12 ? A SER 11 12 1 Y 1 A SER -11 ? A SER 12 13 1 Y 1 A GLY -10 ? A GLY 13 14 1 Y 1 A GLU -9 ? A GLU 14 15 1 Y 1 A ASN -8 ? A ASN 15 16 1 Y 1 A LEU -7 ? A LEU 16 17 1 Y 1 A TYR -6 ? A TYR 17 18 1 Y 1 A PHE -5 ? A PHE 18 19 1 Y 1 A GLN -4 ? A GLN 19 20 1 Y 1 A GLY -3 ? A GLY 20 21 1 Y 1 A SER -2 ? A SER 21 22 1 Y 1 A HIS -1 ? A HIS 22 23 1 Y 1 A MET 0 ? A MET 23 24 1 Y 1 A GLU 49 ? A GLU 72 25 1 Y 1 A LYS 50 ? A LYS 73 26 1 Y 1 A GLY 51 ? A GLY 74 27 1 Y 1 A LEU 52 ? A LEU 75 28 1 Y 1 A ASP 53 ? A ASP 76 29 1 Y 1 A THR 54 ? A THR 77 30 1 Y 1 A LYS 55 ? A LYS 78 31 1 Y 1 A GLU 151 ? A GLU 174 32 1 Y 1 A LYS 152 ? A LYS 175 33 1 Y 1 A GLY 153 ? A GLY 176 34 1 Y 1 A LEU 154 ? A LEU 177 35 1 Y 1 A ASP 155 ? A ASP 178 36 1 Y 1 A THR 156 ? A THR 179 37 1 Y 1 A LYS 157 ? A LYS 180 38 1 Y 1 A TYR 254 ? A TYR 277 39 1 Y 1 A GLY 255 ? A GLY 278 40 1 Y 1 A LEU 256 ? A LEU 279 41 1 Y 1 A ASP 257 ? A ASP 280 42 1 Y 1 A THR 258 ? A THR 281 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 ASP N N N N 31 ASP CA C N S 32 ASP C C N N 33 ASP O O N N 34 ASP CB C N N 35 ASP CG C N N 36 ASP OD1 O N N 37 ASP OD2 O N N 38 ASP OXT O N N 39 ASP H H N N 40 ASP H2 H N N 41 ASP HA H N N 42 ASP HB2 H N N 43 ASP HB3 H N N 44 ASP HD2 H N N 45 ASP HXT H N N 46 CYS N N N N 47 CYS CA C N R 48 CYS C C N N 49 CYS O O N N 50 CYS CB C N N 51 CYS SG S N N 52 CYS OXT O N N 53 CYS H H N N 54 CYS H2 H N N 55 CYS HA H N N 56 CYS HB2 H N N 57 CYS HB3 H N N 58 CYS HG H N N 59 CYS HXT H N N 60 GLN N N N N 61 GLN CA C N S 62 GLN C C N N 63 GLN O O N N 64 GLN CB C N N 65 GLN CG C N N 66 GLN CD C N N 67 GLN OE1 O N N 68 GLN NE2 N N N 69 GLN OXT O N N 70 GLN H H N N 71 GLN H2 H N N 72 GLN HA H N N 73 GLN HB2 H N N 74 GLN HB3 H N N 75 GLN HG2 H N N 76 GLN HG3 H N N 77 GLN HE21 H N N 78 GLN HE22 H N N 79 GLN HXT H N N 80 GLU N N N N 81 GLU CA C N S 82 GLU C C N N 83 GLU O O N N 84 GLU CB C N N 85 GLU CG C N N 86 GLU CD C N N 87 GLU OE1 O N N 88 GLU OE2 O N N 89 GLU OXT O N N 90 GLU H H N N 91 GLU H2 H N N 92 GLU HA H N N 93 GLU HB2 H N N 94 GLU HB3 H N N 95 GLU HG2 H N N 96 GLU HG3 H N N 97 GLU HE2 H N N 98 GLU HXT H N N 99 GLY N N N N 100 GLY CA C N N 101 GLY C C N N 102 GLY O O N N 103 GLY OXT O N N 104 GLY H H N N 105 GLY H2 H N N 106 GLY HA2 H N N 107 GLY HA3 H N N 108 GLY HXT H N N 109 GOL C1 C N N 110 GOL O1 O N N 111 GOL C2 C N N 112 GOL O2 O N N 113 GOL C3 C N N 114 GOL O3 O N N 115 GOL H11 H N N 116 GOL H12 H N N 117 GOL HO1 H N N 118 GOL H2 H N N 119 GOL HO2 H N N 120 GOL H31 H N N 121 GOL H32 H N N 122 GOL HO3 H N N 123 HIS N N N N 124 HIS CA C N S 125 HIS C C N N 126 HIS O O N N 127 HIS CB C N N 128 HIS CG C Y N 129 HIS ND1 N Y N 130 