data_9UOA # _entry.id 9UOA # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.404 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9UOA pdb_00009uoa 10.2210/pdb9uoa/pdb WWPDB D_1300058900 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2025-05-14 ? 2 'Structure model' 1 1 2025-08-27 ? 3 'Structure model' 1 2 2025-09-17 ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 3 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.pdbx_database_id_PubMed' 8 2 'Structure model' '_citation.title' 9 2 'Structure model' '_citation.year' 10 2 'Structure model' '_citation_author.identifier_ORCID' 11 3 'Structure model' '_citation.journal_volume' 12 3 'Structure model' '_citation.page_first' 13 3 'Structure model' '_citation.page_last' 14 3 'Structure model' '_citation_author.identifier_ORCID' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9UOA _pdbx_database_status.recvd_initial_deposition_date 2025-04-25 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible N # _pdbx_contact_author.id 2 _pdbx_contact_author.email hoshino@chiba-u.jp _pdbx_contact_author.name_first Tyuji _pdbx_contact_author.name_last Hoshino _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-4705-4412 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Wei, S.' 1 ? 'Fujimoto, K.' 2 ? 'Tang, K.' 3 ? 'Zhan, P.' 4 ? 'Menendez-Arias, L.' 5 ? 'Hoshino, T.' 6 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Biochemistry _citation.journal_id_ASTM BICHAW _citation.journal_id_CSD 0033 _citation.journal_id_ISSN 0006-2960 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 64 _citation.language ? _citation.page_first 3695 _citation.page_last 3705 _citation.title 'Structural Analysis of HIV-1 RNase H Bound to a Galloyl Active Site Inhibitor and Computational Compound Modification.' _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.biochem.5c00266 _citation.pdbx_database_id_PubMed 40801556 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wei, S.' 1 ? primary 'Fujimoto, K.' 2 ? primary 'Tang, K.' 3 ? primary 'Zhan, P.' 4 ? primary 'Menendez-Arias, L.' 5 ? primary 'Hoshino, T.' 6 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Reverse transcriptase/RNaseH' 16832.285 1 ? ? ? ? 2 non-polymer syn 'MANGANESE (II) ION' 54.938 2 ? ? ? ? 3 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 4 non-polymer syn '~{N}-[4-[4-[3,4,5-tris(oxidanyl)phenyl]carbonylpiperazin-1-yl]sulfonylphenyl]ethanamide' 435.451 1 ? ? ? ? 5 water nat water 18.015 39 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GPGGSMYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQ YALGIITQWIHNWKKRGWKTPVKNVDLVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRKVLF ; _entity_poly.pdbx_seq_one_letter_code_can ;GPGGSMYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQ YALGIITQWIHNWKKRGWKTPVKNVDLVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRKVLF ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'MANGANESE (II) ION' MN 3 'ZINC ION' ZN 4 '~{N}-[4-[4-[3,4,5-tris(oxidanyl)phenyl]carbonylpiperazin-1-yl]sulfonylphenyl]ethanamide' A1L9C 5 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 GLY n 1 4 GLY n 1 5 SER n 1 6 MET n 1 7 TYR n 1 8 GLN n 1 9 LEU n 1 10 GLU n 1 11 LYS n 1 12 GLU n 1 13 PRO n 1 14 ILE n 1 15 VAL n 1 16 GLY n 1 17 ALA n 1 18 GLU n 1 19 THR n 1 20 PHE n 1 21 TYR n 1 22 VAL n 1 23 ASP n 1 24 GLY n 1 25 ALA n 1 26 ALA n 1 27 ASN n 1 28 ARG n 1 29 GLU n 1 30 THR n 1 31 LYS n 1 32 LEU n 1 33 GLY n 1 34 LYS n 1 35 ALA n 1 36 GLY n 1 37 TYR n 1 38 VAL n 1 39 THR n 1 40 ASN n 1 41 ARG n 1 42 GLY n 1 43 ARG n 1 44 GLN n 1 45 LYS n 1 46 VAL n 1 47 VAL n 1 48 THR n 1 49 LEU n 1 50 THR n 1 51 ASP n 1 52 THR n 1 53 THR n 1 54 ASN n 1 55 GLN n 1 56 LYS n 1 57 THR n 1 58 GLU n 1 59 LEU n 1 60 GLN n 1 61 ALA n 1 62 ILE n 1 63 TYR n 1 64 LEU n 1 65 ALA n 1 66 LEU n 1 67 GLN n 1 68 ASP n 1 69 SER n 1 70 GLY n 1 71 LEU n 1 72 GLU n 1 73 VAL n 1 74 ASN n 1 75 ILE n 1 76 VAL n 1 77 THR n 1 78 ASP n 1 79 SER n 1 80 GLN n 1 81 TYR n 1 82 ALA n 1 83 LEU n 1 84 GLY n 1 85 ILE n 1 86 ILE n 1 87 THR n 1 88 GLN n 1 89 TRP n 1 90 ILE n 1 91 HIS n 1 92 ASN n 1 93 TRP n 1 94 LYS n 1 95 LYS n 1 96 ARG n 1 97 GLY n 1 98 TRP n 1 99 LYS n 1 100 THR n 1 101 PRO n 1 102 VAL n 1 103 LYS n 1 104 ASN n 1 105 VAL n 1 106 ASP n 1 107 LEU n 1 108 VAL n 1 109 ASN n 1 110 GLN n 1 111 ILE n 1 112 ILE n 1 113 GLU n 1 114 GLN n 1 115 LEU n 1 116 ILE n 1 117 LYS n 1 118 LYS n 1 119 GLU n 1 120 LYS n 1 121 VAL n 1 122 TYR n 1 123 LEU n 1 124 ALA n 1 125 TRP n 1 126 VAL n 1 127 PRO n 1 128 ALA n 1 129 HIS n 1 130 LYS n 1 131 GLY n 1 132 ILE n 1 133 GLY n 1 134 GLY n 1 135 ASN n 1 136 GLU n 1 137 GLN n 1 138 VAL n 1 139 ASP n 1 140 LYS n 1 141 LEU n 1 142 VAL n 1 143 SER n 1 144 ALA n 1 145 GLY n 1 146 ILE n 1 147 ARG n 1 148 LYS n 1 149 VAL n 1 150 LEU n 1 151 PHE n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 86 ? ? pol ? ? ? ? ? ? 'Human immunodeficiency virus 1' 11676 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? plasmid ? ? ? 'pET50(b)' ? ? 1 2 sample 'Biological sequence' 87 151 HIV-1 ? pol ? ? ? ? ? ? 'Human immunodeficiency virus 1' 11676 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? plasmid ? ? ? 'pET50(b)' ? ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight A1L9C non-polymer . '~{N}-[4-[4-[3,4,5-tris(oxidanyl)phenyl]carbonylpiperazin-1-yl]sulfonylphenyl]ethanamide' ? 'C19 H21 N3 O7 S' 435.451 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MN non-polymer . 'MANGANESE (II) ION' ? 'Mn 2' 54.938 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 ? ? ? A . n A 1 2 PRO 2 2 ? ? ? A . n A 1 3 GLY 3 3 ? ? ? A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 MET 6 6 6 MET MET A . n A 1 7 TYR 7 7 7 TYR TYR A . n A 1 8 GLN 8 8 8 GLN GLN A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 PHE 20 20 20 PHE PHE A . n A 1 21 TYR 21 21 21 TYR TYR A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 ASN 27 27 27 ASN ASN A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 TYR 37 37 37 TYR TYR A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 THR 39 39 39 THR THR A . n A 1 40 ASN 40 40 40 ASN ASN A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 GLN 44 44 44 GLN GLN A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 THR 48 48 48 THR THR A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 ASP 51 51 51 ASP ASP A . n A 1 52 THR 52 52 52 THR THR A . n A 1 53 THR 53 53 53 THR THR A . n A 1 54 ASN 54 54 54 ASN ASN A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 THR 57 57 57 THR THR A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 GLN 60 60 60 GLN GLN A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 TYR 63 63 63 TYR TYR A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 GLN 67 67 67 GLN GLN A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 ASN 74 74 74 ASN ASN A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 THR 77 77 77 THR THR A . n A 1 78 ASP 78 78 78 ASP ASP A . n A 1 79 SER 79 79 79 SER SER A . n A 1 80 GLN 80 80 80 GLN GLN A . n A 1 81 TYR 81 81 81 TYR TYR A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 ILE 85 85 85 ILE ILE A . n A 1 86 ILE 86 86 86 ILE ILE A . n A 1 87 THR 87 87 87 THR THR A . n A 1 88 GLN 88 88 88 GLN GLN A . n A 1 89 TRP 89 89 89 TRP TRP A . n A 1 90 ILE 90 90 90 ILE ILE A . n A 1 91 HIS 91 91 91 HIS HIS A . n A 1 92 ASN 92 92 92 ASN ASN A . n A 1 93 TRP 93 93 93 TRP TRP A . n A 1 94 LYS 94 94 94 LYS LYS A . n A 1 95 LYS 95 95 95 LYS LYS A . n A 1 96 ARG 96 96 96 ARG ARG A . n A 1 97 GLY 97 97 97 GLY GLY A . n A 1 98 TRP 98 98 98 TRP TRP A . n A 1 99 LYS 99 99 99 LYS LYS A . n A 1 100 THR 100 100 100 THR THR A . n A 1 101 PRO 101 101 101 PRO PRO A . n A 1 102 VAL 102 102 102 VAL VAL A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 ASN 104 104 104 ASN ASN A . n A 1 105 VAL 105 105 105 VAL VAL A . n A 1 106 ASP 106 106 106 ASP ASP A . n A 1 107 LEU 107 107 107 LEU LEU A . n A 1 108 VAL 108 108 108 VAL VAL A . n A 1 109 ASN 109 109 109 ASN ASN A . n A 1 110 GLN 110 110 110 GLN GLN A . n A 1 111 ILE 111 111 111 ILE ILE A . n A 1 112 ILE 112 112 112 ILE ILE A . n A 1 113 GLU 113 113 113 GLU GLU A . n A 1 114 GLN 114 114 114 GLN GLN A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 ILE 116 116 116 ILE ILE A . n A 1 117 LYS 117 117 117 LYS LYS A . n A 1 118 LYS 118 118 118 LYS LYS A . n A 1 119 GLU 119 119 119 GLU GLU A . n A 1 120 LYS 120 120 120 LYS LYS A . n A 1 121 VAL 121 121 121 VAL VAL A . n A 1 122 TYR 122 122 122 TYR TYR A . n A 1 123 LEU 123 123 123 LEU LEU A . n A 1 124 ALA 124 124 124 ALA ALA A . n A 1 125 TRP 125 125 125 TRP TRP A . n A 1 126 VAL 126 126 126 VAL VAL A . n A 1 127 PRO 127 127 127 PRO PRO A . n A 1 128 ALA 128 128 128 ALA ALA A . n A 1 129 HIS 129 129 129 HIS HIS A . n A 1 130 LYS 130 130 130 LYS LYS A . n A 1 131 GLY 131 131 131 GLY GLY A . n A 1 132 ILE 132 132 132 ILE ILE A . n A 1 133 GLY 133 133 133 GLY GLY A . n A 1 134 GLY 134 134 134 GLY GLY A . n A 1 135 ASN 135 135 135 ASN ASN A . n A 1 136 GLU 136 136 136 GLU GLU A . n A 1 137 GLN 137 137 137 GLN GLN A . n A 1 138 VAL 138 138 138 VAL VAL A . n A 1 139 ASP 139 139 139 ASP ASP A . n A 1 140 LYS 140 140 140 LYS LYS A . n A 1 141 LEU 141 141 141 LEU LEU A . n A 1 142 VAL 142 142 142 VAL VAL A . n A 1 143 SER 143 143 143 SER SER A . n A 1 144 ALA 144 144 144 ALA ALA A . n A 1 145 GLY 145 145 145 GLY GLY A . n A 1 146 ILE 146 146 146 ILE ILE A . n A 1 147 ARG 147 147 147 ARG ARG A . n A 1 148 LYS 148 148 148 LYS LYS A . n A 1 149 VAL 149 149 149 VAL VAL A . n A 1 150 LEU 150 150 ? ? ? A . n A 1 151 PHE 151 151 ? ? ? A . n # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 A1L9C ? ? A1L9C ? ? 'SUBJECT OF INVESTIGATION' ? 2 MN ? ? MN ? ? 'SUBJECT OF INVESTIGATION' ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MN 1 201 150 MN MN A . C 2 MN 1 202 151 MN MN A . D 3 ZN 1 203 152 ZN ZN A . E 4 A1L9C 1 204 201 A1L9C LIG A . F 5 HOH 1 301 11 HOH HOH A . F 5 HOH 2 302 32 HOH HOH A . F 5 HOH 3 303 39 HOH HOH A . F 5 HOH 4 304 21 HOH HOH A . F 5 HOH 5 305 34 HOH HOH A . F 5 HOH 6 306 4 HOH HOH A . F 5 HOH 7 307 29 HOH HOH A . F 5 HOH 8 308 20 HOH HOH A . F 5 HOH 9 309 33 HOH HOH A . F 5 HOH 10 310 18 HOH HOH A . F 5 HOH 11 311 16 HOH HOH A . F 5 HOH 12 312 1 HOH HOH A . F 5 HOH 13 313 26 HOH HOH A . F 5 HOH 14 314 12 HOH HOH A . F 5 HOH 15 315 8 HOH HOH A . F 5 HOH 16 316 15 HOH HOH A . F 5 HOH 17 317 3 HOH HOH A . F 5 HOH 18 318 7 HOH HOH A . F 5 HOH 19 319 13 HOH HOH A . F 5 HOH 20 320 6 HOH HOH A . F 5 HOH 21 321 28 HOH HOH A . F 5 HOH 22 322 23 HOH HOH A . F 5 HOH 23 323 36 HOH HOH A . F 5 HOH 24 324 5 HOH HOH A . F 5 HOH 25 325 27 HOH HOH A . F 5 HOH 26 326 9 HOH HOH A . F 5 HOH 27 327 25 HOH HOH A . F 5 HOH 28 328 2 HOH HOH A . F 5 HOH 29 329 14 HOH HOH A . F 5 HOH 30 330 19 HOH HOH A . F 5 HOH 31 331 30 HOH HOH A . F 5 HOH 32 332 24 HOH HOH A . F 5 HOH 33 333 38 HOH HOH A . F 5 HOH 34 334 22 HOH HOH A . F 5 HOH 35 335 35 HOH HOH A . F 5 HOH 36 336 10 HOH HOH A . F 5 HOH 37 337 17 HOH HOH A . F 5 HOH 38 338 31 HOH HOH A . F 5 HOH 39 339 37 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.20.1_4487: ???)' ? 