data_9T4L # _entry.id 9T4L # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.415 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9T4L pdb_00009t4l 10.2210/pdb9t4l/pdb WWPDB D_1292151739 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-06-10 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9T4L _pdbx_database_status.recvd_initial_deposition_date 2025-10-30 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 3 _pdbx_contact_author.email xbeatriz@iqf.csic.es _pdbx_contact_author.name_first Beatriz _pdbx_contact_author.name_last 'Gonzalez Perez' _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-0710-0202 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Casas-Florez, D.' 1 0009-0000-3550-4370 'Marquez-Monino, M.A.' 2 0000-0003-3255-9135 'Gonzalez, B.' 3 0000-0002-0710-0202 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Int.J.Biol.Macromol. _citation.journal_id_ASTM IJBMDR _citation.journal_id_CSD 0708 _citation.journal_id_ISSN 0141-8130 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first 152715 _citation.page_last 152715 _citation.title ;The DIPP1 family binds IP 8 in catalytically-productive twist-boat and chair conformations and associates in a ligand-dependent manner. ; _citation.year 2026 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.ijbiomac.2026.152715 _citation.pdbx_database_id_PubMed 42202926 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Casas-Florez, D.' 1 ? primary 'Whitfield, H.' 2 ? primary 'Perez-Canadillas, J.M.' 3 ? primary 'Monterroso, B.' 4 ? primary 'Riley, A.M.' 5 ? primary 'Marquez-Monino, M.A.' 6 0000-0001-6835-5850 primary 'Shipton, M.L.' 7 ? primary 'Sanz-Aparicio, J.' 8 ? primary 'Brearley, C.A.' 9 ? primary 'Potter, B.V.L.' 10 ? primary 'Gonzalez, B.' 11 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Diphosphoinositol polyphosphate phosphohydrolase 1' 17426.752 1 3.6.1.52,3.6.1.61,3.6.1.10,3.6.1.62,3.6.1.59 'Deletion of the last 24 C-terminal residues (149-172) and E108N' ? ;Deletion of the last 24 C-terminal residues (149-172), the first three amino acids (GHM) remain as residual residues after removal of the expression tag. ; 2 non-polymer syn 'INOSITOL HEXAKISPHOSPHATE' 660.035 1 ? ? ? ? 3 non-polymer syn 'MAGNESIUM ION' 24.305 4 ? ? ? ? 4 non-polymer syn 'CHLORIDE ION' 35.453 2 ? ? ? ? 5 water nat water 18.015 239 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;DIPP-1,Diadenosine hexaphosphate hydrolase,Ap6A hydrolase,Endopolyphosphatase,Nucleoside diphosphate-linked moiety X motif 3,Nudix motif 3,m7GpppN-mRNA hydrolase,m7GpppX diphosphatase ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GHMMMKLKSNQTRTYDGDGYKKRAACLCFRSESEEEVLLVSSSRHPDRWIVPGGGMEPEEEPSVAAVREVCEEAGVKGTL GRLVGIFENQERKHRTYVYVLIVTEVLEDWNDSVNIGRKREWFKIEDAIKVLQYHKPVQASYFETLRQGYS ; _entity_poly.pdbx_seq_one_letter_code_can ;GHMMMKLKSNQTRTYDGDGYKKRAACLCFRSESEEEVLLVSSSRHPDRWIVPGGGMEPEEEPSVAAVREVCEEAGVKGTL GRLVGIFENQERKHRTYVYVLIVTEVLEDWNDSVNIGRKREWFKIEDAIKVLQYHKPVQASYFETLRQGYS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'INOSITOL HEXAKISPHOSPHATE' IHP 3 'MAGNESIUM ION' MG 4 'CHLORIDE ION' CL 5 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 HIS n 1 3 MET n 1 4 MET n 1 5 MET n 1 6 LYS n 1 7 LEU n 1 8 LYS n 1 9 SER n 1 10 ASN n 1 11 GLN n 1 12 THR n 1 13 ARG n 1 14 THR n 1 15 TYR n 1 16 ASP n 1 17 GLY n 1 18 ASP n 1 19 GLY n 1 20 TYR n 1 21 LYS n 1 22 LYS n 1 23 ARG n 1 24 ALA n 1 25 ALA n 1 26 CYS n 1 27 LEU n 1 28 CYS n 1 29 PHE n 1 30 ARG n 1 31 SER n 1 32 GLU n 1 33 SER n 1 34 GLU n 1 35 GLU n 1 36 GLU n 1 37 VAL n 1 38 LEU n 1 39 LEU n 1 40 VAL n 1 41 SER n 1 42 SER n 1 43 SER n 1 44 ARG n 1 45 HIS n 1 46 PRO n 1 47 ASP n 1 48 ARG n 1 49 TRP n 1 50 ILE n 1 51 VAL n 1 52 PRO n 1 53 GLY n 1 54 GLY n 1 55 GLY n 1 56 MET n 1 57 GLU n 1 58 PRO n 1 59 GLU n 1 60 GLU n 1 61 GLU n 1 62 PRO n 1 63 SER n 1 64 VAL n 1 65 ALA n 1 66 ALA n 1 67 VAL n 1 68 ARG n 1 69 GLU n 1 70 VAL n 1 71 CYS n 1 72 GLU n 1 73 GLU n 1 74 ALA n 1 75 GLY n 1 76 VAL n 1 77 LYS n 1 78 GLY n 1 79 THR n 1 80 LEU n 1 81 GLY n 1 82 ARG n 1 83 LEU n 1 84 VAL n 1 85 GLY n 1 86 ILE n 1 87 PHE n 1 88 GLU n 1 89 ASN n 1 90 GLN n 1 91 GLU n 1 92 ARG n 1 93 LYS n 1 94 HIS n 1 95 ARG n 1 96 THR n 1 97 TYR n 1 98 VAL n 1 99 TYR n 1 100 VAL n 1 101 LEU n 1 102 ILE n 1 103 VAL n 1 104 THR n 1 105 GLU n 1 106 VAL n 1 107 LEU n 1 108 GLU n 1 109 ASP n 1 110 TRP n 1 111 ASN n 1 112 ASP n 1 113 SER n 1 114 VAL n 1 115 ASN n 1 116 ILE n 1 117 GLY n 1 118 ARG n 1 119 LYS n 1 120 ARG n 1 121 GLU n 1 122 TRP n 1 123 PHE n 1 124 LYS n 1 125 ILE n 1 126 GLU n 1 127 ASP n 1 128 ALA n 1 129 ILE n 1 130 LYS n 1 131 VAL n 1 132 LEU n 1 133 GLN n 1 134 TYR n 1 135 HIS n 1 136 LYS n 1 137 PRO n 1 138 VAL n 1 139 GLN n 1 140 ALA n 1 141 SER n 1 142 TYR n 1 143 PHE n 1 144 GLU n 1 145 THR n 1 146 LEU n 1 147 ARG n 1 148 GLN n 1 149 GLY n 1 150 TYR n 1 151 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 151 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'NUDT3, DIPP, DIPP1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain Star _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 IHP non-polymer . 'INOSITOL HEXAKISPHOSPHATE' 'MYO-INOSITOL HEXAKISPHOSPHATE; INOSITOL 1,2,3,4,5,6-HEXAKISPHOSPHATE' 'C6 H18 O24 P6' 660.035 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -2 ? ? ? A . n A 1 2 HIS 2 -1 ? ? ? A . n A 1 3 MET 3 0 0 MET MET A . n A 1 4 MET 4 1 1 MET MET A . n A 1 5 MET 5 2 2 MET MET A . n A 1 6 LYS 6 3 3 LYS LYS A . n A 1 7 LEU 7 4 4 LEU LEU A . n A 1 8 LYS 8 5 5 LYS LYS A . n A 1 9 SER 9 6 6 SER SER A . n A 1 10 ASN 10 7 7 ASN ASN A . n A 1 11 GLN 11 8 8 GLN GLN A . n A 1 12 THR 12 9 9 THR THR A . n A 1 13 ARG 13 10 10 ARG ARG A . n A 1 14 THR 14 11 11 THR THR A . n A 1 15 TYR 15 12 12 TYR TYR A . n A 1 16 ASP 16 13 13 ASP ASP A . n A 1 17 GLY 17 14 14 GLY GLY A . n A 1 18 ASP 18 15 15 ASP ASP A . n A 1 19 GLY 19 16 16 GLY GLY A . n A 1 20 TYR 20 17 17 TYR TYR A . n A 1 21 LYS 21 18 18 LYS LYS A . n A 1 22 LYS 22 19 19 LYS LYS A . n A 1 23 ARG 23 20 20 ARG ARG A . n A 1 24 ALA 24 21 21 ALA ALA A . n A 1 25 ALA 25 22 22 ALA ALA A . n A 1 26 CYS 26 23 23 CYS CYS A . n A 1 27 LEU 27 24 24 LEU LEU A . n A 1 28 CYS 28 25 25 CYS CYS A . n A 1 29 PHE 29 26 26 PHE PHE A . n A 1 30 ARG 30 27 27 ARG ARG A . n A 1 31 SER 31 28 28 SER SER A . n A 1 32 GLU 32 29 29 GLU GLU A . n A 1 33 SER 33 30 30 SER SER A . n A 1 34 GLU 34 31 31 GLU GLU A . n A 1 35 GLU 35 32 32 GLU GLU A . n A 1 36 GLU 36 33 33 GLU GLU A . n A 1 37 