HIS CD2 C Y N 131 HIS CE1 C Y N 132 HIS NE2 N Y N 133 HIS OXT O N N 134 HIS H H N N 135 HIS H2 H N N 136 HIS HA H N N 137 HIS HB2 H N N 138 HIS HB3 H N N 139 HIS HD1 H N N 140 HIS HD2 H N N 141 HIS HE1 H N N 142 HIS HE2 H N N 143 HIS HXT H N N 144 HOH O O N N 145 HOH H1 H N N 146 HOH H2 H N N 147 ILE N N N N 148 ILE CA C N S 149 ILE C C N N 150 ILE O O N N 151 ILE CB C N S 152 ILE CG1 C N N 153 ILE CG2 C N N 154 ILE CD1 C N N 155 ILE OXT O N N 156 ILE H H N N 157 ILE H2 H N N 158 ILE HA H N N 159 ILE HB H N N 160 ILE HG12 H N N 161 ILE HG13 H N N 162 ILE HG21 H N N 163 ILE HG22 H N N 164 ILE HG23 H N N 165 ILE HD11 H N N 166 ILE HD12 H N N 167 ILE HD13 H N N 168 ILE HXT H N N 169 LEU N N N N 170 LEU CA C N S 171 LEU C C N N 172 LEU O O N N 173 LEU CB C N N 174 LEU CG C N N 175 LEU CD1 C N N 176 LEU CD2 C N N 177 LEU OXT O N N 178 LEU H H N N 179 LEU H2 H N N 180 LEU HA H N N 181 LEU HB2 H N N 182 LEU HB3 H N N 183 LEU HG H N N 184 LEU HD11 H N N 185 LEU HD12 H N N 186 LEU HD13 H N N 187 LEU HD21 H N N 188 LEU HD22 H N N 189 LEU HD23 H N N 190 LEU HXT H N N 191 LMR C1 C N N 192 LMR O1A O N N 193 LMR O1B O N N 194 LMR C2 C N S 195 LMR O2 O N N 196 LMR C3 C N N 197 LMR C4 C N N 198 LMR O4A O N N 199 LMR O4B O N N 200 LMR H2 H N N 201 LMR HO2 H N N 202 LMR H3 H N N 203 LMR H3A H N N 204 LMR H4 H N N 205 LMR H5 H N N 206 LYS N N N N 207 LYS CA C N S 208 LYS C C N N 209 LYS O O N N 210 LYS CB C N N 211 LYS CG C N N 212 LYS CD C N N 213 LYS CE C N N 214 LYS NZ N N N 215 LYS OXT O N N 216 LYS H H N N 217 LYS H2 H N N 218 LYS HA H N N 219 LYS HB2 H N N 220 LYS HB3 H N N 221 LYS HG2 H N N 222 LYS HG3 H N N 223 LYS HD2 H N N 224 LYS HD3 H N N 225 LYS HE2 H N N 226 LYS HE3 H N N 227 LYS HZ1 H N N 228 LYS HZ2 H N N 229 LYS HZ3 H N N 230 LYS HXT H N N 231 MET N N N N 232 MET CA C N S 233 MET C C N N 234 MET O O N N 235 MET CB C N N 236 MET CG C N N 237 MET SD S N N 238 MET CE C N N 239 MET OXT O N N 240 MET H H N N 241 MET H2 H N N 242 MET HA H N N 243 MET HB2 H N N 244 MET HB3 H N N 245 MET HG2 H N N 246 MET HG3 H N N 247 MET HE1 H N N 248 MET HE2 H N N 249 MET HE3 H N N 250 MET HXT H N N 251 PHE N N N N 252 PHE CA C N S 253 PHE C C N N 254 PHE O O N N 255 PHE CB C N N 256 PHE CG C Y N 257 PHE CD1 C Y N 258 PHE CD2 C Y N 259 PHE CE1 C Y N 260 PHE CE2 C Y N 261 PHE CZ C Y N 262 PHE OXT O N N 263 PHE H H N N 264 PHE H2 H N N 265 PHE HA H N N 266 PHE HB2 H N N 267 PHE HB3 H N N 268 PHE HD1 H N N 269 PHE HD2 H N N 270 PHE HE1 H N N 271 PHE HE2 H N N 272 PHE HZ H N N 273 PHE HXT H N N 274 PO4 P P N N 275 PO4 O1 O N N 276 PO4 O2 O N N 277 PO4 O3 O N N 278 PO4 O4 O N N 279 SER N N N N 280 SER CA C N S 281 SER C C N