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . ? 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? . ? 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . ? 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . ? 5 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 9UOA _cell.details ? _cell.formula_units_Z ? _cell.length_a 61.255 _cell.length_a_esd ? _cell.length_b 61.255 _cell.length_b_esd ? _cell.length_c 83.122 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9UOA _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9UOA _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.32 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 46.89 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.6 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1M MES, 26%(v/v) PEG 6000, 0.01M Zinc Sulfate, 0.001M MANGANESE CHLORIDE' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 291 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 4M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2024-03-23 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Si(111)' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.98 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PHOTON FACTORY BEAMLINE BL-17A' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.98 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL-17A _diffrn_source.pdbx_synchrotron_site 'Photon Factory' # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 9UOA _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.96 _reflns.d_resolution_low 43.31 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 11986 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.0 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 24.1 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 24.0 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.22 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.084 _reflns.pdbx_Rpim_I_all 0.017 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 288857 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.082 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.96 _reflns_shell.d_res_low 2.01 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all 20530 _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 813 _reflns_shell.percent_possible_obs 100.0 _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 25.3 _reflns_shell.pdbx_chi_squared 0.83 _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs 2.8 _reflns_shell.pdbx_Rrim_I_all 1.349 _reflns_shell.pdbx_Rpim_I_all 0.264 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.880 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.322 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9UOA _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.96 _refine.ls_d_res_low 43.31 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 11512 _refine.ls_number_reflns_R_free 1151 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 96.42 _refine.ls_percent_reflns_R_free 10.00 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2537 _refine.ls_R_factor_R_free 0.2816 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2505 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.33 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.10 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 32.98 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.31 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.96 _refine_hist.d_res_low 43.31 _refine_hist.number_atoms_solvent 39 _refine_hist.number_atoms_total 1226 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1154 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 33 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.007 ? ? ? f_bond_d ? ? ? 'X-RAY DIFFRACTION' ? 1.078 ? ? ? f_angle_d ? ? ? 'X-RAY DIFFRACTION' ? 5.394 ? 169 ? f_dihedral_angle_d ? ? ? 'X-RAY DIFFRACTION' ? 0.041 ? 184 ? f_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.007 ? 204 ? f_plane_restr ? ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.96 2.05 . . 141 1276 98.00 . . . . 0.3241 . . . . . . . . . . . . . . . 0.3985 'X-RAY DIFFRACTION' 2.05 2.15 . . 122 1101 84.00 . . . . 0.3654 . . . . . . . . . . . . . . . 0.4207 'X-RAY DIFFRACTION' 2.16 2.29 . . 133 1193 90.00 . . . . 0.3513 . . . . . . . . . . . . . . . 0.3505 'X-RAY DIFFRACTION' 2.29 2.47 . . 147 1319 100.00 . . . . 0.2712 . . . . . . . . . . . . . . . 0.3235 'X-RAY DIFFRACTION' 2.47 2.72 . . 145 1311 99.00 . . . . 0.2688 . . . . . . . . . . . . . . . 0.3179 'X-RAY DIFFRACTION' 2.72 3.11 . . 150 1344 100.00 . . . . 0.2728 . . . . . . . . . . . . . . . 0.2936 'X-RAY DIFFRACTION' 3.11 3.91 . . 151 1360 100.00 . . . . 0.2398 . . . . . . . . . . . . . . . 0.2773 'X-RAY DIFFRACTION' 3.92 43.31 . . 162 1457 100.00 . . . . 0.2161 . . . . . . . . . . . . . . . 0.2359 # _struct.entry_id 9UOA _struct.title 'Crystal structure of HIV-1 Reverse Transcriptase RNase H domain complexed with a galloyl inhibitor' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9UOA _struct_keywords.text 'Inhibitor, Complex, RNase, VIRAL PROTEIN' _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 4 ? F N N 5 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP Q72547_HV1 Q72547 ? 1 ;YQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGII ; 427 2 UNP Q72547_HV1 Q72547 ? 1 LVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRKVLF 517 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 9UOA A 7 ? 86 ? Q72547 427 ? 506 ? 7 86 2 2 9UOA A 107 ? 151 ? Q72547 517 ? 561 ? 107 151 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9UOA GLY A 1 ? UNP Q72547 ? ? 'expression tag' 1 1 1 9UOA PRO A 2 ? UNP Q72547 ? ? 'expression tag' 2 2 1 9UOA GLY A 3 ? UNP Q72547 ? ? 'expression tag' 3 3 1 9UOA GLY A 4 ? UNP Q72547 ? ? 'expression tag' 4 4 1 9UOA SER A 5 ? UNP Q72547 ? ? 'expression tag' 5 5 1 9UOA MET A 6 ? UNP Q72547 ? ? 'expression tag' 6 6 1 9UOA THR A 87 ? UNP Q72547 ? ? linker 87 7 1 9UOA GLN A 88 ? UNP Q72547 ? ? linker 88 8 1 9UOA TRP A 89 ? UNP Q72547 ? ? linker 89 9 1 9UOA ILE A 90 ? UNP Q72547 ? ? linker 90 10 1 9UOA HIS A 91 ? UNP Q72547 ? ? linker 91 11 1 9UOA ASN A 92 ? UNP Q72547 ? ? linker 92 12 1 9UOA TRP A 93 ? UNP Q72547 ? ? linker 93 13 1 9UOA LYS A 94 ? UNP Q72547 ? ? linker 94 14 1 9UOA LYS A 95 ? UNP Q72547 ? ? linker 95 15 1 9UOA ARG A 96 ? UNP Q72547 ? ? linker 96 16 1 9UOA GLY A 97 ? UNP Q72547 ? ? linker 97 17 1 9UOA TRP A 98 ? UNP Q72547 ? ? linker 98 18 1 9UOA LYS A 99 ? UNP Q72547 ? ? linker 99 19 1 9UOA THR A 100 ? UNP Q72547 ? ? linker 100 20 1 9UOA PRO A 101 ? UNP Q72547 ? ? linker 101 21 1 9UOA VAL A 102 ? UNP Q72547 ? ? linker 102 22 1 9UOA LYS A 103 ? UNP Q72547 ? ? linker 103 23 1 9UOA ASN A 104 ? UNP Q72547 ? ? linker 104 24 1 9UOA VAL A 105 ? UNP Q72547 ? ? linker 105 25 1 9UOA ASP A 106 ? UNP Q72547 ? ? linker 106 26 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 80 ? 1 MORE -24 ? 1 'SSA (A^2)' 8340 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 53 ? ASP A 68 ? THR A 53 ASP A 68 1 ? 16 HELX_P HELX_P2 AA2 SER A 79 ? ASN A 92 ? SER A 79 ASN A 92 1 ? 14 HELX_P HELX_P3 AA3 ASN A 104 ? ILE A 116 ? ASN A 104 ILE A 116 1 ? 13 HELX_P HELX_P4 AA4 GLY A 133 ? ALA A 144 ? GLY A 133 ALA A 144 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 23 OD1 ? ? ? 1_555 B MN . MN ? ? A ASP 23 A MN 201 1_555 ? ? ? ? ? ? ? 1.991 ? ? metalc2 metalc ? ? A ASP 23 OD2 ? ? ? 1_555 C MN . MN ? ? A ASP 23 A MN 202 1_555 ? ? ? ? ? ? ? 2.491 ? ? metalc3 metalc ? ? A ASP 51 OD1 ? ? ? 1_555 D ZN . ZN ? ? A ASP 51 A ZN 203 1_555 ? ? ? ? ? ? ? 2.051 ? ? metalc4 metalc ? ? A ASP 51 OD2 ? ? ? 1_555 D ZN . ZN ? ? A ASP 51 A ZN 203 1_555 ? ? ? ? ? ? ? 2.616 ? ? metalc5 metalc ? ? A GLU 58 OE2 ? ? ? 1_555 B MN . MN ? ? A GLU 58 A MN 201 1_555 ? ? ? ? ? ? ? 2.313 ? ? metalc6 metalc ? ? A ASP 78 OD1 ? ? ? 1_555 B MN . MN ? ? A ASP 78 A MN 201 1_555 ? ? ? ? ? ? ? 1.940 ? ? metalc7 metalc ? ? A ASP 78 OD2 ? ? ? 1_555 B MN . MN ? ? A ASP 78 A MN 201 1_555 ? ? ? ? ? ? ? 2.694 ? ? metalc8 metalc ? ? A HIS 129 NE2 ? ? ? 1_555 D ZN . ZN ? ? A HIS 129 A ZN 203 5_555 ? ? ? ? ? ? ? 2.288 ? ? metalc9 metalc ? ? A GLU 136 OE1 ? ? ? 1_555 D ZN . ZN ? ? A GLU 136 A ZN 203 5_555 ? ? ? ? ? ? ? 2.057 ? ? metalc10 metalc ? ? A ASP 139 OD1 ? ? ? 1_555 C MN . MN ? ? A ASP 139 A MN 202 1_555 ? ? ? ? ? ? ? 1.933 ? ? metalc11 metalc ? ? B MN . MN ? ? ? 1_555 E A1L9C . O ? ? A MN 201 A A1L9C 204 1_555 ? ? ? ? ? ? ? 2.036 ? ? metalc12 metalc ? ? B MN . MN ? ? ? 1_555 E A1L9C . O1 ? ? A MN 201 A A1L9C 204 1_555 ? ? ? ? ? ? ? 2.353 ? ? metalc13 metalc ? ? B MN . MN ? ? ? 1_555 F HOH . O ? ? A MN 201 A HOH 314 1_555 ? ? ? ? ? ? ? 2.743 ? ? metalc14 metalc ? ? C MN . MN ? ? ? 1_555 E A1L9C . O2 ? ? A MN 202 A A1L9C 204 1_555 ? ? ? ? ? ? ? 2.269 ? ? metalc15 metalc ? ? C MN . MN ? ? ? 1_555 E A1L9C . O1 ? ? A MN 202 A A1L9C 204 1_555 ? ? ? ? ? ? ? 1.902 ? ? metalc16 metalc ? ? D ZN . ZN ? ? ? 1_555 F HOH . O ? ? A ZN 203 A HOH 336 1_555 ? ? ? ? ? ? ? 2.169 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD1 ? A ASP 23 ? A ASP 23 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 OE2 ? A GLU 58 ? A GLU 58 ? 1_555 108.4 ? 2 OD1 ? A ASP 23 ? A ASP 23 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 OD1 ? A ASP 78 ? A ASP 78 ? 1_555 158.5 ? 3 OE2 ? A GLU 58 ? A GLU 58 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 OD1 ? A ASP 78 ? A ASP 78 ? 1_555 84.7 ? 4 OD1 ? A ASP 23 ? A ASP 23 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 OD2 ? A ASP 78 ? A ASP 78 ? 1_555 112.3 ? 5 OE2 ? A GLU 58 ? A GLU 58 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 OD2 ? A ASP 78 ? A ASP 78 ? 1_555 137.9 ? 6 OD1 ? A ASP 78 ? A ASP 78 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 OD2 ? A ASP 78 ? A ASP 78 ? 1_555 53.2 ? 7 OD1 ? A ASP 23 ? A ASP 23 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 O ? E A1L9C . ? A A1L9C 204 ? 1_555 83.9 ? 8 OE2 ? A GLU 58 ? A GLU 58 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 O ? E A1L9C . ? A A1L9C 204 ? 1_555 62.5 ? 9 OD1 ? A ASP 78 ? A ASP 78 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 O ? E A1L9C . ? A A1L9C 204 ? 1_555 117.6 ? 10 OD2 ? A ASP 78 ? A ASP 78 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 O ? E A1L9C . ? A A1L9C 204 ? 1_555 131.5 ? 11 OD1 ? A ASP 23 ? A ASP 23 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 O1 ? E A1L9C . ? A A1L9C 204 ? 1_555 74.1 ? 12 OE2 ? A GLU 58 ? A GLU 58 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 O1 ? E A1L9C . ? A A1L9C 204 ? 1_555 136.7 ? 13 OD1 ? A ASP 78 ? A ASP 78 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 O1 ? E A1L9C . ? A A1L9C 204 ? 1_555 108.4 ? 14 OD2 ? A ASP 78 ? A ASP 78 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 O1 ? E A1L9C . ? A A1L9C 204 ? 1_555 67.0 ? 15 O ? E A1L9C . ? A A1L9C 204 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 O1 ? E A1L9C . ? A A1L9C 204 ? 1_555 75.2 ? 16 OD1 ? A ASP 23 ? A ASP 23 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 O ? F HOH . ? A HOH 314 ? 1_555 97.0 ? 17 OE2 ? A GLU 58 ? A GLU 58 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 O ? F HOH . ? A HOH 314 ? 1_555 85.5 ? 18 OD1 ? A ASP 78 ? A ASP 78 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 O ? F HOH . ? A HOH 314 ? 1_555 66.4 ? 19 OD2 ? A ASP 78 ? A ASP 78 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 O ? F HOH . ? A HOH 314 ? 1_555 79.6 ? 20 O ? E A1L9C . ? A A1L9C 204 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 O ? F HOH . ? A HOH 314 ? 1_555 146.1 ? 21 O1 ? E A1L9C . ? A A1L9C 204 ? 1_555 MN ? B MN . ? A MN 201 ? 1_555 O ? F HOH . ? A HOH 314 ? 1_555 137.8 ? 22 OD2 ? A ASP 23 ? A ASP 23 ? 1_555 MN ? C MN . ? A MN 202 ? 1_555 OD1 ? A ASP 139 ? A ASP 139 ? 1_555 118.8 ? 23 OD2 ? A ASP 23 ? A ASP 23 ? 1_555 MN ? C MN . ? A MN 202 ? 1_555 O2 ? E A1L9C . ? A A1L9C 204 ? 1_555 130.7 ? 24 OD1 ? A ASP 139 ? A ASP 139 ? 1_555 MN ? C MN . ? A MN 202 ? 1_555 O2 ? E A1L9C . ? A A1L9C 204 ? 1_555 107.6 ? 25 OD2 ? A ASP 23 ? A ASP 23 ? 1_555 MN ? C MN . ? A MN 202 ? 1_555 O1 ? E A1L9C . ? A A1L9C 204 ? 1_555 60.3 ? 26 OD1 ? A ASP 139 ? A ASP 139 ? 1_555 MN ? C MN . ? A MN 202 ? 1_555 O1 ? E A1L9C . ? A A1L9C 204 ? 1_555 130.5 ? 27 O2 ? E A1L9C . ? A A1L9C 204 ? 1_555 MN ? C MN . ? A MN 202 ? 1_555 O1 ? E A1L9C . ? A A1L9C 204 ? 1_555 77.7 ? 28 OD1 ? A ASP 51 ? A ASP 51 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 1_555 OD2 ? A ASP 51 ? A ASP 51 ? 1_555 54.5 ? 29 OD1 ? A ASP 51 ? A ASP 51 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 1_555 NE2 ? A HIS 129 ? A HIS 129 ? 1_555 54.3 ? 30 OD2 ? A ASP 51 ? A ASP 51 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 1_555 NE2 ? A HIS 129 ? A HIS 129 ? 1_555 53.6 ? 31 OD1 ? A ASP 51 ? A ASP 51 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 1_555 OE1 ? A GLU 136 ? A GLU 136 ? 1_555 60.2 ? 32 OD2 ? A ASP 51 ? A ASP 51 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 1_555 OE1 ? A GLU 136 ? A GLU 136 ? 1_555 56.0 ? 33 NE2 ? A HIS 129 ? A HIS 129 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 1_555 OE1 ? A GLU 136 ? A GLU 136 ? 1_555 5.9 ? 34 OD1 ? A ASP 51 ? A ASP 51 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 1_555 O ? F HOH . ? A HOH 336 ? 1_555 92.6 ? 35 OD2 ? A ASP 51 ? A ASP 51 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 1_555 O ? F HOH . ? A HOH 336 ? 1_555 129.8 ? 36 NE2 ? A HIS 129 ? A HIS 129 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 1_555 O ? F HOH . ? A HOH 336 ? 1_555 76.7 ? 37 OE1 ? A GLU 136 ? A GLU 136 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 1_555 O ? F HOH . ? A HOH 336 ? 1_555 75.4 ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel AA1 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLN A 44 ? LEU A 49 ? GLN A 44 LEU A 49 AA1 2 GLY A 33 ? THR A 39 ? GLY A 33 THR A 39 AA1 3 THR A 19 ? ALA A 26 ? THR A 19 ALA A 26 AA1 4 GLU A 72 ? THR A 77 ? GLU A 72 THR A 77 AA1 5 LYS A 120 ? TRP A 125 ? LYS A 120 TRP A 125 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O LEU A 49 ? O LEU A 49 N GLY A 33 ? N GLY A 33 AA1 2 3 O VAL A 38 ? O VAL A 38 N TYR A 21 ? N TYR A 21 AA1 3 4 N PHE A 20 ? N PHE A 20 O ASN A 74 ? O ASN A 74 AA1 4 5 N ILE A 75 ? N ILE A 75 O TYR A 122 ? O TYR A 122 # _pdbx_entry_details.entry_id 9UOA _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TYR A 7 ? ? 171.19 137.80 2 1 LYS A 94 ? ? 50.03 16.12 3 1 ARG A 96 ? ? -65.13 -73.76 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 1 ? A GLY 1 2 1 Y 1 A PRO 2 ? A PRO 2 3 1 Y 1 A GLY 3 ? A GLY 3 4 1 Y 1 A LEU 150 ? A LEU 150 5 1 Y 1 A PHE 151 ? A PHE 151 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal A1L9C N1 N N N 1 A1L9C C4 C Y N 2 A1L9C C5 C Y N 3 A1L9C C6 C N N 4 A1L9C C7 C N N 5 A1L9C C8 C N N 6 A1L9C C10 C N N 7 A1L9C C13 C Y N 8 A1L9C C15 C Y N 9 A1L9C C17 C N N 10 A1L9C N N N N 11 A1L9C C C Y N 12 A1L9C O O N N 13 A1L9C C1 C Y N 14 A1L9C C11 C Y N 15 A1L9C C12 C Y N 16 A1L9C C14 C Y N 17 A1L9C C16 C Y N 18 A1L9C C18 C N N 19 A1L9C C2 C Y N 20 A1L9C C3 C Y N 21 A1L9C C9 C N N 22 A1L9C N2 N N N 23 A1L9C O1 O N N 24 A1L9C O2 O N N 25 A1L9C O3 O N N 26 A1L9C O4 O N N 27 A1L9C O5 O N N 28 A1L9C O6 O N N 29 A1L9C S S N N 30 A1L9C H1 H N N 31 A1L9C H2 H N N 32 A1L9C H3 H N N 33 A1L9C H4 H N N 34 A1L9C H5 H N N 35 A1L9C H6 H N N 36 A1L9C H7 H N N 37 A1L9C H8 H N N 38 A1L9C H9 H N N 39 A1L9C H10 H N N 40 A1L9C H11 H N N 41 A1L9C H12 H N N 42 A1L9C H13 H N N 43 A1L9C H14 H N N 44 A1L9C H15 H N N 45 A1L9C H16 H N N 46 A1L9C H17 H N N 47 A1L9C H18 H N N 48 A1L9C H19 H N N 49 A1L9C H20 H N N 50 A1L9C H21 H N N 51 ALA N N N N 52 ALA CA C N S 53 ALA C C N N 54 ALA O O N N 55 ALA CB C N N 56 ALA OXT O N N 57 ALA H H N N 58 ALA H2 H N N 59 ALA HA H N N 60 ALA HB1 H N N 61 ALA HB2 H N N 62 ALA HB3 H N N 63 ALA HXT H N N 64 ARG N N N N 65 ARG CA C N S 66 ARG C C N N 67 ARG O O N N 68 ARG CB C N N 69 ARG CG C N N 70 ARG CD C N N 71 ARG NE N N N 72 ARG CZ C N N 73 ARG NH1 N N N 74 ARG NH2 N N N 75 ARG OXT O N N 76 ARG H H N N 77 ARG H2 H N N 78 ARG HA H N N 79 ARG HB2 H N N 80 ARG HB3 H N N 81 ARG HG2 H N N 82 ARG HG3 H N N 83 ARG HD2 H N N 84 ARG HD3 H N N 85 ARG HE H N N 86 ARG HH11 H N N 87 ARG HH12 H N N 88 ARG HH21 H N N 89 ARG HH22 H N N 90 ARG HXT H N N 91 ASN N N N N 92 ASN CA C N S 93 ASN C C N N 94 ASN O O N N 95 ASN CB C N N 96 ASN CG C N N 97 ASN OD1 O N N 98 ASN ND2 N N N 99 ASN OXT O N N 100 ASN H H N N 101 ASN H2 H N N 102 ASN HA H N N 103 ASN HB2 H N N 104 ASN HB3 H N N 105 ASN HD21 H N N 106 ASN HD22 H N N 107 ASN HXT H N N 108 ASP N N N N 109 ASP CA C N S 110 ASP C C N N 111 ASP O O N N 112 ASP CB C N N 113 ASP CG C N N 114 ASP OD1 O N N 115 ASP OD2 O N N 116 ASP OXT O N N 117 ASP H H N N 118 ASP H2 H N N 119 ASP HA H N N 120 ASP HB2 H N N 121 ASP HB3 H N N 122 ASP HD2 H N N 123 ASP HXT H N N 124 GLN N N N N 125 GLN CA C N S 126 GLN C C N N 127 GLN O O N N 128 GLN CB C N N 129 GLN CG C N N 130 GLN CD C N N 131 GLN OE1 O N N 132 GLN NE2 N N N 133 GLN OXT O N N 134 GLN H H N N 135 GLN H2 H N N 136 GLN HA H N N 137 GLN HB2 H N N 138 GLN HB3 H N N 139 GLN HG2 H N N 140 GLN HG3 H N N 141 GLN HE21 H N N 142 GLN HE22 H N N 143 GLN HXT H N N 144 GLU N N N N 145 GLU CA C N S 146 GLU C C N N 147 GLU O O N N 148 GLU CB C N N 149 GLU CG C N N 150 GLU CD C N N 151 GLU OE1 O N N 152 GLU OE2 O N N 153 GLU OXT O N N 154 GLU H H N N 155 GLU H2 H N N 156 GLU HA H N N 157 GLU HB2 H N N 158 GLU HB3 H N N 159 GLU HG2 H N N 160 GLU HG3 H N N 161 GLU HE2 H N N 162 GLU HXT H N N 163 GLY N N N N 164 GLY CA C N N 165 GLY C C N N 166 GLY O O N N 167 GLY OXT O N N 168 GLY H H N N 169 GLY H2 H N N 170 GLY HA2 H N N 171 GLY HA3 H N N 172 GLY HXT H N N 173 HIS N N N N 174 HIS CA C N S 175 HIS C C N N 176 HIS O O N N 177 HIS CB C N N 178 HIS CG C Y N 179 HIS ND1 N Y N 180 HIS CD2 C Y N 181 HIS CE1 C Y N 182 HIS NE2 N Y N 183 HIS OXT O N N 184 HIS H H N N 185 HIS H2 H N N 186 HIS HA H N N 187 HIS HB2 H N N 188 HIS HB3 H N N 189 HIS HD1 H N N 190 HIS HD2 H N N 191 HIS HE1 H N N 192 HIS HE2 H N N 193 HIS HXT H N N 194 HOH O O N N 195 HOH H1 H N N 196 HOH H2 H N N 197 ILE N N N N 198 ILE CA C N S 199 ILE C C N N 200 ILE O O N N 201 ILE CB C N S 202 ILE CG1 C N N 203 ILE CG2 C N N 204 ILE CD1 C N N 205 ILE OXT O N N 206 ILE H H N N 207 ILE H2 H N N 208 ILE HA H N N 209 ILE HB H N N 210 ILE HG12 H N N 211 ILE HG13 H N N 212 ILE HG21 H N N 213 ILE HG22 H N N 214 ILE HG23 H N N 215 ILE HD11 H N N 216 ILE HD12 H N N 217 ILE HD13 H N N 218 ILE HXT H N N 219 LEU N N N N 220 LEU CA C N S 221 LEU C C N N 222 LEU O O N N 223 LEU CB C N N 224 LEU CG C N N 225 LEU CD1 C N N 226 LEU CD2 C N N 227 LEU OXT O N N 228 LEU H H N N 229 LEU H2 H N N 230 LEU HA H N N 231 LEU HB2 H N N 232 LEU HB3 H N N 233 LEU HG H N N 234 LEU HD11 H N N 235 LEU HD12 H N N 236 LEU HD13 H N N 237 LEU HD21 H N N 238 LEU HD22 H N N 239 LEU HD23 H N N 240 LEU HXT H N N 241 LYS N N N N 242 LYS CA C N S 243 LYS C C N N 244 LYS O O N N 245 LYS CB C N N 246 LYS CG C N N 247 LYS CD C N N 248 LYS CE C N N 249 LYS NZ N N N 250 LYS OXT O N N 251 LYS H H N N 252 LYS H2 H N N 253 LYS HA H N N 254 LYS HB2 H N N 255 LYS HB3 H N N 256 LYS HG2 H N N 257 LYS HG3 H N N 258 LYS HD2 H N N 259 LYS HD3 H N N 260 LYS HE2 H N N 261 LYS HE3 H N N 262 LYS HZ1 H N N 263 LYS HZ2 H N N 264 LYS HZ3 H N N 265 LYS HXT H N N 266 MET N N N N 267 MET CA C N S 268 MET C C N N 269 MET O O N N 270 MET CB C N N 271 MET CG C N N 272 MET SD S N N 273 MET CE C N N 274 MET OXT O N N 275 MET H H N N 276 MET H2 H N N 277 MET HA H N N 278 MET HB2 H N N 279 MET HB3 H N N 280 MET HG2 H N N 281 MET HG3 H N N 282 MET HE1 H N N 283 MET HE2 H N N 284 MET HE3 H N N 285 MET HXT H N N 286 MN MN MN N N 287 PHE N N N N 288 PHE CA C N S 289 PHE C C N N 290 PHE O O N N 291 PHE CB C N N 292 PHE CG C Y N 293 PHE CD1 C Y N 294 PHE CD2 C Y N 295 PHE CE1 C Y N 296 PHE CE2 C Y N 297 PHE CZ C Y N 298 PHE OXT O N N 299 PHE H H N N 300 PHE H2 H N N 301 PHE HA H N N 302 PHE HB2 H N N 303 PHE HB3 H N N 304 PHE HD1 H N N 305 PHE HD2 H N N 306 PHE HE1 H N N 307 PHE HE2 H N N 308 PHE HZ H N N 309 PHE HXT H N N 310 PRO N N N N 311 PRO CA C N S 312 PRO C C N N 313 PRO O O N N 314 PRO CB C N N 315 PRO CG C N N 316 PRO CD C N N 317 PRO OXT O N N 318 PRO H H N N 319 PRO HA H N N 320 PRO HB2 H N N 321 PRO HB3 H N N 322 PRO HG2 H N N 323 PRO HG3 H N N 324 PRO HD2 H N N 325 PRO HD3 H N N 326 PRO HXT H N N 327 SER N N N N 328 SER CA C N S 329 SER C C N N 330 SER O O N N 331 SER CB C N N 332 SER OG O N N 333 SER OXT O N N 334 SER H H N N 335 SER H2 H N N 336 SER HA H N N 337 SER HB2 H N N 338 SER HB3 H N N 339 SER HG H N N 340 SER HXT H N N 341 THR N N N N 342 THR CA C N S 343 THR C C N N 344 THR O O N N 345 THR CB C N R 346 THR OG1 O N N 347 THR CG2 C N N 348 THR OXT O N N 349 THR H H N N 350 THR H2 H N N 351 THR HA H N N 352 THR HB H N N 353 THR HG1 H N N 354 THR HG21 H N N 355 THR HG22 H N N 356 THR HG23 H N N 357 THR HXT H N N 358 TRP N N N N 359 TRP CA C N S 360 TRP C C N N 361 TRP O O N N 362 TRP CB C N N 363 TRP CG C Y N 364 TRP CD1 C Y N 365 TRP CD2 C Y N 366 TRP NE1 N Y N 367 TRP CE2 C Y N 368 TRP CE3 C Y N 369 TRP CZ2 C Y N 370 TRP CZ3 C Y N 371 TRP CH2 C Y N 372 TRP OXT O N N 373 TRP H H N N 374 TRP H2 H N N 375 TRP HA H N N 376 TRP HB2 H N N 377 TRP HB3 H N N 378 TRP HD1 H N N 379 TRP HE1 H N N 380 TRP HE3 H N N 381 TRP HZ2 H N N 382 TRP HZ3 H N N 383 TRP HH2 H N N 384 TRP HXT H N N 385 TYR N N N N 386 TYR CA C N S 387 TYR C C N N 388 TYR O O N N 389 TYR CB C N N 390 TYR CG C Y N 391 TYR CD1 C Y N 392 TYR CD2 C Y N 393 TYR CE1 C Y N 394 TYR CE2 C Y N 395 TYR CZ C Y N 396 TYR OH O N N 397 TYR OXT O N N 398 TYR H H N N 399 TYR H2 H N N 400 TYR HA H N N 401 TYR HB2 H N N 402 TYR HB3 H N N 403 TYR HD1 H N N 404 TYR HD2 H N N 405 TYR HE1 H N N 406 TYR HE2 H N N 407 TYR HH H N N 408 TYR HXT H N N 409 VAL N N N N 410 VAL CA C N S 411 VAL C C N N 412 VAL O O N N 413 VAL CB C N N 414 VAL CG1 C N N 415 VAL CG2 C N N 416 VAL OXT O N N 417 VAL H H N N 418 VAL H2 H N N 419 VAL HA H N N 420 VAL HB H N N 421 VAL HG11 H N N 422 VAL HG12 H N N 423 VAL HG13 H N N 424 VAL HG21 H N N 425 VAL HG22 H N N 426 VAL HG23 H N N 427 VAL HXT H N N 428 ZN ZN ZN N N 429 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal A1L9C O6 C17 doub N N 1 A1L9C C17 C18 sing N N 2 A1L9C C17 N2 sing N N 3 A1L9C N2 C16 sing N N 4 A1L9C C16 C15 doub Y N 5 A1L9C C16 C14 sing Y N 6 A1L9C C15 C13 sing Y N 7 A1L9C C7 C9 sing N N 8 A1L9C C7 N sing N N 9 A1L9C C14 C12 doub Y N 10 A1L9C O3 C6 doub N N 11 A1L9C C9 N1 sing N N 12 A1L9C C13 C11 doub Y N 13 A1L9C N C6 sing N N 14 A1L9C N C8 sing N N 15 A1L9C C12 C11 sing Y N 16 A1L9C C6 C5 sing N N 17 A1L9C C11 S sing N N 18 A1L9C N1 S sing N N 19 A1L9C N1 C10 sing N N 20 A1L9C C8 C10 sing N N 21 A1L9C C5 C4 doub Y N 22 A1L9C C5 C sing Y N 23 A1L9C C4 C3 sing Y N 24 A1L9C S O5 doub N N 25 A1L9C S O4 doub N N 26 A1L9C C C1 doub Y N 27 A1L9C C3 O2 sing N N 28 A1L9C C3 C2 doub Y N 29 A1L9C C1 C2 sing Y N 30 A1L9C C1 O sing N N 31 A1L9C C2 O1 sing N N 32 A1L9C C4 H1 sing N N 33 A1L9C C7 H2 sing N N 34 A1L9C C7 H3 sing N N 35 A1L9C C8 H4 sing N N 36 A1L9C C8 H5 sing N N 37 A1L9C C10 H6 sing N N 38 A1L9C C10 H7 sing N N 39 A1L9C C13 H8 sing N N 40 A1L9C C15 H9 sing N N 41 A1L9C C H10 sing N N 42 A1L9C O H11 sing N N 43 A1L9C C12 H12 sing N N 44 A1L9C C14 H13 sing N N 45 A1L9C C18 H14 sing N N 46 A1L9C C18 H15 sing N N 47 A1L9C C18 H16 sing N N 48 A1L9C C9 H17 sing N N 49 A1L9C C9 H18 sing N N 50 A1L9C N2 H19 sing N N 51 A1L9C O1 H20 sing N N 52 A1L9C O2 H21 sing N N 53 ALA N CA sing N N 54 ALA N H sing N N 55 ALA N H2 sing N N 56 ALA CA C sing N N 57 ALA CA CB sing N N 58 ALA CA HA sing N N 59 ALA C O doub N N 60 ALA C OXT sing N N 61 ALA CB HB1 sing N N 62 ALA CB HB2 sing N N 63 ALA CB HB3 sing N N 64 ALA OXT HXT sing N N 65 ARG N CA sing N N 66 ARG N H sing N N 67 ARG N H2 sing N N 68 ARG CA C sing N N 69 ARG CA CB sing N N 70 ARG CA HA sing N N 71 ARG C O doub N N 72 ARG C OXT sing N N 73 ARG CB CG sing N N 74 ARG CB HB2 sing N N 75 ARG CB HB3 sing N N 76 ARG CG CD sing N N 77 ARG CG HG2 sing N N 78 ARG CG HG3 sing N N 79 ARG CD NE sing N N 80 ARG CD HD2 sing N N 81 ARG CD HD3 sing N N 82 ARG NE CZ sing N N 83 ARG NE HE sing N N 84 ARG CZ NH1 sing N N 85 ARG CZ NH2 doub N N 86 ARG NH1 HH11 sing N N 87 ARG NH1 HH12 sing N N 88 ARG NH2 HH21 sing N N 89 ARG NH2 HH22 sing N N 90 ARG OXT HXT sing N N 91 ASN N CA sing N N 92 ASN N H sing N N 93 ASN N H2 sing N N 94 ASN CA C sing N N 95 ASN CA CB sing N N 96 ASN CA HA sing N N 97 ASN C O doub N N 98 ASN C OXT sing N N 99 ASN CB CG sing N N 100 ASN CB HB2 sing N N 101 ASN CB HB3 sing N N 102 ASN CG OD1 doub N N 103 ASN CG ND2 sing N N 104 ASN ND2 HD21 sing N N 105 ASN ND2 HD22 sing N N 106 ASN OXT HXT sing N N 107 ASP N CA sing N N 108 ASP N H sing N N 109 ASP N H2 sing N N 110 ASP CA C sing N N 111 ASP CA CB sing N N 112 ASP CA HA sing N N 113 ASP C O doub N N 114 ASP C OXT sing N N 115 ASP CB CG sing N N 116 ASP CB HB2 sing N N 117 ASP CB HB3 sing N N 118 ASP CG OD1 doub N N 119 ASP CG OD2 sing N N 120 ASP OD2 HD2 sing N N 121 ASP OXT HXT sing N N 122 GLN N CA sing N N 123 GLN N H sing N N 124 GLN N H2 sing N N 125 GLN CA C sing N N 126 GLN CA CB sing N N 127 GLN CA HA sing N N 128 GLN C O doub N N 129 GLN C OXT sing N N 130 GLN CB CG sing N N 131 GLN CB HB2 sing N N 132 GLN CB HB3 sing N N 133 GLN CG CD sing N N 134 GLN CG HG2 sing N N 135 GLN CG HG3 sing N N 136 GLN CD OE1 doub N N 137 GLN CD NE2 sing N N 138 GLN NE2 HE21 sing N N 139 GLN NE2 HE22 sing N N 140 GLN OXT HXT sing N N 141 GLU N CA sing N N 142 GLU N H sing N N 143 GLU N H2 sing N N 144 GLU CA C sing N N 145 GLU CA CB sing N N 146 GLU CA HA sing N N 147 GLU C O doub N N 148 GLU C OXT sing N N 149 GLU CB CG sing N N 150 GLU CB HB2 sing N N 151 GLU CB HB3 sing N N 152 GLU CG CD sing N N 153 GLU CG HG2 sing N N 154 GLU CG HG3 sing N N 155 GLU CD OE1 doub N N 156 GLU CD OE2 sing N N 157 GLU OE2 HE2 sing N N 158 GLU OXT HXT sing N N 159 GLY N CA sing N N 160 GLY N H sing N N 161 GLY N H2 sing N N 162 GLY CA C sing N N 163 GLY CA HA2 sing N N 164 GLY CA HA3 sing N N 165 GLY C O doub N N 166 GLY C OXT sing N N 167 GLY OXT HXT sing N N 168 HIS N CA sing N N 169 HIS N H sing N N 170 HIS N H2 sing N N 171 HIS CA C sing N N 172 HIS CA CB sing N N 173 HIS CA HA sing N N 174 HIS C O doub N N 175 HIS C OXT sing N N 176 HIS CB CG sing N N 177 HIS CB HB2 sing N N 178 HIS CB HB3 sing N N 179 HIS CG ND1 sing Y N 180 HIS CG CD2 doub Y N 181 HIS ND1 CE1 doub Y N 182 HIS ND1 HD1 sing N N 183 HIS CD2 NE2 sing Y N 184 HIS CD2 HD2 sing N N 185 HIS CE1 NE2 sing Y N 186 HIS CE1 HE1 sing N N 187 HIS NE2 HE2 sing N N 188 HIS OXT HXT sing N N 189 HOH O H1 sing N N 190 HOH O H2 sing N N 191 ILE N CA sing N N 192 ILE N H sing N N 193 ILE N H2 sing N N 194 ILE CA C sing N N 195 ILE CA CB sing N N 196 ILE CA HA sing N N 197 ILE C O doub N N 198 ILE C OXT sing N N 199 ILE CB CG1 sing N N 200 ILE CB CG2 sing N N 201 ILE CB HB sing N N 202 ILE CG1 CD1 sing N N 203 ILE CG1 HG12 sing N N 204 ILE CG1 HG13 sing N N 205 ILE CG2 HG21 sing N N 206 ILE CG2 HG22 sing N N 207 ILE CG2 HG23 sing N N 208 ILE CD1 HD11 sing N N 209 ILE CD1 HD12 sing N N 210 ILE CD1 HD13 sing N N 211 ILE OXT HXT sing N N 212 LEU N CA sing N N 213 LEU N H sing N N 214 LEU N H2 sing N N 215 LEU CA C sing N N 216 LEU CA CB sing N N 217 LEU CA HA sing N N 218 LEU C O doub N N 219 LEU C OXT sing N N 220 LEU CB CG sing N N 221 LEU CB HB2 sing N N 222 LEU CB HB3 sing N N 223 LEU CG CD1 sing N N 224 LEU CG CD2 sing N N 225 LEU CG HG sing N N 226 LEU CD1 HD11 sing N N 227 LEU CD1 HD12 sing N N 228 LEU CD1 HD13 sing N N 229 LEU CD2 HD21 sing N N 230 LEU CD2 HD22 sing N N 231 LEU CD2 HD23 sing N N 232 LEU OXT HXT sing N N 233 LYS N CA sing N N 234 LYS N H sing N N 235 LYS N H2 sing N N 236 LYS CA C sing N N 237 LYS CA CB sing N N 238 LYS CA HA sing N N 239 LYS C O doub N N 240 LYS C OXT sing N N 241 LYS CB CG sing N N 242 LYS CB HB2 sing N N 243 LYS CB HB3 sing N N 244 LYS CG CD sing N N 245 LYS CG HG2 sing N N 246 LYS CG HG3 sing N N 247 LYS CD CE sing N N 248 LYS CD HD2 sing N N 249 LYS CD HD3 sing N N 250 LYS CE NZ sing N N 251 LYS CE HE2 sing N N 252 LYS CE HE3 sing N N 253 LYS NZ HZ1 sing N N 254 LYS NZ HZ2 sing N N 255 LYS NZ HZ3 sing N N 256 LYS OXT HXT sing N N 257 MET N CA sing N N 258 MET N H sing N N 259 MET N H2 sing N N 260 MET CA C sing N N 261 MET CA CB sing N N 262 MET CA HA sing N N 263 MET C O doub N N 264 MET C OXT sing N N 265 MET CB CG sing N N 266 MET CB HB2 sing N N 267 MET CB HB3 sing N N 268 MET CG SD sing N N 269 MET CG HG2 sing N N 270 MET CG HG3 sing N N 271 MET SD CE sing N N 272 MET CE HE1 sing N N 273 MET CE HE2 sing N N 274 MET CE HE3 sing N N 275 MET OXT HXT sing N N 276 PHE N CA sing N N 277 PHE N H sing N N 278 PHE N H2 sing N N 279 PHE CA C sing N N 280 PHE CA CB sing N N 281 PHE CA HA sing N N 282 PHE C O doub N N 283 PHE C OXT sing N N 284 PHE CB CG sing N N 285 PHE CB HB2 sing N N 286 PHE CB HB3 sing N N 287 PHE CG CD1 doub Y N 288 PHE CG CD2 sing Y N 289 PHE CD1 CE1 sing Y N 290 PHE CD1 HD1 sing N N 291 PHE CD2 CE2 doub Y N 292 PHE CD2 HD2 sing N N 293 PHE CE1 CZ doub Y N 294 PHE CE1 HE1 sing N N 295 PHE CE2 CZ sing Y N 296 PHE CE2 HE2 sing N N 297 PHE CZ HZ sing N N 298 PHE OXT HXT sing N N 299 PRO N CA sing N N 300 PRO N CD sing N N 301 PRO N H sing N N 302 PRO CA C sing N N 303 PRO CA CB sing N N 304 PRO CA HA sing N N 305 PRO C O doub N N 306 PRO C OXT sing N N 307 PRO CB CG sing N N 308 PRO CB HB2 sing N N 309 PRO CB HB3 sing N N 310 PRO CG CD sing N N 311 PRO CG HG2 sing N N 312 PRO CG HG3 sing N N 313 PRO CD HD2 sing N N 314 PRO CD HD3 sing N N 315 PRO OXT HXT sing N N 316 SER N CA sing N N 317 SER N H sing N N 318 SER N H2 sing N N 319 SER CA C sing N N 320 SER CA CB sing N N 321 SER CA HA sing N N 322 SER C O doub N N 323 SER C OXT sing N N 324 SER CB OG sing N N 325 SER CB HB2 sing N N 326 SER CB HB3 sing N N 327 SER OG HG sing N N 328 SER OXT HXT sing N N 329 THR N CA sing N N 330 THR N H sing N N 331 THR N H2 sing N N 332 THR CA C sing N N 333 THR CA CB sing N N 334 THR CA HA sing N N 335 THR C O doub N N 336 THR C OXT sing N N 337 THR CB OG1 sing N N 338 THR CB CG2 sing N N 339 THR CB HB sing N N 340 THR OG1 HG1 sing N N 341 THR CG2 HG21 sing N N 342 THR CG2 HG22 sing N N 343 THR CG2 HG23 sing N N 344 THR OXT HXT sing N N 345 TRP N CA sing N N 346 TRP N H sing N N 347 TRP N H2 sing N N 348 TRP CA C sing N N 349 TRP CA CB sing N N 350 TRP CA HA sing N N 351 TRP C O doub N N 352 TRP C OXT sing N N 353 TRP CB CG sing N N 354 TRP CB HB2 sing N N 355 TRP CB HB3 sing N N 356 TRP CG CD1 doub Y N 357 TRP CG CD2 sing Y N 358 TRP CD1 NE1 sing Y N 359 TRP CD1 HD1 sing N N 360 TRP CD2 CE2 doub Y N 361 TRP CD2 CE3 sing Y N 362 TRP NE1 CE2 sing Y N 363 TRP NE1 HE1 sing N N 364 TRP CE2 CZ2 sing Y N 365 TRP CE3 CZ3 doub Y N 366 TRP CE3 HE3 sing N N 367 TRP CZ2 CH2 doub Y N 368 TRP CZ2 HZ2 sing N N 369 TRP CZ3 CH2 sing Y N 370 TRP CZ3 HZ3 sing N N 371 TRP CH2 HH2 sing N N 372 TRP OXT HXT sing N N 373 TYR N CA sing N N 374 TYR N H sing N N 375 TYR N H2 sing N N 376 TYR CA C sing N N 377 TYR CA CB sing N N 378 TYR CA HA sing N N 379 TYR C O doub N N 380 TYR C OXT sing N N 381 TYR CB CG sing N N 382 TYR CB HB2 sing N N 383 TYR CB HB3 sing N N 384 TYR CG CD1 doub Y N 385 TYR CG CD2 sing Y N 386 TYR CD1 CE1 sing Y N 387 TYR CD1 HD1 sing N N 388 TYR CD2 CE2 doub Y N 389 TYR CD2 HD2 sing N N 390 TYR CE1 CZ doub Y N 391 TYR CE1 HE1 sing N N 392 TYR CE2 CZ sing Y N 393 TYR CE2 HE2 sing N N 394 TYR CZ OH sing N N 395 TYR OH HH sing N N 396 TYR OXT HXT sing N N 397 VAL N CA sing N N 398 VAL N H sing N N 399 VAL N H2 sing N N 400 VAL CA C sing N N 401 VAL CA CB sing N N 402 VAL CA HA sing N N 403 VAL C O doub N N 404 VAL C OXT sing N N 405 VAL CB CG1 sing N N 406 VAL CB CG2 sing N N 407 VAL CB HB sing N N 408 VAL CG1 HG11 sing N N 409 VAL CG1 HG12 sing N N 410 VAL CG1 HG13 sing N N 411 VAL CG2 HG21 sing N N 412 VAL CG2 HG22 sing N N 413 VAL CG2 HG23 sing N N 414 VAL OXT HXT sing N N 415 # _pdbx_audit_support.funding_organization 'Japan Society for the Promotion of Science (JSPS)' _pdbx_audit_support.country Japan _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 8JYH _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 9UOA _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.016325 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016325 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012031 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C MN N O S ZN # loop_ #