VAL 37 34 34 VAL VAL A . n A 1 38 LEU 38 35 35 LEU LEU A . n A 1 39 LEU 39 36 36 LEU LEU A . n A 1 40 VAL 40 37 37 VAL VAL A . n A 1 41 SER 41 38 38 SER SER A . n A 1 42 SER 42 39 39 SER SER A . n A 1 43 SER 43 40 40 SER SER A . n A 1 44 ARG 44 41 41 ARG ARG A . n A 1 45 HIS 45 42 42 HIS HIS A . n A 1 46 PRO 46 43 43 PRO PRO A . n A 1 47 ASP 47 44 44 ASP ASP A . n A 1 48 ARG 48 45 45 ARG ARG A . n A 1 49 TRP 49 46 46 TRP TRP A . n A 1 50 ILE 50 47 47 ILE ILE A . n A 1 51 VAL 51 48 48 VAL VAL A . n A 1 52 PRO 52 49 49 PRO PRO A . n A 1 53 GLY 53 50 50 GLY GLY A . n A 1 54 GLY 54 51 51 GLY GLY A . n A 1 55 GLY 55 52 52 GLY GLY A . n A 1 56 MET 56 53 53 MET MET A . n A 1 57 GLU 57 54 54 GLU GLU A . n A 1 58 PRO 58 55 55 PRO PRO A . n A 1 59 GLU 59 56 56 GLU GLU A . n A 1 60 GLU 60 57 57 GLU GLU A . n A 1 61 GLU 61 58 58 GLU GLU A . n A 1 62 PRO 62 59 59 PRO PRO A . n A 1 63 SER 63 60 60 SER SER A . n A 1 64 VAL 64 61 61 VAL VAL A . n A 1 65 ALA 65 62 62 ALA ALA A . n A 1 66 ALA 66 63 63 ALA ALA A . n A 1 67 VAL 67 64 64 VAL VAL A . n A 1 68 ARG 68 65 65 ARG ARG A . n A 1 69 GLU 69 66 66 GLU GLU A . n A 1 70 VAL 70 67 67 VAL VAL A . n A 1 71 CYS 71 68 68 CYS CYS A . n A 1 72 GLU 72 69 69 GLU GLU A . n A 1 73 GLU 73 70 70 GLU GLU A . n A 1 74 ALA 74 71 71 ALA ALA A . n A 1 75 GLY 75 72 72 GLY GLY A . n A 1 76 VAL 76 73 73 VAL VAL A . n A 1 77 LYS 77 74 74 LYS LYS A . n A 1 78 GLY 78 75 75 GLY GLY A . n A 1 79 THR 79 76 76 THR THR A . n A 1 80 LEU 80 77 77 LEU LEU A . n A 1 81 GLY 81 78 78 GLY GLY A . n A 1 82 ARG 82 79 79 ARG ARG A . n A 1 83 LEU 83 80 80 LEU LEU A . n A 1 84 VAL 84 81 81 VAL VAL A . n A 1 85 GLY 85 82 82 GLY GLY A . n A 1 86 ILE 86 83 83 ILE ILE A . n A 1 87 PHE 87 84 84 PHE PHE A . n A 1 88 GLU 88 85 85 GLU GLU A . n A 1 89 ASN 89 86 86 ASN ASN A . n A 1 90 GLN 90 87 87 GLN GLN A . n A 1 91 GLU 91 88 88 GLU GLU A . n A 1 92 ARG 92 89 89 ARG ARG A . n A 1 93 LYS 93 90 90 LYS LYS A . n A 1 94 HIS 94 91 91 HIS HIS A . n A 1 95 ARG 95 92 92 ARG ARG A . n A 1 96 THR 96 93 93 THR THR A . n A 1 97 TYR 97 94 94 TYR TYR A . n A 1 98 VAL 98 95 95 VAL VAL A . n A 1 99 TYR 99 96 96 TYR TYR A . n A 1 100 VAL 100 97 97 VAL VAL A . n A 1 101 LEU 101 98 98 LEU LEU A . n A 1 102 ILE 102 99 99 ILE ILE A . n A 1 103 VAL 103 100 100 VAL VAL A . n A 1 104 THR 104 101 101 THR THR A . n A 1 105 GLU 105 102 102 GLU GLU A . n A 1 106 VAL 106 103 103 VAL VAL A . n A 1 107 LEU 107 104 104 LEU LEU A . n A 1 108 GLU 108 105 105 GLU GLU A . n A 1 109 ASP 109 106 106 ASP ASP A . n A 1 110 TRP 110 107 107 TRP TRP A . n A 1 111 ASN 111 108 108 ASN ASN A . n A 1 112 ASP 112 109 109 ASP ASP A . n A 1 113 SER 113 110 110 SER SER A . n A 1 114 VAL 114 111 111 VAL VAL A . n A 1 115 ASN 115 112 112 ASN ASN A . n A 1 116 ILE 116 113 113 ILE ILE A . n A 1 117 GLY 117 114 114 GLY GLY A . n A 1 118 ARG 118 115 115 ARG ARG A . n A 1 119 LYS 119 116 116 LYS LYS A . n A 1 120 ARG 120 117 117 ARG ARG A . n A 1 121 GLU 121 118 118 GLU GLU A . n A 1 122 TRP 122 119 119 TRP TRP A . n A 1 123 PHE 123 120 120 PHE PHE A . n A 1 124 LYS 124 121 121 LYS LYS A . n A 1 125 ILE 125 122 122 ILE ILE A . n A 1 126 GLU 126 123 123 GLU GLU A . n A 1 127 ASP 127 124 124 ASP ASP A . n A 1 128 ALA 128 125 125 ALA ALA A . n A 1 129 ILE 129 126 126 ILE ILE A . n A 1 130 LYS 130 127 127 LYS LYS A . n A 1 131 VAL 131 128 128 VAL VAL A . n A 1 132 LEU 132 129 129 LEU LEU A . n A 1 133 GLN 133 130 130 GLN GLN A . n A 1 134 TYR 134 131 131 TYR TYR A . n A 1 135 HIS 135 132 132 HIS HIS A . n A 1 136 LYS 136 133 133 LYS LYS A . n A 1 137 PRO 137 134 134 PRO PRO A . n A 1 138 VAL 138 135 135 VAL VAL A . n A 1 139 GLN 139 136 136 GLN GLN A . n A 1 140 ALA 140 137 137 ALA ALA A . n A 1 141 SER 141 138 138 SER SER A . n A 1 142 TYR 142 139 139 TYR TYR A . n A 1 143 PHE 143 140 140 PHE PHE A . n A 1 144 GLU 144 141 141 GLU GLU A . n A 1 145 THR 145 142 142 THR THR A . n A 1 146 LEU 146 143 143 LEU LEU A . n A 1 147 ARG 147 144 144 ARG ARG A . n A 1 148 GLN 148 145 145 GLN GLN A . n A 1 149 GLY 149 146 146 GLY GLY A . n A 1 150 TYR 150 147 147 TYR TYR A . n A 1 151 SER 151 148 148 SER SER A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id IHP _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id IHP _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 IHP 1 201 201 IHP IHP A . C 3 MG 1 202 1 MG MG A . D 3 MG 1 203 3 MG MG A . E 3 MG 1 204 4 MG MG A . F 3 MG 1 205 5 MG MG A . G 4 CL 1 206 1 CL CL A . H 4 CL 1 207 2 CL CL A . I 5 HOH 1 301 267 HOH HOH A . I 5 HOH 2 302 271 HOH HOH A . I 5 HOH 3 303 254 HOH HOH A . I 5 HOH 4 304 94 HOH HOH A . I 5 HOH 5 305 265 HOH HOH A . I 5 HOH 6 306 120 HOH HOH A . I 5 HOH 7 307 55 HOH HOH A . I 5 HOH 8 308 96 HOH HOH A . I 5 HOH 9 309 205 HOH HOH A . I 5 HOH 10 310 266 HOH HOH A . I 5 HOH 11 311 12 HOH HOH A . I 5 HOH 12 312 127 HOH HOH A . I 5 HOH 13 313 233 HOH HOH A . I 5 HOH 14 314 143 HOH HOH A . I 5 HOH 15 315 102 HOH HOH A . I 5 HOH 16 316 50 HOH HOH A . I 5 HOH 17 317 253 HOH HOH A . I 5 HOH 18 318 149 HOH HOH A . I 5 HOH 19 319 63 HOH HOH A . I 5 HOH 20 320 115 HOH HOH A . I 5 HOH 21 321 192 HOH HOH A . I 5 HOH 22 322 157 HOH HOH A . I 5 HOH 23 323 264 HOH HOH A . I 5 HOH 24 324 117 HOH HOH A . I 5 HOH 25 325 101 HOH HOH A . I 5 HOH 26 326 173 HOH HOH A . I 5 HOH 27 327 116 HOH HOH A . I 5 HOH 28 328 132 HOH HOH A . I 5 HOH 29 329 260 HOH HOH A . I 5 HOH 30 330 43 HOH HOH A . I 5 HOH 31 331 16 HOH HOH A . I 5 HOH 32 332 229 HOH HOH A . I 5 HOH 33 333 255 HOH HOH A . I 5 HOH 34 334 90 HOH HOH A . I 5 HOH 35 335 231 HOH HOH A . I 5 HOH 36 336 121 HOH HOH A . I 5 HOH 37 337 159 HOH HOH A . I 5 HOH 38 338 47 HOH HOH A . I 5 HOH 39 339 182 HOH HOH A . I 5 HOH 40 340 130 HOH HOH A . I 5 HOH 41 341 228 HOH HOH A . I 5 HOH 42 342 252 HOH HOH A . I 5 HOH 43 343 128 HOH HOH A . I 5 HOH 44 344 87 HOH HOH A . I 5 HOH 45 345 74 HOH HOH A . I 5 HOH 46 346 274 HOH HOH A . I 5 HOH 47 347 28 HOH HOH A . I 5 HOH 48 348 135 HOH HOH A . I 5 HOH 49 349 155 HOH HOH A . I 5 HOH 50 350 33 HOH HOH A . I 5 HOH 51 351 256 HOH HOH A . I 5 HOH 52 352 11 HOH HOH A . I 5 HOH 53 353 53 HOH HOH A . I 5 HOH 54 354 242 HOH HOH A . I 5 HOH 55 355 113 HOH HOH A . I 5 HOH 56 356 40 HOH HOH A . I 5 HOH 57 357 81 HOH HOH A . I 5 HOH 58 358 22 HOH HOH A . I 5 HOH 59 359 174 HOH HOH A . I 5 HOH 60 360 34 HOH HOH A . I 5 HOH 61 361 75 HOH HOH A . I 5 HOH 62 362 110 HOH HOH A . I 5 HOH 63 363 10 HOH HOH A . I 5 HOH 64 364 109 HOH HOH A . I 5 HOH 65 365 134 HOH HOH A . I 5 HOH 66 366 89 HOH HOH A . I 5 HOH 67 367 91 HOH HOH A . I 5 HOH 68 368 7 HOH HOH A . I 5 HOH 69 369 269 HOH HOH A . I 5 HOH 70 370 93 HOH HOH A . I 5 HOH 71 371 111 HOH HOH A . I 5 HOH 72 372 36 HOH HOH A . I 5 HOH 73 373 148 HOH HOH A . I 5 HOH 74 374 160 HOH HOH A . I 5 HOH 75 375 70 HOH HOH A . I 5 HOH 76 376 232 HOH HOH A . I 5 HOH 77 377 257 HOH HOH A . I 5 HOH 78 378 78 HOH HOH A . I 5 HOH 79 379 31 HOH HOH A . I 5 HOH 80 380 162 HOH HOH A . I 5 HOH 81 381 26 HOH HOH A . I 5 HOH 82 382 238 HOH HOH A . I 5 HOH 83 383 214 HOH HOH A . I 5 HOH 84 384 66 HOH HOH A . I 5 HOH 85 385 122 HOH HOH A . I 5 HOH 86 386 21 HOH HOH A . I 5 HOH 87 387 137 HOH HOH A . I 5 HOH 88 388 44 HOH HOH A . I 5 HOH 89 389 15 HOH HOH A . I 5 HOH 90 390 241 HOH HOH A . I 5 HOH 91 391 201 HOH HOH A . I 5 HOH 92 392 261 HOH HOH A . I 5 HOH 93 393 263 HOH HOH A . I 5 HOH 94 394 83 HOH HOH A . I 5 HOH 95 395 48 HOH HOH A . I 5 HOH 96 396 171 HOH HOH A . I 5 HOH 97 397 73 HOH HOH A . I 5 HOH 98 398 65 HOH HOH A . I 5 HOH 99 399 3 HOH HOH A . I 5 HOH 100 400 165 HOH HOH A . I 5 HOH 101 401 164 HOH HOH A . I 5 HOH 102 402 20 HOH HOH A . I 5 HOH 103 403 99 HOH HOH A . I 5 HOH 104 404 227 HOH HOH A . I 5 HOH 105 405 30 HOH HOH A . I 5 HOH 106 406 18 HOH HOH A . I 5 HOH 107 407 52 HOH HOH A . I 5 HOH 108 408 119 HOH HOH A . I 5 HOH 109 409 19 HOH HOH A . I 5 HOH 110 410 39 HOH HOH A . I 5 HOH 111 411 225 HOH HOH A . I 5 HOH 112 412 251 HOH HOH A . I 5 HOH 113 413 114 HOH HOH A . I 5 HOH 114 414 234 HOH HOH A . I 5 HOH 115 415 98 HOH HOH A . I 5 HOH 116 416 29 HOH HOH A . I 5 HOH 117 417 208 HOH HOH A . I 5 HOH 118 418 237 HOH HOH A . I 5 HOH 119 419 235 HOH HOH A . I 5 HOH 120 420 6 HOH HOH A . I 5 HOH 121 421 58 HOH HOH A . I 5 HOH 122 422 202 HOH HOH A . I 5 HOH 123 423 32 HOH HOH A . I 5 HOH 124 424 245 HOH HOH A . I 5 HOH 125 425 104 HOH HOH A . I 5 HOH 126 426 45 HOH HOH A . I 5 HOH 127 427 64 HOH HOH A . I 5 HOH 128 428 153 HOH HOH A . I 5 HOH 129 429 92 HOH HOH A . I 5 HOH 130 430 100 HOH HOH A . I 5 HOH 131 431 13 HOH HOH A . I 5 HOH 132 432 210 HOH HOH A . I 5 HOH 133 433 51 HOH HOH A . I 5 HOH 134 434 236 HOH HOH A . I 5 HOH 135 435 226 HOH HOH A . I 5 HOH 136 436 8 HOH HOH A . I 5 HOH 137 437 194 HOH HOH A . I 5 HOH 138 438 196 HOH HOH A . I 5 HOH 139 439 131 HOH HOH A . I 5 HOH 140 440 67 HOH HOH A . I 5 HOH 141 441 37 HOH HOH A . I 5 HOH 142 442 141 HOH HOH A . I 5 HOH 143 443 4 HOH HOH A . I 5 HOH 144 444 249 HOH HOH A . I 5 HOH 145 445 177 HOH HOH A . I 5 HOH 146 446 23 HOH HOH A . I 5 HOH 147 447 79 HOH HOH A . I 5 HOH 148 448 123 HOH HOH A . I 5 HOH 149 449 27 HOH HOH A . I 5 HOH 150 450 150 HOH HOH A . I 5 HOH 151 451 76 HOH HOH A . I 5 HOH 152 452 142 HOH HOH A . I 5 HOH 153 453 1 HOH HOH A . I 5 HOH 154 454 2 HOH HOH A . I 5 HOH 155 455 176 HOH HOH A . I 5 HOH 156 456 68 HOH HOH A . I 5 HOH 157 457 118 HOH HOH A . I 5 HOH 158 458 14 HOH HOH A . I 5 HOH 159 459 217 HOH HOH A . I 5 HOH 160 460 42 HOH HOH A . I 5 HOH 161 461 69 HOH HOH A . I 5 HOH 162 462 206 HOH HOH A . I 5 HOH 163 463 105 HOH HOH A . I 5 HOH 164 464 9 HOH HOH A . I 5 HOH 165 465 129 HOH HOH A . I 5 HOH 166 466 273 HOH HOH A . I 5 HOH 167 467 178 HOH HOH A . I 5 HOH 168 468 35 HOH HOH A . I 5 HOH 169 469 86 HOH HOH A . I 5 HOH 170 470 133 HOH HOH A . I 5 HOH 171 471 46 HOH HOH A . I 5 HOH 172 472 72 HOH HOH A . I 5 HOH 173 473 24 HOH HOH A . I 5 HOH 174 474 84 HOH HOH A . I 5 HOH 175 475 166 HOH HOH A . I 5 HOH 176 476 154 HOH HOH A . I 5 HOH 177 477 246 HOH HOH A . I 5 HOH 178 478 198 HOH HOH A . I 5 HOH 179 479 5 HOH HOH A . I 5 HOH 180 480 170 HOH HOH A . I 5 HOH 181 481 156 HOH HOH A . I 5 HOH 182 482 82 HOH HOH A . I 5 HOH 183 483 140 HOH HOH A . I 5 HOH 184 484 268 HOH HOH A . I 5 HOH 185 485 103 HOH HOH A . I 5 HOH 186 486 185 HOH HOH A . I 5 HOH 187 487 240 HOH HOH A . I 5 HOH 188 488 204 HOH HOH A . I 5 HOH 189 489 258 HOH HOH A . I 5 HOH 190 490 211 HOH HOH A . I 5 HOH 191 491 209 HOH HOH A . I 5 HOH 192 492 180 HOH HOH A . I 5 HOH 193 493 88 HOH HOH A . I 5 HOH 194 494 97 HOH HOH A . I 5 HOH 195 495 207 HOH HOH A . I 5 HOH 196 496 239 HOH HOH A . I 5 HOH 197 497 270 HOH HOH A . I 5 HOH 198 498 218 HOH HOH A . I 5 HOH 199 499 272 HOH HOH A . I 5 HOH 200 500 56 HOH HOH A . I 5 HOH 201 501 108 HOH HOH A . I 5 HOH 202 502 126 HOH HOH A . I 5 HOH 203 503 38 HOH HOH A . I 5 HOH 204 504 224 HOH HOH A . I 5 HOH 205 505 95 HOH HOH A . I 5 HOH 206 506 124 HOH HOH A . I 5 HOH 207 507 61 HOH HOH A . I 5 HOH 208 508 248 HOH HOH A . I 5 HOH 209 509 151 HOH HOH A . I 5 HOH 210 510 247 HOH HOH A . I 5 HOH 211 511 106 HOH HOH A . I 5 HOH 212 512 230 HOH HOH A . I 5 HOH 213 513 259 HOH HOH A . I 5 HOH 214 514 213 HOH HOH A . I 5 HOH 215 515 189 HOH HOH A . I 5 HOH 216 516 250 HOH HOH A . I 5 HOH 217 517 190 HOH HOH A . I 5 HOH 218 518 244 HOH HOH A . I 5 HOH 219 519 57 HOH HOH A . I 5 HOH 220 520 112 HOH HOH A . I 5 HOH 221 521 215 HOH HOH A . I 5 HOH 222 522 169 HOH HOH A . I 5 HOH 223 523 77 HOH HOH A . I 5 HOH 224 524 71 HOH HOH A . I 5 HOH 225 525 54 HOH HOH A . I 5 HOH 226 526 107 HOH HOH A . I 5 HOH 227 527 41 HOH HOH A . I 5 HOH 228 528 138 HOH HOH A . I 5 HOH 229 529 184 HOH HOH A . I 5 HOH 230 530 85 HOH HOH A . I 5 HOH 231 531 262 HOH HOH A . I 5 HOH 232 532 152 HOH HOH A . I 5 HOH 233 533 60 HOH HOH A . I 5 HOH 234 534 158 HOH HOH A . I 5 HOH 235 535 80 HOH HOH A . I 5 HOH 236 536 191 HOH HOH A . I 5 HOH 237 537 125 HOH HOH A . I 5 HOH 238 538 222 HOH HOH A . I 5 HOH 239 539 139 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? 'data processing' ? ? ? ? ? ? ? ? ? ? ? autoPROC ? ? ? 1.0.5 ? 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0419 ? 2 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? 0.9.8.92 ? 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? autoPROC ? ? ? 1.1.7 ? 4 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? autoPROC ? ? ? 1.1.7 ? 5 ? phasing ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0419 ? 6 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 9T4L _cell.details ? _cell.formula_units_Z ? _cell.length_a 34.473 _cell.length_a_esd ? _cell.length_b 65.398 _cell.length_b_esd ? _cell.length_c 77.972 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9T4L _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9T4L _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.6 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 53.4 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;Protein: 20mg/mL IP6: 10mM Precipitant condition: 25% PEG 3350, 0.1M Bis-Tris pH 5.5, 0.2M NaCl Ratio: 1:2 ; _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 289 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2024-05-03 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97926 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ALBA BEAMLINE XALOC' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97926 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline XALOC _diffrn_source.pdbx_synchrotron_site ALBA # _reflns.B_iso_Wilson_estimate 13.8 _reflns.entry_id 9T4L _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.13 _reflns.d_resolution_low 50.10 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 51069 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 94.4 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 11.8 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 16.72 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.02 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.13 _reflns_shell.d_res_low 1.23 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.6 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 2523 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.38 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.67 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] 0.062 _refine.aniso_B[1][2] 0.000 _refine.aniso_B[1][3] -0.000 _refine.aniso_B[2][2] -0.076 _refine.aniso_B[2][3] 0.000 _refine.aniso_B[3][3] 0.014 _refine.B_iso_max ? _refine.B_iso_mean 15.848 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.971 _refine.correlation_coeff_Fo_to_Fc_free 0.954 _refine.details 'Hydrogens have been added in their riding positions' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9T4L _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.13 _refine.ls_d_res_low 50.10 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 51069 _refine.ls_number_reflns_R_free 2564 _refine.ls_number_reflns_R_work 48505 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 76.255 _refine.ls_percent_reflns_R_free 5.021 _refine.ls_R_factor_all 0.175 _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.2035 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1731 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'MASK BULK SOLVENT' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'FOURIER SYNTHESIS' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.043 _refine.pdbx_overall_ESU_R_Free 0.047 _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 0.698 _refine.overall_SU_ML 0.031 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1209 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 42 _refine_hist.number_atoms_solvent 239 _refine_hist.number_atoms_total 1490 _refine_hist.d_res_high 1.13 _refine_hist.d_res_low 50.10 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.013 0.012 1399 ? r_bond_refined_d ? ? ? 'X-RAY DIFFRACTION' ? 0.001 0.016 1263 ? r_bond_other_d ? ? ? 'X-RAY DIFFRACTION' ? 2.096 1.888 1917 ? r_angle_refined_deg ? ? ? 'X-RAY DIFFRACTION' ? 0.700 1.794 2930 ? r_angle_other_deg ? ? ? 'X-RAY DIFFRACTION' ? 6.339 5.000 165 ? r_dihedral_angle_1_deg ? ? ? 'X-RAY DIFFRACTION' ? 10.583 5.000 13 ? r_dihedral_angle_2_deg ? ? ? 'X-RAY DIFFRACTION' ? 13.569 10.000 249 ? r_dihedral_angle_3_deg ? ? ? 'X-RAY DIFFRACTION' ? 15.467 10.000 67 ? r_dihedral_angle_6_deg ? ? ? 'X-RAY DIFFRACTION' ? 0.110 0.200 210 ? r_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.009 0.020 1628 ? r_gen_planes_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 318 ? r_gen_planes_other ? ? ? 'X-RAY DIFFRACTION' ? 0.217 0.200 228 ? r_nbd_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.193 0.200 1082 ? r_symmetry_nbd_other ? ? ? 'X-RAY DIFFRACTION' ? 0.182 0.200 594 ? r_nbtor_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.086 0.200 655 ? r_symmetry_nbtor_other ? ? ? 'X-RAY DIFFRACTION' ? 0.194 0.200 180 ? r_xyhbond_nbd_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.424 0.200 4 ? r_metal_ion_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.209 0.200 8 ? r_symmetry_nbd_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.176 0.200 43 ? r_nbd_other ? ? ? 'X-RAY DIFFRACTION' ? 0.173 0.200 18 ? r_symmetry_xyhbond_nbd_refined ? ? ? 'X-RAY DIFFRACTION' ? 1.633 1.429 642 ? r_mcbond_it ? ? ? 'X-RAY DIFFRACTION' ? 1.626 1.429 642 ? r_mcbond_other ? ? ? 'X-RAY DIFFRACTION' ? 2.428 2.563 813 ? r_mcangle_it ? ? ? 'X-RAY DIFFRACTION' ? 2.426 2.562 814 ? r_mcangle_other ? ? ? 'X-RAY DIFFRACTION' ? 3.211 1.882 757 ? r_scbond_it ? ? ? 'X-RAY DIFFRACTION' ? 3.255 1.887 710 ? r_scbond_other ? ? ? 'X-RAY DIFFRACTION' ? 4.931 3.268 1104 ? r_scangle_it ? ? ? 'X-RAY DIFFRACTION' ? 4.942 3.265 1099 ? r_scangle_other ? ? ? 'X-RAY DIFFRACTION' ? 7.240 19.230 1557 ? r_lrange_it ? ? ? 'X-RAY DIFFRACTION' ? 7.026 17.455 1471 ? r_lrange_other ? ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.13 1.159 . . 7 155 3.3136 . . . . 0.388 . . . . . . . . . . . . . . . 0.529 'X-RAY DIFFRACTION' 1.159 1.190 . . 38 777 17.0288 . . . . 0.315 . . . . . . . . . . . . . . . 0.296 'X-RAY DIFFRACTION' 1.190 1.225 . . 84 1335 30.9353 . . . . 0.300 . . . . . . . . . . . . . . . 0.312 'X-RAY DIFFRACTION' 1.225 1.263 . . 99 2215 51.2855 . . . . 0.281 . . . . . . . . . . . . . . . 0.359 'X-RAY DIFFRACTION' 1.263 1.304 . . 157 2826 68.2765 . . . . 0.260 . . . . . . . . . . . . . . . 0.293 'X-RAY DIFFRACTION' 1.304 1.350 . . 169 3644 90.1632 . . . . 0.247 . . . . . . . . . . . . . . . 0.296 'X-RAY DIFFRACTION' 1.350 1.401 . . 207 3865 99.7795 . . . . 0.216 . . . . . . . . . . . . . . . 0.243 'X-RAY DIFFRACTION' 1.401 1.458 . . 217 3731 100.0000 . . . . 0.201 . . . . . . . . . . . . . . . 0.251 'X-RAY DIFFRACTION' 1.458 1.523 . . 165 3629 99.9473 . . . . 0.180 . . . . . . . . . . . . . . . 0.213 'X-RAY DIFFRACTION' 1.523 1.597 . . 203 3425 100.0000 . . . . 0.174 . . . . . . . . . . . . . . . 0.184 'X-RAY DIFFRACTION' 1.597 1.683 . . 171 3279 100.0000 . . . . 0.166 . . . . . . . . . . . . . . . 0.206 'X-RAY DIFFRACTION' 1.683 1.785 . . 161 3105 100.0000 . . . . 0.166 . . . . . . . . . . . . . . . 0.181 'X-RAY DIFFRACTION' 1.785 1.908 . . 155 2944 100.0000 . . . . 0.157 . . . . . . . . . . . . . . . 0.174 'X-RAY DIFFRACTION' 1.908 2.061 . . 158 2719 100.0000 . . . . 0.157 . . . . . . . . . . . . . . . 0.166 'X-RAY DIFFRACTION' 2.061 2.257 . . 117 2563 100.0000 . . . . 0.152 . . . . . . . . . . . . . . . 0.167 'X-RAY DIFFRACTION' 2.257 2.523 . . 133 2282 100.0000 . . . . 0.150 . . . . . . . . . . . . . . . 0.169 'X-RAY DIFFRACTION' 2.523 2.912 . . 116 2042 100.0000 . . . . 0.157 . . . . . . . . . . . . . . . 0.189 'X-RAY DIFFRACTION' 2.912 3.563 . . 96 1749 100.0000 . . . . 0.163 . . . . . . . . . . . . . . . 0.204 'X-RAY DIFFRACTION' 3.563 5.027 . . 58 1409 100.0000 . . . . 0.144 . . . . . . . . . . . . . . . 0.215 'X-RAY DIFFRACTION' 5.027 50.10 . . 53 811 99.8844 . . . . 0.263 . . . . . . . . . . . . . . . 0.266 # _struct.entry_id 9T4L _struct.title 'HumanDiphosphoinositol Polyphosphate Phosphohydrolase 1 (DIPP1) E108N mutant in complex with IP6' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9T4L _struct_keywords.text 'Inositol metabolism, phosphatase, NUDIX hydrolases, DIPP1, IP6, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 3 ? F N N 3 ? G N N 4 ? H N N 4 ? I N N 5 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code NUDT3_HUMAN _struct_ref.pdbx_db_accession O95989 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MMKLKSNQTRTYDGDGYKKRAACLCFRSESEEEVLLVSSSRHPDRWIVPGGGMEPEEEPSVAAVREVCEEAGVKGTLGRL VGIFENQERKHRTYVYVLIVTEVLEDWEDSVNIGRKREWFKIEDAIKVLQYHKPVQASYFETLRQGYS ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9T4L _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 151 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O95989 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 148 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 148 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9T4L GLY A 1 ? UNP O95989 ? ? 'expression tag' -2 1 1 9T4L HIS A 2 ? UNP O95989 ? ? 'expression tag' -1 2 1 9T4L MET A 3 ? UNP O95989 ? ? 'expression tag' 0 3 1 9T4L ASN A 111 ? UNP O95989 GLU 108 'engineered mutation' 108 4 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1780 ? 1 MORE -77 ? 1 'SSA (A^2)' 8540 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H,I # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLU A 61 ? GLY A 75 ? GLU A 58 GLY A 72 1 ? 15 HELX_P HELX_P2 AA2 TRP A 110 ? GLY A 117 ? TRP A 107 GLY A 114 1 ? 8 HELX_P HELX_P3 AA3 ILE A 125 ? GLN A 133 ? ILE A 122 GLN A 130 1 ? 9 HELX_P HELX_P4 AA4 LYS A 136 ? TYR A 142 ? LYS A 133 TYR A 139 1 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A GLY 53 O ? ? ? 1_555 C MG . MG ? ? A GLY 50 A MG 202 1_555 ? ? ? ? ? ? ? 2.450 ? ? metalc2 metalc ? ? A GLU 69 OE2 ? ? ? 1_555 F MG . MG ? ? A GLU 66 A MG 205 1_555 ? ? ? ? ? ? ? 2.623 ? ? metalc3 metalc ? ? A GLU 73 OE1 ? ? ? 1_555 C MG . MG ? ? A GLU 70 A MG 202 1_555 ? ? ? ? ? ? ? 2.304 ? ? metalc4 metalc ? ? A GLU 73 OE1 ? ? ? 1_555 F MG . MG ? ? A GLU 70 A MG 205 1_555 ? ? ? ? ? ? ? 2.783 ? ? metalc5 metalc ? ? B IHP . O22 A ? ? 1_555 C MG . MG ? ? A IHP 201 A MG 202 1_555 ? ? ? ? ? ? ? 2.630 ? ? metalc6 metalc ? ? B IHP . O22 B ? ? 1_555 C MG . MG ? ? A IHP 201 A MG 202 1_555 ? ? ? ? ? ? ? 2.386 ? ? metalc7 metalc ? ? B IHP . O32 B ? ? 1_555 C MG . MG ? ? A IHP 201 A MG 202 1_555 ? ? ? ? ? ? ? 2.873 ? ? metalc8 metalc ? ? B IHP . O23 B ? ? 1_555 C MG . MG ? ? A IHP 201 A MG 202 1_555 ? ? ? ? ? ? ? 2.536 ? ? metalc9 metalc ? ? B IHP . O11 B ? ? 1_555 D MG . MG ? ? A IHP 201 A MG 203 1_555 ? ? ? ? ? ? ? 2.822 ? ? metalc10 metalc ? ? B IHP . O41 A ? ? 1_555 D MG . MG ? ? A IHP 201 A MG 203 1_555 ? ? ? ? ? ? ? 2.582 ? ? metalc11 metalc ? ? B IHP . O32 A ? ? 1_555 D MG . MG ? ? A IHP 201 A MG 203 1_555 ? ? ? ? ? ? ? 1.718 ? ? metalc12 metalc ? ? B IHP . O32 B ? ? 1_555 D MG . MG ? ? A IHP 201 A MG 203 1_555 ? ? ? ? ? ? ? 2.348 ? ? metalc13 metalc ? ? B IHP . O31 B ? ? 1_555 E MG . MG ? ? A IHP 201 A MG 204 1_555 ? ? ? ? ? ? ? 2.802 ? ? metalc14 metalc ? ? B IHP . O36 A ? ? 1_555 E MG . MG ? ? A IHP 201 A MG 204 1_555 ? ? ? ? ? ? ? 2.432 ? ? metalc15 metalc ? ? C MG . MG ? ? ? 1_555 I HOH . O ? ? A MG 202 A HOH 301 1_555 ? ? ? ? ? ? ? 2.072 ? ? metalc16 metalc ? ? C MG . MG ? ? ? 1_555 I HOH . O ? ? A MG 202 A HOH 325 1_555 ? ? ? ? ? ? ? 1.725 ? ? metalc17 metalc ? ? C MG . MG ? ? ? 1_555 I HOH . O ? ? A MG 202 A HOH 472 1_555 ? ? ? ? ? ? ? 2.532 ? ? metalc18 metalc ? ? E MG . MG ? ? ? 1_555 I HOH . O ? ? A MG 204 A HOH 309 1_555 ? ? ? ? ? ? ? 2.365 ? ? metalc19 metalc ? ? E MG . MG ? ? ? 1_555 I HOH . O ? ? A MG 204 A HOH 445 1_555 ? ? ? ? ? ? ? 2.843 ? ? metalc20 metalc ? ? F MG . MG ? ? ? 1_555 I HOH . O ? ? A MG 205 A HOH 334 1_555 ? ? ? ? ? ? ? 2.478 ? ? metalc21 metalc ? ? F MG . MG ? ? ? 1_555 I HOH . O ? ? A MG 205 A HOH 463 1_555 ? ? ? ? ? ? ? 2.714 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? A GLY 53 ? A GLY 50 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 OE1 ? A GLU 73 ? A GLU 70 ? 1_555 78.1 ? 2 O ? A GLY 53 ? A GLY 50 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O22 A B IHP . ? A IHP 201 ? 1_555 91.7 ? 3 OE1 ? A GLU 73 ? A GLU 70 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O22 A B IHP . ? A IHP 201 ? 1_555 168.0 ? 4 O ? A GLY 53 ? A GLY 50 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O22 B B IHP . ? A IHP 201 ? 1_555 83.5 ? 5 OE1 ? A GLU 73 ? A GLU 70 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O22 B B IHP . ? A IHP 201 ? 1_555 155.5 ? 6 O22 A B IHP . ? A IHP 201 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O22 B B IHP . ? A IHP 201 ? 1_555 12.8 ? 7 O ? A GLY 53 ? A GLY 50 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O32 B B IHP . ? A IHP 201 ? 1_555 122.2 ? 8 OE1 ? A GLU 73 ? A GLU 70 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O32 B B IHP . ? A IHP 201 ? 1_555 148.3 ? 9 O22 A B IHP . ? A IHP 201 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O32 B B IHP . ? A IHP 201 ? 1_555 43.4 ? 10 O22 B B IHP . ? A IHP 201 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O32 B B IHP . ? A IHP 201 ? 1_555 56.1 ? 11 O ? A GLY 53 ? A GLY 50 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O23 B B IHP . ? A IHP 201 ? 1_555 161.5 ? 12 OE1 ? A GLU 73 ? A GLU 70 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O23 B B IHP . ? A IHP 201 ? 1_555 90.4 ? 13 O22 A B IHP . ? A IHP 201 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O23 B B IHP . ? A IHP 201 ? 1_555 97.7 ? 14 O22 B B IHP . ? A IHP 201 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O23 B B IHP . ? A IHP 201 ? 1_555 102.7 ? 15 O32 B B IHP . ? A IHP 201 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O23 B B IHP . ? A IHP 201 ? 1_555 74.6 ? 16 O ? A GLY 53 ? A GLY 50 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? I HOH . ? A HOH 301 ? 1_555 160.4 ? 17 OE1 ? A GLU 73 ? A GLU 70 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? I HOH . ? A HOH 301 ? 1_555 92.4 ? 18 O22 A B IHP . ? A IHP 201 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? I HOH . ? A HOH 301 ? 1_555 99.2 ? 19 O22 B B IHP . ? A IHP 201 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? I HOH . ? A HOH 301 ? 1_555 109.7 ? 20 O32 B B IHP . ? A IHP 201 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? I HOH . ? A HOH 301 ? 1_555 60.2 ? 21 O23 B B IHP . ? A IHP 201 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? I HOH . ? A HOH 301 ? 1_555 32.0 ? 22 O ? A GLY 53 ? A GLY 50 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? I HOH . ? A HOH 325 ? 1_555 82.4 ? 23 OE1 ? A GLU 73 ? A GLU 70 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? I HOH . ? A HOH 325 ? 1_555 85.1 ? 24 O22 A B IHP . ? A IHP 201 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? I HOH . ? A HOH 325 ? 1_555 87.4 ? 25 O22 B B IHP . ? A IHP 201 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? I HOH . ? A HOH 325 ? 1_555 76.6 ? 26 O32 B B IHP . ? A IHP 201 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? I HOH . ? A HOH 325 ? 1_555 119.2 ? 27 O23 B B IHP . ? A IHP 201 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? I HOH . ? A HOH 325 ? 1_555 82.1 ? 28 O ? I HOH . ? A HOH 301 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? I HOH . ? A HOH 325 ? 1_555 114.1 ? 29 O ? A GLY 53 ? A GLY 50 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? I HOH . ? A HOH 472 ? 1_555 102.3 ? 30 OE1 ? A GLU 73 ? A GLU 70 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? I HOH . ? A HOH 472 ? 1_555 83.2 ? 31 O22 A B IHP . ? A IHP 201 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? I HOH . ? A HOH 472 ? 1_555 105.3 ? 32 O22 B B IHP . ? A IHP 201 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? I HOH . ? A HOH 472 ? 1_555 116.7 ? 33 O32 B B IHP . ? A IHP 201 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? I HOH . ? A HOH 472 ? 1_555 69.5 ? 34 O23 B B IHP . ? A IHP 201 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? I HOH . ? A HOH 472 ? 1_555 90.6 ? 35 O ? I HOH . ? A HOH 301 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? I HOH . ? A HOH 472 ? 1_555 59.2 ? 36 O ? I HOH . ? A HOH 325 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? I HOH . ? A HOH 472 ? 1_555 166.2 ? 37 OE2 ? A GLU 69 ? A GLU 66 ? 1_555 MG ? F MG . ? A MG 205 ? 1_555 OE1 ? A GLU 73 ? A GLU 70 ? 1_555 81.5 ? 38 OE2 ? A GLU 69 ? A GLU 66 ? 1_555 MG ? F MG . ? A MG 205 ? 1_555 O ? I HOH . ? A HOH 334 ? 1_555 89.1 ? 39 OE1 ? A GLU 73 ? A GLU 70 ? 1_555 MG ? F MG . ? A MG 205 ? 1_555 O ? I HOH . ? A HOH 334 ? 1_555 151.1 ? 40 OE2 ? A GLU 69 ? A GLU 66 ? 1_555 MG ? F MG . ? A MG 205 ? 1_555 O ? I HOH . ? A HOH 463 ? 1_555 114.0 ? 41 OE1 ? A GLU 73 ? A GLU 70 ? 1_555 MG ? F MG . ? A MG 205 ? 1_555 O ? I HOH . ? A HOH 463 ? 1_555 91.7 ? 42 O ? I HOH . ? A HOH 334 ? 1_555 MG ? F MG . ? A MG 205 ? 1_555 O ? I HOH . ? A HOH 463 ? 1_555 117.1 ? 43 O11 B B IHP . ? A IHP 201 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O41 A B IHP . ? A IHP 201 ? 1_555 53.8 ? 44 O11 B B IHP . ? A IHP 201 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O32 A B IHP . ? A IHP 201 ? 1_555 79.5 ? 45 O41 A B IHP . ? A IHP 201 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O32 A B IHP . ? A IHP 201 ? 1_555 127.8 ? 46 O11 B B IHP . ? A IHP 201 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O32 B B IHP . ? A IHP 201 ? 1_555 95.1 ? 47 O41 A B IHP . ? A IHP 201 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O32 B B IHP . ? A IHP 201 ? 1_555 147.2 ? 48 O32 A B IHP . ? A IHP 201 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O32 B B IHP . ? A IHP 201 ? 1_555 20.5 ? 49 O31 B B IHP . ? A IHP 201 ? 1_555 MG ? E MG . ? A MG 204 ? 1_555 O36 A B IHP . ? A IHP 201 ? 1_555 126.6 ? 50 O31 B B IHP . ? A IHP 201 ? 1_555 MG ? E MG . ? A MG 204 ? 1_555 O ? I HOH . ? A HOH 309 ? 1_555 108.0 ? 51 O36 A B IHP . ? A IHP 201 ? 1_555 MG ? E MG . ? A MG 204 ? 1_555 O ? I HOH . ? A HOH 309 ? 1_555 89.2 ? 52 O31 B B IHP . ? A IHP 201 ? 1_555 MG ? E MG . ? A MG 204 ? 1_555 O ? I HOH . ? A HOH 445 ? 1_555 97.3 ? 53 O36 A B IHP . ? A IHP 201 ? 1_555 MG ? E MG . ? A MG 204 ? 1_555 O ? I HOH . ? A HOH 445 ? 1_555 126.9 ? 54 O ? I HOH . ? A HOH 309 ? 1_555 MG ? E MG . ? A MG 204 ? 1_555 O ? I HOH . ? A HOH 445 ? 1_555 105.4 ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLY A 53 ? GLY A 55 ? GLY A 50 GLY A 52 AA1 2 LYS A 21 ? PHE A 29 ? LYS A 18 PHE A 26 AA1 3 HIS A 94 ? VAL A 106 ? HIS A 91 VAL A 103 AA1 4 VAL A 76 ? ASN A 89 ? VAL A 73 ASN A 86 AA2 1 TRP A 49 ? ILE A 50 ? TRP A 46 ILE A 47 AA2 2 GLU A 36 ? SER A 41 ? GLU A 33 SER A 38 AA2 3 ARG A 120 ? LYS A 124 ? ARG A 117 LYS A 121 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O GLY A 54 ? O GLY A 51 N ALA A 24 ? N ALA A 21 AA1 2 3 N PHE A 29 ? N PHE A 26 O LEU A 101 ? O LEU A 98 AA1 3 4 O VAL A 100 ? O VAL A 97 N GLY A 81 ? N GLY A 78 AA2 1 2 O ILE A 50 ? O ILE A 47 N VAL A 40 ? N VAL A 37 AA2 2 3 N VAL A 37 ? N VAL A 34 O PHE A 123 ? O PHE A 120 # _pdbx_entry_details.entry_id 9T4L _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O41 A IHP 201 ? B MG A MG 203 ? ? 1.34 2 1 MG A MG 205 ? ? O A HOH 472 ? ? 1.60 3 1 O A HOH 371 ? ? O A HOH 415 ? ? 1.92 4 1 O A HOH 377 ? ? O A HOH 442 ? ? 2.15 5 1 O A HOH 508 ? ? O A HOH 510 ? ? 2.15 6 1 O A HOH 346 ? ? O A HOH 438 ? ? 2.17 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 20 ? ? CZ A ARG 20 ? ? NH1 A ARG 20 ? ? 114.74 120.30 -5.56 0.50 N 2 1 NE A ARG 20 ? ? CZ A ARG 20 ? ? NH2 A ARG 20 ? ? 124.75 120.30 4.45 0.50 N 3 1 NE A ARG 79 ? ? CZ A ARG 79 ? ? NH1 A ARG 79 ? ? 123.85 120.30 3.55 0.50 N 4 1 NE A ARG 115 ? ? CZ A ARG 115 ? ? NH1 A ARG 115 ? ? 124.21 120.30 3.91 0.50 N # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 10 ? A 0.128 'SIDE CHAIN' 2 1 ARG A 115 ? ? 0.081 'SIDE CHAIN' # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 536 ? 6.21 . 2 1 O ? A HOH 537 ? 6.28 . 3 1 O ? A HOH 538 ? 6.34 . 4 1 O ? A HOH 539 ? 6.37 . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -2 ? A GLY 1 2 1 Y 1 A HIS -1 ? A HIS 2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CL CL CL N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 HIS N N N N 138 HIS CA C N S 139 HIS C C N N 140 HIS O O N N 141 HIS CB C N N 142 HIS CG C Y N 143 HIS ND1 N Y N 144 HIS CD2 C Y N 145 HIS CE1 C Y N 146 HIS NE2 N Y N 147 HIS OXT O N N 148 HIS H H N N 149 HIS H2 H N N 150 HIS HA H N N 151 HIS HB2 H N N 152 HIS HB3 H N N 153 HIS HD1 H N N 154 HIS HD2 H N N 155 HIS HE1 H N N 156 HIS HE2 H N N 157 HIS HXT H N N 158 HOH O O N N 159 HOH H1 H N N 160 HOH H2 H N N 161 IHP C1 C N N 162 IHP C2 C N N 163 IHP C3 C N N 164 IHP C4 C N N 165 IHP C5 C N N 166 IHP C6 C N N 167 IHP O11 O N N 168 IHP P1 P N N 169 IHP O21 O N N 170 IHP O31 O N N 171 IHP O41 O N N 172 IHP O12 O N N 173 IHP P2 P N N 174 IHP O22 O N N 175 IHP O32 O N N 176 IHP O42 O N N 177 IHP O13 O N N 178 IHP P3 P N N 179 IHP O23 O N N 180 IHP O33 O N N 181 IHP O43 O N N 182 IHP O14 O N N 183 IHP P4 P N N 184 IHP O24 O N N 185 IHP O34 O N N 186 IHP O44 O N N 187 IHP O15 O N N 188 IHP P5 P N N 189 IHP O25 O N N 190 IHP O35 O N N 191 IHP O45 O N N 192 IHP O16 O N N 193 IHP P6 P N N 194 IHP O26 O N N 195 IHP O36 O N N 196 IHP O46 O N N 197 IHP H1 H N N 198 IHP H2 H N N 199 IHP H3 H N N 200 IHP H4 H N N 201 IHP H5 H N N 202 IHP H6 H N N 203 IHP H31 H N N 204 IHP H41 H N N 205 IHP H32 H N N 206 IHP H42 H N N 207 IHP H33 H N N 208 IHP H43 H N N 209 IHP H34 H N N 210 IHP H44 H N N 211 IHP H35 H N N 212 IHP H45 H N N 213 IHP H36 H N N 214 IHP H46 H N N 215 ILE N N N N 216 ILE CA C N S 217 ILE C C N N 218 ILE O O N N 219 ILE CB C N S 220 ILE CG1 C N N 221 ILE CG2 C N N 222 ILE CD1 C N N 223 ILE OXT O N N 224 ILE H H N N 225 ILE H2 H N N 226 ILE HA H N N 227 ILE HB H N N 228 ILE HG12 H N N 229 ILE HG13 H N N 230 ILE HG21 H N N 231 ILE HG22 H N N 232 ILE HG23 H N N 233 ILE HD11 H N N 234 ILE HD12 H N N 235 ILE HD13 H N N 236 ILE HXT H N N 237 LEU N N N N 238 LEU CA C N S 239 LEU C C N N 240 LEU O O N N 241 LEU CB C N N 242 LEU CG C N N 243 LEU CD1 C N N 244 LEU CD2 C N N 245 LEU OXT O N N 246 LEU H H N N 247 LEU H2 H N N 248 LEU HA H N N 249 LEU HB2 H N N 250 LEU HB3 H N N 251 LEU HG H N N 252 LEU HD11 H N N 253 LEU HD12 H N N 254 LEU HD13 H N N 255 LEU HD21 H N N 256 LEU HD22 H N N 257 LEU HD23 H N N 258 LEU HXT H N N 259 LYS N N N N 260 LYS CA C N S 261 LYS C C N N 262 LYS O O N N 263 LYS CB C N N 264 LYS CG C N N 265 LYS CD C N N 266 LYS CE C N N 267 LYS NZ N N N 268 LYS OXT O N N 269 LYS H H N N 270 LYS H2 H N N 271 LYS HA H N N 272 LYS HB2 H N N 273 LYS HB3 H N N 274 LYS HG2 H N N 275 LYS HG3 H N N 276 LYS HD2 H N N 277 LYS HD3 H N N 278 LYS HE2 H N N 279 LYS HE3 H N N 280 LYS HZ1 H N N 281 LYS HZ2 H N N 282 LYS HZ3 H N N 283 LYS HXT H N N 284 MET N N N N 285 MET CA C N S 286 MET C C N N 287 MET O O N N 288 MET CB C N N 289 MET CG C N N 290 MET SD S N N 291 MET CE C N N 292 MET OXT O N N 293 MET H H N N 294 MET H2 H N N 295 MET HA H N N 296 MET HB2 H N N 297 MET HB3 H N N 298 MET HG2 H N N 299 MET HG3 H N N 300 MET HE1 H N N 301 MET HE2 H N N 302 MET HE3 H N N 303 MET HXT H N N 304 MG MG MG N N 305 PHE N N N N 306 PHE CA C N S 307 PHE C C N N 308 PHE O O N N 309 PHE CB C N N 310 PHE CG C Y N 311 PHE CD1 C Y N 312 PHE CD2 C Y N 313 PHE CE1 C Y N 314 PHE CE2 C Y N 315 PHE CZ C Y N 316 PHE OXT O N N 317 PHE H H N N 318 PHE H2 H N N 319 PHE HA H N N 320 PHE HB2 H N N 321 PHE HB3 H N N 322 PHE HD1 H N N 323 PHE HD2 H N N 324 PHE HE1 H N N 325 PHE HE2 H N N 326 PHE HZ H N N 327 PHE HXT H N N 328 PRO N N N N 329 PRO CA C N S 330 PRO C C N N 331 PRO O O N N 332 PRO CB C N N 333 PRO CG C N N 334 PRO CD C N N 335 PRO OXT O N N 336 PRO H H N N 337 PRO HA H N N 338 PRO HB2 H N N 339 PRO HB3 H N N 340 PRO HG2 H N N 341 PRO HG3 H N N 342 PRO HD2 H N N 343 PRO HD3 H N N 344 PRO HXT H N N 345 SER N N N N 346 SER CA C N S 347 SER C C N N 348 SER O O N N 349 SER CB C N N 350 SER OG O N N 351 SER OXT O N N 352 SER H H N N 353 SER H2 H N N 354 SER HA H N N 355 SER HB2 H N N 356 SER HB3 H N N 357 SER HG H N N 358 SER HXT H N N 359 THR N N N N 360 THR CA C N S 361 THR C C N N 362 THR O O N N 363 THR CB C N R 364 THR OG1 O N N 365 THR CG2 C N N 366 THR OXT O N N 367 THR H H N N 368 THR H2 H N N 369 THR HA H N N 370 THR HB H N N 371 THR HG1 H N N 372 THR HG21 H N N 373 THR HG22 H N N 374 THR HG23 H N N 375 THR HXT H N N 376 TRP N N N N 377 TRP CA C N S 378 TRP C C N N 379 TRP O O N N 380 TRP CB C N N 381 TRP CG C Y N 382 TRP CD1 C Y N 383 TRP CD2 C Y N 384 TRP NE1 N Y N 385 TRP CE2 C Y N 386 TRP CE3 C Y N 387 TRP CZ2 C Y N 388 TRP CZ3 C Y N 389 TRP CH2 C Y N 390 TRP OXT O N N 391 TRP H H N N 392 TRP H2 H N N 393 TRP HA H N N 394 TRP HB2 H N N 395 TRP HB3 H N N 396 TRP HD1 H N N 397 TRP HE1 H N N 398 TRP HE3 H N N 399 TRP HZ2 H N N 400 TRP HZ3 H N N 401 TRP HH2 H N N 402 TRP HXT H N N 403 TYR N N N N 404 TYR CA C N S 405 TYR C C N N 406 TYR O O N N 407 TYR CB C N N 408 TYR CG C Y N 409 TYR CD1 C Y N 410 TYR CD2 C Y N 411 TYR CE1 C Y N 412 TYR CE2 C Y N 413 TYR CZ C Y N 414 TYR OH O N N 415 TYR OXT O N N 416 TYR H H N N 417 TYR H2 H N N 418 TYR HA H N N 419 TYR HB2 H N N 420 TYR HB3 H N N 421 TYR HD1 H N N 422 TYR HD2 H N N 423 TYR HE1 H N N 424 TYR HE2 H N N 425 TYR HH H N N 426 TYR HXT H N N 427 VAL N N N N 428 VAL CA C N S 429 VAL C C N N 430 VAL O O N N 431 VAL CB C N N 432 VAL CG1 C N N 433 VAL CG2 C N N 434 VAL OXT O N N 435 VAL H H N N 436 VAL H2 H N N 437 VAL HA H N N 438 VAL HB H N N 439 VAL HG11 H N N 440 VAL HG12 H N N 441 VAL HG13 H N N 442 VAL HG21 H N N 443 VAL HG22 H N N 444 VAL HG23 H N N 445 VAL HXT H N N 446 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 IHP C1 C2 sing N N 152 IHP C1 C6 sing N N 153 IHP C1 O11 sing N N 154 IHP C1 H1 sing N N 155 IHP C2 C3 sing N N 156 IHP C2 O12 sing N N 157 IHP C2 H2 sing N N 158 IHP C3 C4 sing N N 159 IHP C3 O13 sing N N 160 IHP C3 H3 sing N N 161 IHP C4 C5 sing N N 162 IHP C4 O14 sing N N 163 IHP C4 H4 sing N N 164 IHP C5 C6 sing N N 165 IHP C5 O15 sing N N 166 IHP C5 H5 sing N N 167 IHP C6 O16 sing N N 168 IHP C6 H6 sing N N 169 IHP O11 P1 sing N N 170 IHP P1 O21 doub N N 171 IHP P1 O31 sing N N 172 IHP P1 O41 sing N N 173 IHP O31 H31 sing N N 174 IHP O41 H41 sing N N 175 IHP O12 P2 sing N N 176 IHP P2 O22 doub N N 177 IHP P2 O32 sing N N 178 IHP P2 O42 sing N N 179 IHP O32 H32 sing N N 180 IHP O42 H42 sing N N 181 IHP O13 P3 sing N N 182 IHP P3 O23 doub N N 183 IHP P3 O33 sing N N 184 IHP P3 O43 sing N N 185 IHP O33 H33 sing N N 186 IHP O43 H43 sing N N 187 IHP O14 P4 sing N N 188 IHP P4 O24 doub N N 189 IHP P4 O34 sing N N 190 IHP P4 O44 sing N N 191 IHP O34 H34 sing N N 192 IHP O44 H44 sing N N 193 IHP O15 P5 sing N N 194 IHP P5 O25 doub N N 195 IHP P5 O35 sing N N 196 IHP P5 O45 sing N N 197 IHP O35 H35 sing N N 198 IHP O45 H45 sing N N 199 IHP O16 P6 sing N N 200 IHP P6 O26 doub N N 201 IHP P6 O36 sing N N 202 IHP P6 O46 sing N N 203 IHP O36 H36 sing N N 204 IHP O46 H46 sing N N 205 ILE N CA sing N N 206 ILE N H sing N N 207 ILE N H2 sing N N 208 ILE CA C sing N N 209 ILE CA CB sing N N 210 ILE CA HA sing N N 211 ILE C O doub N N 212 ILE C OXT sing N N 213 ILE CB CG1 sing N N 214 ILE CB CG2 sing N N 215 ILE CB HB sing N N 216 ILE CG1 CD1 sing N N 217 ILE CG1 HG12 sing N N 218 ILE CG1 HG13 sing N N 219 ILE CG2 HG21 sing N N 220 ILE CG2 HG22 sing N N 221 ILE CG2 HG23 sing N N 222 ILE CD1 HD11 sing N N 223 ILE CD1 HD12 sing N N 224 ILE CD1 HD13 sing N N 225 ILE OXT HXT sing N N 226 LEU N CA sing N N 227 LEU N H sing N N 228 LEU N H2 sing N N 229 LEU CA C sing N N 230 LEU CA CB sing N N 231 LEU CA HA sing N N 232 LEU C O doub N N 233 LEU C OXT sing N N 234 LEU CB CG sing N N 235 LEU CB HB2 sing N N 236 LEU CB HB3 sing N N 237 LEU CG CD1 sing N N 238 LEU CG CD2 sing N N 239 LEU CG HG sing N N 240 LEU CD1 HD11 sing N N 241 LEU CD1 HD12 sing N N 242 LEU CD1 HD13 sing N N 243 LEU CD2 HD21 sing N N 244 LEU CD2 HD22 sing N N 245 LEU CD2 HD23 sing N N 246 LEU OXT HXT sing N N 247 LYS N CA sing N N 248 LYS N H sing N N 249 LYS N H2 sing N N 250 LYS CA C sing N N 251 LYS CA CB sing N N 252 LYS CA HA sing N N 253 LYS C O doub N N 254 LYS C OXT sing N N 255 LYS CB CG sing N N 256 LYS CB HB2 sing N N 257 LYS CB HB3 sing N N 258 LYS CG CD sing N N 259 LYS CG HG2 sing N N 260 LYS CG HG3 sing N N 261 LYS CD CE sing N N 262 LYS CD HD2 sing N N 263 LYS CD HD3 sing N N 264 LYS CE NZ sing N N 265 LYS CE HE2 sing N N 266 LYS CE HE3 sing N N 267 LYS NZ HZ1 sing N N 268 LYS NZ HZ2 sing N N 269 LYS NZ HZ3 sing N N 270 LYS OXT HXT sing N N 271 MET N CA sing N N 272 MET N H sing N N 273 MET N H2 sing N N 274 MET CA C sing N N 275 MET CA CB sing N N 276 MET CA HA sing N N 277 MET C O doub N N 278 MET C OXT sing N N 279 MET CB CG sing N N 280 MET CB HB2 sing N N 281 MET CB HB3 sing N N 282 MET CG SD sing N N 283 MET CG HG2 sing N N 284 MET CG HG3 sing N N 285 MET SD CE sing N N 286 MET CE HE1 sing N N 287 MET CE HE2 sing N N 288 MET CE HE3 sing N N 289 MET OXT HXT sing N N 290 PHE N CA sing N N 291 PHE N H sing N N 292 PHE N H2 sing N N 293 PHE CA C sing N N 294 PHE CA CB sing N N 295 PHE CA HA sing N N 296 PHE C O doub N N 297 PHE C OXT sing N N 298 PHE CB CG sing N N 299 PHE CB HB2 sing N N 300 PHE CB HB3 sing N N 301 PHE CG CD1 doub Y N 302 PHE CG CD2 sing Y N 303 PHE CD1 CE1 sing Y N 304 PHE CD1 HD1 sing N N 305 PHE CD2 CE2 doub Y N 306 PHE CD2 HD2 sing N N 307 PHE CE1 CZ doub Y N 308 PHE CE1 HE1 sing N N 309 PHE CE2 CZ sing Y N 310 PHE CE2 HE2 sing N N 311 PHE CZ HZ sing N N 312 PHE OXT HXT sing N N 313 PRO N CA sing N N 314 PRO N CD sing N N 315 PRO N H sing N N 316 PRO CA C sing N N 317 PRO CA CB sing N N 318 PRO CA HA sing N N 319 PRO C O doub N N 320 PRO C OXT sing N N 321 PRO CB CG sing N N 322 PRO CB HB2 sing N N 323 PRO CB HB3 sing N N 324 PRO CG CD sing N N 325 PRO CG HG2 sing N N 326 PRO CG HG3 sing N N 327 PRO CD HD2 sing N N 328 PRO CD HD3 sing N N 329 PRO OXT HXT sing N N 330 SER N CA sing N N 331 SER N H sing N N 332 SER N H2 sing N N 333 SER CA C sing N N 334 SER CA CB sing N N 335 SER CA HA sing N N 336 SER C O doub N N 337 SER C OXT sing N N 338 SER CB OG sing N N 339 SER CB HB2 sing N N 340 SER CB HB3 sing N N 341 SER OG HG sing N N 342 SER OXT HXT sing N N 343 THR N CA sing N N 344 THR N H sing N N 345 THR N H2 sing N N 346 THR CA C sing N N 347 THR CA CB sing N N 348 THR CA HA sing N N 349 THR C O doub N N 350 THR C OXT sing N N 351 THR CB OG1 sing N N 352 THR CB CG2 sing N N 353 THR CB HB sing N N 354 THR OG1 HG1 sing N N 355 THR CG2 HG21 sing N N 356 THR CG2 HG22 sing N N 357 THR CG2 HG23 sing N N 358 THR OXT HXT sing N N 359 TRP N CA sing N N 360 TRP N H sing N N 361 TRP N H2 sing N N 362 TRP CA C sing N N 363 TRP CA CB sing N N 364 TRP CA HA sing N N 365 TRP C O doub N N 366 TRP C OXT sing N N 367 TRP CB CG sing N N 368 TRP CB HB2 sing N N 369 TRP CB HB3 sing N N 370 TRP CG CD1 doub Y N 371 TRP CG CD2 sing Y N 372 TRP CD1 NE1 sing Y N 373 TRP CD1 HD1 sing N N 374 TRP CD2 CE2 doub Y N 375 TRP CD2 CE3 sing Y N 376 TRP NE1 CE2 sing Y N 377 TRP NE1 HE1 sing N N 378 TRP CE2 CZ2 sing Y N 379 TRP CE3 CZ3 doub Y N 380 TRP CE3 HE3 sing N N 381 TRP CZ2 CH2 doub Y N 382 TRP CZ2 HZ2 sing N N 383 TRP CZ3 CH2 sing Y N 384 TRP CZ3 HZ3 sing N N 385 TRP CH2 HH2 sing N N 386 TRP OXT HXT sing N N 387 TYR N CA sing N N 388 TYR N H sing N N 389 TYR N H2 sing N N 390 TYR CA C sing N N 391 TYR CA CB sing N N 392 TYR CA HA sing N N 393 TYR C O doub N N 394 TYR C OXT sing N N 395 TYR CB CG sing N N 396 TYR CB HB2 sing N N 397 TYR CB HB3 sing N N 398 TYR CG CD1 doub Y N 399 TYR CG CD2 sing Y N 400 TYR CD1 CE1 sing Y N 401 TYR CD1 HD1 sing N N 402 TYR CD2 CE2 doub Y N 403 TYR CD2 HD2 sing N N 404 TYR CE1 CZ doub Y N 405 TYR CE1 HE1 sing N N 406 TYR CE2 CZ sing Y N 407 TYR CE2 HE2 sing N N 408 TYR CZ OH sing N N 409 TYR OH HH sing N N 410 TYR OXT HXT sing N N 411 VAL N CA sing N N 412 VAL N H sing N N 413 VAL N H2 sing N N 414 VAL CA C sing N N 415 VAL CA CB sing N N 416 VAL CA HA sing N N 417 VAL C O doub N N 418 VAL C OXT sing N N 419 VAL CB CG1 sing N N 420 VAL CB CG2 sing N N 421 VAL CB HB sing N N 422 VAL CG1 HG11 sing N N 423 VAL CG1 HG12 sing N N 424 VAL CG1 HG13 sing N N 425 VAL CG2 HG21 sing N N 426 VAL CG2 HG22 sing N N 427 VAL CG2 HG23 sing N N 428 VAL OXT HXT sing N N 429 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Ministerio de Ciencia e Innovacion (MCIN)' Spain PID2020-117400GB-I00 1 'Spanish Ministry of Science, Innovation, and Universities' Spain PID2023-147659NB-I00 2 # _atom_sites.entry_id 9T4L _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.029008 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015291 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012825 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.pdbx_scat_Z _atom_type.pdbx_N_electrons _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c C 6 6 2.3103 20.8439 1.0201 10.2075 1.5888 0.5687 0.8651 51.6512 0.2156 CL 17 17 11.4601 0.0104 7.1962 1.1662 6.2554 18.5194 1.6455 47.7784 -9.3443 H 1 1 0.4930 10.5109 0.3229 26.1257 0.1402 3.1424 0.0408 57.7997 0.0030 MG 12 12 5.4265 2.8275 2.1759 79.2611 1.2283 0.3808 2.3099 7.1937 0.9350 N 7 7 12.2220 0.0057 3.1346 9.8933 2.0141 28.9975 1.1672 0.5826 -11.5379 O 8 8 3.0487 13.2771 2.2870 5.7011 1.5464 0.3239 0.8671 32.9089 0.2508 P 15 15 6.4348 1.9067 4.1793 27.1570 1.7801 0.5260 1.4909 68.1645 1.2679 S 16 16 6.9054 1.4679 5.2035 22.2151 1.4379 0.2536 1.5863 56.1720 1.0495 # loop_ #