N 282 SER O O N N 283 SER CB C N N 284 SER OG O N N 285 SER OXT O N N 286 SER H H N N 287 SER H2 H N N 288 SER HA H N N 289 SER HB2 H N N 290 SER HB3 H N N 291 SER HG H N N 292 SER HXT H N N 293 THR N N N N 294 THR CA C N S 295 THR C C N N 296 THR O O N N 297 THR CB C N R 298 THR OG1 O N N 299 THR CG2 C N N 300 THR OXT O N N 301 THR H H N N 302 THR H2 H N N 303 THR HA H N N 304 THR HB H N N 305 THR HG1 H N N 306 THR HG21 H N N 307 THR HG22 H N N 308 THR HG23 H N N 309 THR HXT H N N 310 TYR N N N N 311 TYR CA C N S 312 TYR C C N N 313 TYR O O N N 314 TYR CB C N N 315 TYR CG C Y N 316 TYR CD1 C Y N 317 TYR CD2 C Y N 318 TYR CE1 C Y N 319 TYR CE2 C Y N 320 TYR CZ C Y N 321 TYR OH O N N 322 TYR OXT O N N 323 TYR H H N N 324 TYR H2 H N N 325 TYR HA H N N 326 TYR HB2 H N N 327 TYR HB3 H N N 328 TYR HD1 H N N 329 TYR HD2 H N N 330 TYR HE1 H N N 331 TYR HE2 H N N 332 TYR HH H N N 333 TYR HXT H N N 334 VAL N N N N 335 VAL CA C N S 336 VAL C C N N 337 VAL O O N N 338 VAL CB C N N 339 VAL CG1 C N N 340 VAL CG2 C N N 341 VAL OXT O N N 342 VAL H H N N 343 VAL H2 H N N 344 VAL HA H N N 345 VAL HB H N N 346 VAL HG11 H N N 347 VAL HG12 H N N 348 VAL HG13 H N N 349 VAL HG21 H N N 350 VAL HG22 H N N 351 VAL HG23 H N N 352 VAL HXT H N N 353 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 ASP N CA sing N N 29 ASP N H sing N N 30 ASP N H2 sing N N 31 ASP CA C sing N N 32 ASP CA CB sing N N 33 ASP CA HA sing N N 34 ASP C O doub N N 35 ASP C OXT sing N N 36 ASP CB CG sing N N 37 ASP CB HB2 sing N N 38 ASP CB HB3 sing N N 39 ASP CG OD1 doub N N 40 ASP CG OD2 sing N N 41 ASP OD2 HD2 sing N N 42 ASP OXT HXT sing N N 43 CYS N CA sing N N 44 CYS N H sing N N 45 CYS N H2 sing N N 46 CYS CA C sing N N 47 CYS CA CB sing N N 48 CYS CA HA sing N N 49 CYS C O doub N N 50 CYS C OXT sing N N 51 CYS CB SG sing N N 52 CYS CB HB2 sing N N 53 CYS CB HB3 sing N N 54 CYS SG HG sing N N 55 CYS OXT HXT sing N N 56 GLN N CA sing N N 57 GLN N H sing N N 58 GLN N H2 sing N N 59 GLN CA C sing N N 60 GLN CA CB sing N N 61 GLN CA HA sing N N 62 GLN C O doub N N 63 GLN C OXT sing N N 64 GLN CB CG sing N N 65 GLN CB HB2 sing N N 66 GLN CB HB3 sing N N 67 GLN CG CD sing N N 68 GLN CG HG2 sing N N 69 GLN CG HG3 sing N N 70 GLN CD OE1 doub N N 71 GLN CD NE2 sing N N 72 GLN NE2 HE21 sing N N 73 GLN NE2 HE22 sing N N 74 GLN OXT HXT sing N N 75 GLU N CA sing N N 76 GLU N H sing N N 77 GLU N H2 sing N N 78 GLU CA C sing N N 79 GLU CA CB sing N N 80 GLU CA HA sing N N 81 GLU C O doub N N 82 GLU C OXT sing N N 83 GLU CB CG sing N N 84 GLU CB HB2 sing N N 85 GLU CB HB3 sing N N 86 GLU CG CD sing N N 87 GLU CG HG2 sing N N 88 GLU CG HG3 sing N N 89 GLU CD OE1 doub N N 90 GLU CD OE2 sing N N 91 GLU OE2 HE2 sing N N 92 GLU OXT HXT sing N N 93 GLY N CA sing N N 94 GLY N H sing N N 95 GLY N H2 sing N N 96 GLY CA C sing N N 97 GLY CA HA2 sing N N 98 GLY CA HA3 sing N N 99 GLY C O doub N N 100 GLY C OXT sing N N 101 GLY OXT HXT sing N N 102 GOL C1 O1 sing N N 103 GOL C1 C2 sing N N 104 GOL C1 H11 sing N N 105 GOL C1 H12 sing N N 106 GOL O1 HO1 sing N N 107 GOL C2 O2 sing N N 108 GOL C2 C3 sing N N 109 GOL C2 H2 sing N N 110 GOL O2 HO2 sing N N 111 GOL C3 O3 sing N N 112 GOL C3 H31 sing N N 113 GOL C3 H32 sing N N 114 GOL O3 HO3 sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LMR C1 O1A doub N N 181 LMR C1 O1B sing N N 182 LMR C1 C2 sing N N 183 LMR C2 O2 sing N N 184 LMR C2 C3 sing N N 185 LMR C3 C4 sing N N 186 LMR C4 O4A sing N N 187 LMR C4 O4B doub N N 188 LMR C2 H2 sing N N 189 LMR O2 HO2 sing N N 190 LMR C3 H3 sing N N 191 LMR C3 H3A sing N N 192 LMR O1B H4 sing N N 193 LMR O4A H5 sing N N 194 LYS N CA sing N N 195 LYS N H sing N N 196 LYS N H2 sing N N 197 LYS CA C sing N N 198 LYS CA CB sing N N 199 LYS CA HA sing N N 200 LYS C O doub N N 201 LYS C OXT sing N N 202 LYS CB CG sing N N 203 LYS CB HB2 sing N N 204 LYS CB HB3 sing N N 205 LYS CG CD sing N N 206 LYS CG HG2 sing N N 207 LYS CG HG3 sing N N 208 LYS CD CE sing N N 209 LYS CD HD2 sing N N 210 LYS CD HD3 sing N N 211 LYS CE NZ sing N N 212 LYS CE HE2 sing N N 213 LYS CE HE3 sing N N 214 LYS NZ HZ1 sing N N 215 LYS NZ HZ2 sing N N 216 LYS NZ HZ3 sing N N 217 LYS OXT HXT sing N N 218 MET N CA sing N N 219 MET N H sing N N 220 MET N H2 sing N N 221 MET CA C sing N N 222 MET CA CB sing N N 223 MET CA HA sing N N 224 MET C O doub N N 225 MET C OXT sing N N 226 MET CB CG sing N N 227 MET CB HB2 sing N N 228 MET CB HB3 sing N N 229 MET CG SD sing N N 230 MET CG HG2 sing N N 231 MET CG HG3 sing N N 232 MET SD CE sing N N 233 MET CE HE1 sing N N 234 MET CE HE2 sing N N 235 MET CE HE3 sing N N 236 MET OXT HXT sing N N 237 PHE N CA sing N N 238 PHE N H sing N N 239 PHE N H2 sing N N 240 PHE CA C sing N N 241 PHE CA CB sing N N 242 PHE CA HA sing N N 243 PHE C O doub N N 244 PHE C OXT sing N N 245 PHE CB CG sing N N 246 PHE CB HB2 sing N N 247 PHE CB HB3 sing N N 248 PHE CG CD1 doub Y N 249 PHE CG CD2 sing Y N 250 PHE CD1 CE1 sing Y N 251 PHE CD1 HD1 sing N N 252 PHE CD2 CE2 doub Y N 253 PHE CD2 HD2 sing N N 254 PHE CE1 CZ doub Y N 255 PHE CE1 HE1 sing N N 256 PHE CE2 CZ sing Y N 257 PHE CE2 HE2 sing N N 258 PHE CZ HZ sing N N 259 PHE OXT HXT sing N N 260 PO4 P O1 doub N N 261 PO4 P O2 sing N N 262 PO4 P O3 sing N N 263 PO4 P O4 sing N N 264 SER N CA sing N N 265 SER N H sing N N 266 SER N H2 sing N N 267 SER CA C sing N N 268 SER CA CB sing N N 269 SER CA HA sing N N 270 SER C O doub N N 271 SER C OXT sing N N 272 SER CB OG sing N N 273 SER CB HB2 sing N N 274 SER CB HB3 sing N N 275 SER OG HG sing N N 276 SER OXT HXT sing N N 277 THR N CA sing N N 278 THR N H sing N N 279 THR N H2 sing N N 280 THR CA C sing N N 281 THR CA CB sing N N 282 THR CA HA sing N N 283 THR C O doub N N 284 THR C OXT sing N N 285 THR CB OG1 sing N N 286 THR CB CG2 sing N N 287 THR CB HB sing N N 288 THR OG1 HG1 sing N N 289 THR CG2 HG21 sing N N 290 THR CG2 HG22 sing N N 291 THR CG2 HG23 sing N N 292 THR OXT HXT sing N N 293 TYR N CA sing N N 294 TYR N H sing N N 295 TYR N H2 sing N N 296 TYR CA C sing N N 297 TYR CA CB sing N N 298 TYR CA HA sing N N 299 TYR C O doub N N 300 TYR C OXT sing N N 301 TYR CB CG sing N N 302 TYR CB HB2 sing N N 303 TYR CB HB3 sing N N 304 TYR CG CD1 doub Y N 305 TYR CG CD2 sing Y N 306 TYR CD1 CE1 sing Y N 307 TYR CD1 HD1 sing N N 308 TYR CD2 CE2 doub Y N 309 TYR CD2 HD2 sing N N 310 TYR CE1 CZ doub Y N 311 TYR CE1 HE1 sing N N 312 TYR CE2 CZ sing Y N 313 TYR CE2 HE2 sing N N 314 TYR CZ OH sing N N 315 TYR OH HH sing N N 316 TYR OXT HXT sing N N 317 VAL N CA sing N N 318 VAL N H sing N N 319 VAL N H2 sing N N 320 VAL CA C sing N N 321 VAL CA CB sing N N 322 VAL CA HA sing N N 323 VAL C O doub N N 324 VAL C OXT sing N N 325 VAL CB CG1 sing N N 326 VAL CB CG2 sing N N 327 VAL CB HB sing N N 328 VAL CG1 HG11 sing N N 329 VAL CG1 HG12 sing N N 330 VAL CG1 HG13 sing N N 331 VAL CG2 HG21 sing N N 332 VAL CG2 HG22 sing N N 333 VAL CG2 HG23 sing N N 334 VAL OXT HXT sing N N 335 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'European Research Council (ERC)' 'European Union' 802217 1 'Austrian Science Fund' Austria P30826 2 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'in silico model' _pdbx_initial_refinement_model.source_name AlphaFold _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'P 1' _space_group.name_Hall 'P 1' _space_group.IT_number 1 _space_group.crystal_system triclinic _space_group.id 1 # _atom_sites.entry_id 9S1T _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.027347 _atom_sites.fract_transf_matrix[1][2] 0.005772 _atom_sites.fract_transf_matrix[1][3] 0.003204 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.026478 _atom_sites.fract_transf_matrix[2][3] 0.005747 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.017254 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 7.96527 ? ? ? 9.05267 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? P ? ? 9.51135 5.44231 ? ? 1.42069 35.72801 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ #