data_9UWU # _entry.id 9UWU # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.410 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9UWU pdb_00009uwu 10.2210/pdb9uwu/pdb WWPDB D_1300059414 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-02-18 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9UWU _pdbx_database_status.recvd_initial_deposition_date 2025-05-12 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB 'PDB entries for the same citation' 8JAE unspecified PDB 'PDB entries for the same citation' 9UWK unspecified PDB 'PDB entries for the same citation' 9UWN unspecified PDB 'PDB entries for the same citation' 9UWO unspecified PDB 'PDB entries for the same citation' 9UWP unspecified PDB 'PDB entries for the same citation' 9UWS unspecified PDB 'PDB entries for the same citation' 9UWT unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email tueno@bio.titech.ac.jp _pdbx_contact_author.name_first Takafumi _pdbx_contact_author.name_last Ueno _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-9219-0726 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Kojima, M.' 1 0000-0002-9853-323X 'Ueno, T.' 2 0000-0001-9219-0726 'Abe, S.' 3 0000-0002-9403-4089 'Hirata, K.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country DE _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Small Struct' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2688-4062 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title ;Cell-Free Protein Crystallization Enables Rapid Structure Determination of Disaccharides and Trisaccharides Using Galectin-10 Crystals. ; _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1002/sstr.202500501 _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kojima, M.' 1 ? primary 'Yao, X.' 2 ? primary 'Abe, S.' 3 ? primary 'Furuta, T.' 4 ? primary 'Hirata, K.' 5 ? primary 'Kobayashi, R.' 6 ? primary 'Suzuki, T.' 7 ? primary 'Ueno, T.' 8 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Galectin-10 16471.832 1 ? ? ? ? 2 branched syn 'alpha-D-glucopyranose-(1-2)-[alpha-D-glucopyranose-(1-3)]beta-D-fructofuranose' 504.438 1 ? ? ? ? 3 non-polymer syn 1,2-ETHANEDIOL 62.068 1 ? ? ? ? 4 water nat water 18.015 82 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Gal-10,Charcot-Leyden crystal protein,CLC,Eosinophil lysophospholipase,Lysolecithin acylhydrolase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSLLPVPYTEAASLSTGSTVTIKGRPLACFLNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYGAWKQQVESKN MPFQDGQEFELSISVLPDKYQVMVNGQSSYTFDHRIKPEAVKMVQVWRDISLTKFNVSYLKR ; _entity_poly.pdbx_seq_one_letter_code_can ;MSLLPVPYTEAASLSTGSTVTIKGRPLACFLNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYGAWKQQVESKN MPFQDGQEFELSISVLPDKYQVMVNGQSSYTFDHRIKPEAVKMVQVWRDISLTKFNVSYLKR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 1,2-ETHANEDIOL EDO 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 LEU n 1 4 LEU n 1 5 PRO n 1 6 VAL n 1 7 PRO n 1 8 TYR n 1 9 THR n 1 10 GLU n 1 11 ALA n 1 12 ALA n 1 13 SER n 1 14 LEU n 1 15 SER n 1 16 THR n 1 17 GLY n 1 18 SER n 1 19 THR n 1 20 VAL n 1 21 THR n 1 22 ILE n 1 23 LYS n 1 24 GLY n 1 25 ARG n 1 26 PRO n 1 27 LEU n 1 28 ALA n 1 29 CYS n 1 30 PHE n 1 31 LEU n 1 32 ASN n 1 33 GLU n 1 34 PRO n 1 35 TYR n 1 36 LEU n 1 37 GLN n 1 38 VAL n 1 39 ASP n 1 40 PHE n 1 41 HIS n 1 42 THR n 1 43 GLU n 1 44 MET n 1 45 LYS n 1 46 GLU n 1 47 GLU n 1 48 SER n 1 49 ASP n 1 50 ILE n 1 51 VAL n 1 52 PHE n 1 53 HIS n 1 54 PHE n 1 55 GLN n 1 56 VAL n 1 57 CYS n 1 58 PHE n 1 59 GLY n 1 60 ARG n 1 61 ARG n 1 62 VAL n 1 63 VAL n 1 64 MET n 1 65 ASN n 1 66 SER n 1 67 ARG n 1 68 GLU n 1 69 TYR n 1 70 GLY n 1 71 ALA n 1 72 TRP n 1 73 LYS n 1 74 GLN n 1 75 GLN n 1 76 VAL n 1 77 GLU n 1 78 SER n 1 79 LYS n 1 80 ASN n 1 81 MET n 1 82 PRO n 1 83 PHE n 1 84 GLN n 1 85 ASP n 1 86 GLY n 1 87 GLN n 1 88 GLU n 1 89 PHE n 1 90 GLU n 1 91 LEU n 1 92 SER n 1 93 ILE n 1 94 SER n 1 95 VAL n 1 96 LEU n 1 97 PRO n 1 98 ASP n 1 99 LYS n 1 100 TYR n 1 101 GLN n 1 102 VAL n 1 103 MET n 1 104 VAL n 1 105 ASN n 1 106 GLY n 1 107 GLN n 1 108 SER n 1 109 SER n 1 110 TYR n 1 111 THR n 1 112 PHE n 1 113 ASP n 1 114 HIS n 1 115 ARG n 1 116 ILE n 1 117 LYS n 1 118 PRO n 1 119 GLU n 1 120 ALA n 1 121 VAL n 1 122 LYS n 1 123 MET n 1 124 VAL n 1 125 GLN n 1 126 VAL n 1 127 TRP n 1 128 ARG n 1 129 ASP n 1 130 ILE n 1 131 SER n 1 132 LEU n 1 133 THR n 1 134 LYS n 1 135 PHE n 1 136 ASN n 1 137 VAL n 1 138 SER n 1 139 TYR n 1 140 LEU n 1 141 LYS n 1 142 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 142 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'CLC, LGALS10, LGALS10A' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Triticum aestivum' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 4565 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_branch.entity_id 2 _pdbx_entity_branch.type oligosaccharide # loop_ _pdbx_entity_branch_descriptor.ordinal _pdbx_entity_branch_descriptor.entity_id _pdbx_entity_branch_descriptor.descriptor _pdbx_entity_branch_descriptor.type _pdbx_entity_branch_descriptor.program _pdbx_entity_branch_descriptor.program_version 1 2 'DGlcpa1-2[DGlcpa1-3]DFrufb' 'Glycam Condensed Sequence' GMML 1.0 2 2 'WURCS=2.0/2,3,2/[a2122h-1a_1-5][ha122h-2b_2-5]/1-2-1/a1-b2_b3-c1' WURCS PDB2Glycan 1.1.0 3 2 '[][b-D-Fruf]{[(2+1)][a-D-Glcp]{}[(3+1)][a-D-Glcp]{}}' LINUCS PDB-CARE ? # loop_ _pdbx_entity_branch_link.link_id _pdbx_entity_branch_link.entity_id _pdbx_entity_branch_link.entity_branch_list_num_1 _pdbx_entity_branch_link.comp_id_1 _pdbx_entity_branch_link.atom_id_1 _pdbx_entity_branch_link.leaving_atom_id_1 _pdbx_entity_branch_link.entity_branch_list_num_2 _pdbx_entity_branch_link.comp_id_2 _pdbx_entity_branch_link.atom_id_2 _pdbx_entity_branch_link.leaving_atom_id_2 _pdbx_entity_branch_link.value_order _pdbx_entity_branch_link.details 1 2 1 FRU C2 O2 2 GLC O1 HO1 sing ? 2 2 3 GLC C1 O1 1 FRU O3 HO3 sing ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 FRU 'D-saccharide, beta linking' . beta-D-fructofuranose 'beta-D-fructose; D-fructose; fructose' 'C6 H12 O6' 180.156 GLC 'D-saccharide, alpha linking' . alpha-D-glucopyranose 'alpha-D-glucose; D-glucose; glucose' 'C6 H12 O6' 180.156 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier FRU 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DFrufb FRU 'COMMON NAME' GMML 1.0 b-D-fructofuranose FRU 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-Fruf FRU 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 Fru GLC 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGlcpa GLC 'COMMON NAME' GMML 1.0 a-D-glucopyranose GLC 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 a-D-Glcp GLC 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 Glc # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 LEU 3 3 3 LEU LEU A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 PRO 5 5 5 PRO PRO A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 PRO 7 7 7 PRO PRO A . n A 1 8 TYR 8 8 8 TYR TYR A . n A 1 9 THR 9 9 9 THR THR A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 PRO 26 26 26 PRO PRO A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 CYS 29 29 29 CYS CYS A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 ASN 32 32 32 ASN ASN A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 PRO 34 34 34 PRO PRO A . n A 1 35 TYR 35 35 35 TYR TYR A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 GLN 37 37 37 GLN GLN A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 PHE 40 40 40 PHE PHE A . n A 1 41 HIS 41 41 41 HIS HIS A . n A 1 42 THR 42 42 42 THR THR A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 MET 44 44 44 MET MET A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 SER 48 48 48 SER SER A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 PHE 52 52 52 PHE PHE A . n A 1 53 HIS 53 53 53 HIS HIS A . n A 1 54 PHE 54 54 54 PHE PHE A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 CYS 57 57 57 CYS CYS A . n A 1 58 PHE 58 58 58 PHE PHE A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 ARG 60 60 60 ARG ALA A . n A 1 61 ARG 61 61 61 ARG ARG A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 MET 64 64 64 MET MET A . n A 1 65 ASN 65 65 65 ASN ASN A . n A 1 66 SER 66 66 66 SER SER A . n A 1 67 ARG 67 67 67 ARG ARG A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 TYR 69 69 69 TYR TYR A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 TRP 72 72 72 TRP TRP A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 GLN 74 74 74 GLN GLN A . n A 1 75 GLN 75 75 75 GLN GLN A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 SER 78 78 78 SER SER A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 ASN 80 80 80 ASN ASN A . n A 1 81 MET 81 81 81 MET MET A . n A 1 82 PRO 82 82 82 PRO PRO A . n A 1 83 PHE 83 83 83 PHE PHE A . n A 1 84 GLN 84 84 84 GLN GLN A . n A 1 85 ASP 85 85 85 ASP ASP A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 GLN 87 87 87 GLN GLN A . n A 1 88 GLU 88 88 88 GLU GLU A . n A 1 89 PHE 89 89 89 PHE PHE A . n A 1 90 GLU 90 90 90 GLU GLU A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 SER 92 92 92 SER SER A . n A 1 93 ILE 93 93 93 ILE ILE A . n A 1 94 SER 94 94 94 SER SER A . n A 1 95 VAL 95 95 95 VAL VAL A . n A 1 96 LEU 96 96 96 LEU LEU A . n A 1 97 PRO 97 97 97 PRO PRO A . n A 1 98 ASP 98 98 98 ASP ASP A . n A 1 99 LYS 99 99 99 LYS LYS A . n A 1 100 TYR 100 100 100 TYR TYR A . n A 1 101 GLN 101 101 101 GLN GLN A . n A 1 102 VAL 102 102 102 VAL VAL A . n A 1 103 MET 103 103 103 MET MET A . n A 1 104 VAL 104 104 104 VAL VAL A . n A 1 105 ASN 105 105 105 ASN ASN A . n A 1 106 GLY 106 106 106 GLY GLY A . n A 1 107 GLN 107 107 107 GLN GLN A . n A 1 108 SER 108 108 108 SER SER A . n A 1 109 SER 109 109 109 SER SER A . n A 1 110 TYR 110 110 110 TYR TYR A . n A 1 111 THR 111 111 111 THR THR A . n A 1 112 PHE 112 112 112 PHE PHE A . n A 1 113 ASP 113 113 113 ASP ASP A . n A 1 114 HIS 114 114 114 HIS HIS A . n A 1 115 ARG 115 115 115 ARG ARG A . n A 1 116 ILE 116 116 116 ILE ILE A . n A 1 117 LYS 117 117 117 LYS LYS A . n A 1 118 PRO 118 118 118 PRO PRO A . n A 1 119 GLU 119 119 119 GLU GLU A . n A 1 120 ALA 120 120 120 ALA ALA A . n A 1 121 VAL 121 121 121 VAL VAL A . n A 1 122 LYS 122 122 122 LYS LYS A . n A 1 123 MET 123 123 123 MET MET A . n A 1 124 VAL 124 124 124 VAL VAL A . n A 1 125 GLN 125 125 125 GLN GLN A . n A 1 126 VAL 126 126 126 VAL VAL A . n A 1 127 TRP 127 127 127 TRP TRP A . n A 1 128 ARG 128 128 128 ARG ARG A . n A 1 129 ASP 129 129 129 ASP ASP A . n A 1 130 ILE 130 130 130 ILE ILE A . n A 1 131 SER 131 131 131 SER SER A . n A 1 132 LEU 132 132 132 LEU LEU A . n A 1 133 THR 133 133 133 THR THR A . n A 1 134 LYS 134 134 134 LYS LYS A . n A 1 135 PHE 135 135 135 PHE PHE A . n A 1 136 ASN 136 136 136 ASN ASN A . n A 1 137 VAL 137 137 137 VAL VAL A . n A 1 138 SER 138 138 138 SER SER A . n A 1 139 TYR 139 139 139 TYR TYR A . n A 1 140 LEU 140 140 140 LEU ALA A . n A 1 141 LYS 141 141 141 LYS LYS A . n A 1 142 ARG 142 142 ? ? ? A . n # loop_ _pdbx_branch_scheme.asym_id _pdbx_branch_scheme.entity_id _pdbx_branch_scheme.mon_id _pdbx_branch_scheme.num _pdbx_branch_scheme.pdb_asym_id _pdbx_branch_scheme.pdb_mon_id _pdbx_branch_scheme.pdb_seq_num _pdbx_branch_scheme.auth_asym_id _pdbx_branch_scheme.auth_mon_id _pdbx_branch_scheme.auth_seq_num _pdbx_branch_scheme.hetero B 2 FRU 1 B FRU 1 A LIG 301 n B 2 GLC 2 B GLC 2 A LIG 301 n B 2 GLC 3 B GLC 3 A LIG 301 n # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 FRU ? ? FRU ? ? 'SUBJECT OF INVESTIGATION' ? 2 GLC ? ? GLC ? ? 'SUBJECT OF INVESTIGATION' ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 EDO 1 201 202 EDO EDO A . D 4 HOH 1 301 80 HOH HOH A . D 4 HOH 2 302 10 HOH HOH A . D 4 HOH 3 303 34 HOH HOH A . D 4 HOH 4 304 30 HOH HOH A . D 4 HOH 5 305 35 HOH HOH A . D 4 HOH 6 306 77 HOH HOH A . D 4 HOH 7 307 44 HOH HOH A . D 4 HOH 8 308 15 HOH HOH A . D 4 HOH 9 309 2 HOH HOH A . D 4 HOH 10 310 7 HOH HOH A . D 4 HOH 11 311 6 HOH HOH A . D 4 HOH 12 312 84 HOH HOH A . D 4 HOH 13 313 67 HOH HOH A . D 4 HOH 14 314 71 HOH HOH A . D 4 HOH 15 315 9 HOH HOH A . D 4 HOH 16 316 11 HOH HOH A . D 4 HOH 17 317 55 HOH HOH A . D 4 HOH 18 318 54 HOH HOH A . D 4 HOH 19 319 16 HOH HOH A . D 4 HOH 20 320 73 HOH HOH A . D 4 HOH 21 321 85 HOH HOH A . D 4 HOH 22 322 79 HOH HOH A . D 4 HOH 23 323 3 HOH HOH A . D 4 HOH 24 324 36 HOH HOH A . D 4 HOH 25 325 61 HOH HOH A . D 4 HOH 26 326 64 HOH HOH A . D 4 HOH 27 327 88 HOH HOH A . D 4 HOH 28 328 24 HOH HOH A . D 4 HOH 29 329 27 HOH HOH A . D 4 HOH 30 330 81 HOH HOH A . D 4 HOH 31 331 53 HOH HOH A . D 4 HOH 32 332 37 HOH HOH A . D 4 HOH 33 333 19 HOH HOH A . D 4 HOH 34 334 74 HOH HOH A . D 4 HOH 35 335 12 HOH HOH A . D 4 HOH 36 336 38 HOH HOH A . D 4 HOH 37 337 52 HOH HOH A . D 4 HOH 38 338 47 HOH HOH A . D 4 HOH 39 339 29 HOH HOH A . D 4 HOH 40 340 40 HOH HOH A . D 4 HOH 41 341 76 HOH HOH A . D 4 HOH 42 342 50 HOH HOH A . D 4 HOH 43 343 18 HOH HOH A . D 4 HOH 44 344 43 HOH HOH A . D 4 HOH 45 345 56 HOH HOH A . D 4 HOH 46 346 4 HOH HOH A . D 4 HOH 47 347 70 HOH HOH A . D 4 HOH 48 348 8 HOH HOH A . D 4 HOH 49 349 5 HOH HOH A . D 4 HOH 50 350 69 HOH HOH A . D 4 HOH 51 351 13 HOH HOH A . D 4 HOH 52 352 42 HOH HOH A . D 4 HOH 53 353 66 HOH HOH A . D 4 HOH 54 354 75 HOH HOH A . D 4 HOH 55 355 58 HOH HOH A . D 4 HOH 56 356 51 HOH HOH A . D 4 HOH 57 357 20 HOH HOH A . D 4 HOH 58 358 26 HOH HOH A . D 4 HOH 59 359 28 HOH HOH A . D 4 HOH 60 360 68 HOH HOH A . D 4 HOH 61 361 87 HOH HOH A . D 4 HOH 62 362 21 HOH HOH A . D 4 HOH 63 363 31 HOH HOH A . D 4 HOH 64 364 25 HOH HOH A . D 4 HOH 65 365 22 HOH HOH A . D 4 HOH 66 366 57 HOH HOH A . D 4 HOH 67 367 62 HOH HOH A . D 4 HOH 68 368 14 HOH HOH A . D 4 HOH 69 369 32 HOH HOH A . D 4 HOH 70 370 39 HOH HOH A . D 4 HOH 71 371 46 HOH HOH A . D 4 HOH 72 372 82 HOH HOH A . D 4 HOH 73 373 23 HOH HOH A . D 4 HOH 74 374 72 HOH HOH A . D 4 HOH 75 375 49 HOH HOH A . D 4 HOH 76 376 17 HOH HOH A . D 4 HOH 77 377 33 HOH HOH A . D 4 HOH 78 378 89 HOH HOH A . D 4 HOH 79 379 60 HOH HOH A . D 4 HOH 80 380 59 HOH HOH A . D 4 HOH 81 381 86 HOH HOH A . D 4 HOH 82 382 48 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 60 ? CG ? A ARG 60 CG 2 1 Y 1 A ARG 60 ? CD ? A ARG 60 CD 3 1 Y 1 A ARG 60 ? NE ? A ARG 60 NE 4 1 Y 1 A ARG 60 ? CZ ? A ARG 60 CZ 5 1 Y 1 A ARG 60 ? NH1 ? A ARG 60 NH1 6 1 Y 1 A ARG 60 ? NH2 ? A ARG 60 NH2 7 1 Y 1 A LEU 140 ? CG ? A LEU 140 CG 8 1 Y 1 A LEU 140 ? CD1 ? A LEU 140 CD1 9 1 Y 1 A LEU 140 ? CD2 ? A LEU 140 CD2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.19.2_4158 ? 1 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? . ? 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . ? 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . ? 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . ? 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 9UWU _cell.details ? _cell.formula_units_Z ? _cell.length_a 49.470 _cell.length_a_esd ? _cell.length_b 49.470 _cell.length_b_esd ? _cell.length_c 263.790 _cell.length_c_esd ? _cell.volume 559078.486 _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9UWU _symmetry.cell_setting ? _symmetry.Int_Tables_number 179 _symmetry.space_group_name_Hall 'P 65 2 (x,y,z+1/12)' _symmetry.space_group_name_H-M 'P 65 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9UWU _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.78 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 55.68 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'SMALL TUBES' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'cell-free crystallization' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2023-02-14 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SPRING-8 BEAMLINE BL32XU' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL32XU _diffrn_source.pdbx_synchrotron_site SPring-8 # _reflns.B_iso_Wilson_estimate 21.12 _reflns.entry_id 9UWU _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.99 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 14256 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 15.7 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 6.5 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.985 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.99 _reflns_shell.d_res_low 2.11 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 2179 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.669 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 100.0 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 22.44 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9UWU _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.99 _refine.ls_d_res_low 43.96 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 14150 _refine.ls_number_reflns_R_free 1415 _refine.ls_number_reflns_R_work 12735 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.89 _refine.ls_percent_reflns_R_free 10.00 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2059 _refine.ls_R_factor_R_free 0.2479 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2011 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.36 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 22.3096 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2316 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.99 _refine_hist.d_res_low 43.96 _refine_hist.number_atoms_solvent 82 _refine_hist.number_atoms_total 1248 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1128 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 38 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0087 ? 1222 ? f_bond_d ? ? ? 'X-RAY DIFFRACTION' ? 1.1345 ? 1664 ? f_angle_d ? ? ? 'X-RAY DIFFRACTION' ? 0.0680 ? 188 ? f_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.0091 ? 206 ? f_plane_restr ? ? ? 'X-RAY DIFFRACTION' ? 8.0361 ? 159 ? f_dihedral_angle_d ? ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.99 2.06 . . 137 1238 100.00 . . . . 0.2563 . . . . . . . . . . . . . . . 0.3204 'X-RAY DIFFRACTION' 2.06 2.14 . . 136 1222 100.00 . . . . 0.2344 . . . . . . . . . . . . . . . 0.2914 'X-RAY DIFFRACTION' 2.14 2.24 . . 137 1228 100.00 . . . . 0.2313 . . . . . . . . . . . . . . . 0.2629 'X-RAY DIFFRACTION' 2.24 2.36 . . 137 1236 100.00 . . . . 0.2173 . . . . . . . . . . . . . . . 0.2559 'X-RAY DIFFRACTION' 2.36 2.51 . . 138 1249 100.00 . . . . 0.2119 . . . . . . . . . . . . . . . 0.2816 'X-RAY DIFFRACTION' 2.51 2.70 . . 140 1253 100.00 . . . . 0.2110 . . . . . . . . . . . . . . . 0.2547 'X-RAY DIFFRACTION' 2.70 2.97 . . 141 1264 100.00 . . . . 0.2021 . . . . . . . . . . . . . . . 0.2868 'X-RAY DIFFRACTION' 2.97 3.40 . . 142 1282 100.00 . . . . 0.2049 . . . . . . . . . . . . . . . 0.2380 'X-RAY DIFFRACTION' 3.40 4.28 . . 147 1324 99.86 . . . . 0.1729 . . . . . . . . . . . . . . . 0.2009 'X-RAY DIFFRACTION' 4.29 43.96 . . 160 1439 99.19 . . . . 0.1808 . . . . . . . . . . . . . . . 0.2340 # _struct.entry_id 9UWU _struct.title 'Crystal structure of human galectin-10 produced by cell-free protein synthesis in complex with melezitose' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9UWU _struct_keywords.text 'Galectin, CLC, SUGAR BINDING PROTEIN' _struct_keywords.pdbx_keywords 'SUGAR BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code LEG10_HUMAN _struct_ref.pdbx_db_accession Q05315 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSLLPVPYTEAASLSTGSTVTIKGRPLACFLNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYGAWKQQVESKN MPFQDGQEFELSISVLPDKYQVMVNGQSSYTFDHRIKPEAVKMVQVWRDISLTKFNVSYLKR ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9UWU _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 142 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q05315 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 142 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 142 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1950 ? 1 MORE -0 ? 1 'SSA (A^2)' 12700 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 10_555 -y,-x,-z+1/6 0.5000000000 -0.8660254038 0.0000000000 0.0000000000 -0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 43.9650000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 CYS A 29 ? GLU A 33 ? CYS A 29 GLU A 33 5 ? 5 HELX_P HELX_P2 AA2 LYS A 117 ? VAL A 121 ? LYS A 117 VAL A 121 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? B FRU . C2 ? ? ? 1_555 B GLC . O1 ? ? B FRU 1 B GLC 2 1_555 ? ? ? ? ? ? ? 1.414 ? ? covale2 covale both ? B FRU . O3 ? ? ? 1_555 B GLC . C1 ? ? B FRU 1 B GLC 3 1_555 ? ? ? ? ? ? ? 1.403 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id VAL _struct_mon_prot_cis.label_seq_id 6 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id VAL _struct_mon_prot_cis.auth_seq_id 6 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 7 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 7 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 5.08 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 6 ? AA2 ? 6 ? AA3 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA3 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TYR A 8 ? ALA A 11 ? TYR A 8 ALA A 11 AA1 2 MET A 123 ? ARG A 128 ? MET A 123 ARG A 128 AA1 3 TYR A 35 ? HIS A 41 ? TYR A 35 HIS A 41 AA1 4 ILE A 50 ? CYS A 57 ? ILE A 50 CYS A 57 AA1 5 ARG A 61 ? GLU A 68 ? ARG A 61 GLU A 68 AA1 6 ALA A 71 ? TRP A 72 ? ALA A 71 TRP A 72 AA2 1 TYR A 8 ? ALA A 11 ? TYR A 8 ALA A 11 AA2 2 MET A 123 ? ARG A 128 ? MET A 123 ARG A 128 AA2 3 TYR A 35 ? HIS A 41 ? TYR A 35 HIS A 41 AA2 4 ILE A 50 ? CYS A 57 ? ILE A 50 CYS A 57 AA2 5 ARG A 61 ? GLU A 68 ? ARG A 61 GLU A 68 AA2 6 VAL A 76 ? SER A 78 ? VAL A 76 SER A 78 AA3 1 GLN A 107 ? ASP A 113 ? GLN A 107 ASP A 113 AA3 2 LYS A 99 ? VAL A 104 ? LYS A 99 VAL A 104 AA3 3 PHE A 89 ? VAL A 95 ? PHE A 89 VAL A 95 AA3 4 SER A 18 ? PRO A 26 ? SER A 18 PRO A 26 AA3 5 ILE A 130 ? TYR A 139 ? ILE A 130 TYR A 139 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N TYR A 8 ? N TYR A 8 O VAL A 126 ? O VAL A 126 AA1 2 3 O MET A 123 ? O MET A 123 N HIS A 41 ? N HIS A 41 AA1 3 4 N LEU A 36 ? N LEU A 36 O VAL A 56 ? O VAL A 56 AA1 4 5 N CYS A 57 ? N CYS A 57 O ARG A 61 ? O ARG A 61 AA1 5 6 N GLU A 68 ? N GLU A 68 O ALA A 71 ? O ALA A 71 AA2 1 2 N TYR A 8 ? N TYR A 8 O VAL A 126 ? O VAL A 126 AA2 2 3 O MET A 123 ? O MET A 123 N HIS A 41 ? N HIS A 41 AA2 3 4 N LEU A 36 ? N LEU A 36 O VAL A 56 ? O VAL A 56 AA2 4 5 N CYS A 57 ? N CYS A 57 O ARG A 61 ? O ARG A 61 AA2 5 6 N VAL A 62 ? N VAL A 62 O SER A 78 ? O SER A 78 AA3 1 2 O TYR A 110 ? O TYR A 110 N VAL A 102 ? N VAL A 102 AA3 2 3 O MET A 103 ? O MET A 103 N SER A 92 ? N SER A 92 AA3 3 4 O LEU A 91 ? O LEU A 91 N ILE A 22 ? N ILE A 22 AA3 4 5 N THR A 21 ? N THR A 21 O ASN A 136 ? O ASN A 136 # _pdbx_entry_details.entry_id 9UWU _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 60 ? ? -126.60 -64.78 2 1 ASN A 65 ? ? -170.78 -178.26 3 1 LYS A 73 ? ? -101.11 -145.57 4 1 SER A 109 ? ? -133.33 -31.28 5 1 ARG A 128 ? ? 81.30 -147.62 6 1 ASP A 129 ? ? -92.91 58.28 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 339 ? D HOH . 2 1 A HOH 355 ? D HOH . # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x-y,x,z+5/6 3 y,-x+y,z+1/6 4 -y,x-y,z+2/3 5 -x+y,-x,z+1/3 6 x-y,-y,-z 7 -x,-x+y,-z+1/3 8 -x,-y,z+1/2 9 y,x,-z+2/3 10 -y,-x,-z+1/6 11 -x+y,y,-z+1/2 12 x,x-y,-z+5/6 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ARG 142 ? A ARG 142 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 EDO C1 C N N 88 EDO O1 O N N 89 EDO C2 C N N 90 EDO O2 O N N 91 EDO H11 H N N 92 EDO H12 H N N 93 EDO HO1 H N N 94 EDO H21 H N N 95 EDO H22 H N N 96 EDO HO2 H N N 97 FRU C1 C N N 98 FRU C2 C N R 99 FRU C3 C N S 100 FRU C4 C N S 101 FRU C5 C N R 102 FRU C6 C N N 103 FRU O1 O N N 104 FRU O2 O N N 105 FRU O3 O N N 106 FRU O4 O N N 107 FRU O5 O N N 108 FRU O6 O N N 109 FRU H11 H N N 110 FRU H12 H N N 111 FRU H3 H N N 112 FRU H4 H N N 113 FRU H5 H N N 114 FRU H61 H N N 115 FRU H62 H N N 116 FRU HO1 H N N 117 FRU HO2 H N N 118 FRU HO3 H N N 119 FRU HO4 H N N 120 FRU HO6 H N N 121 GLC C1 C N S 122 GLC C2 C N R 123 GLC C3 C N S 124 GLC C4 C N S 125 GLC C5 C N R 126 GLC C6 C N N 127 GLC O1 O N N 128 GLC O2 O N N 129 GLC O3 O N N 130 GLC O4 O N N 131 GLC O5 O N N 132 GLC O6 O N N 133 GLC H1 H N N 134 GLC H2 H N N 135 GLC H3 H N N 136 GLC H4 H N N 137 GLC H5 H N N 138 GLC H61 H N N 139 GLC H62 H N N 140 GLC HO1 H N N 141 GLC HO2 H N N 142 GLC HO3 H N N 143 GLC HO4 H N N 144 GLC HO6 H N N 145 GLN N N N N 146 GLN CA C N S 147 GLN C C N N 148 GLN O O N N 149 GLN CB C N N 150 GLN CG C N N 151 GLN CD C N N 152 GLN OE1 O N N 153 GLN NE2 N N N 154 GLN OXT O N N 155 GLN H H N N 156 GLN H2 H N N 157 GLN HA H N N 158 GLN HB2 H N N 159 GLN HB3 H N N 160 GLN HG2 H N N 161 GLN HG3 H N N 162 GLN HE21 H N N 163 GLN HE22 H N N 164 GLN HXT H N N 165 GLU N N N N 166 GLU CA C N S 167 GLU C C N N 168 GLU O O N N 169 GLU CB C N N 170 GLU CG C N N 171 GLU CD C N N 172 GLU OE1 O N N 173 GLU OE2 O N N 174 GLU OXT O N N 175 GLU H H N N 176 GLU H2 H N N 177 GLU HA H N N 178 GLU HB2 H N N 179 GLU HB3 H N N 180 GLU HG2 H N N 181 GLU HG3 H N N 182 GLU HE2 H N N 183 GLU HXT H N N 184 GLY N N N N 185 GLY CA C N N 186 GLY C C N N 187 GLY O O N N 188 GLY OXT O N N 189 GLY H H N N 190 GLY H2 H N N 191 GLY HA2 H N N 192 GLY HA3 H N N 193 GLY HXT H N N 194 HIS N N N N 195 HIS CA C N S 196 HIS C C N N 197 HIS O O N N 198 HIS CB C N N 199 HIS CG C Y N 200 HIS ND1 N Y N 201 HIS CD2 C Y N 202 HIS CE1 C Y N 203 HIS NE2 N Y N 204 HIS OXT O N N 205 HIS H H N N 206 HIS H2 H N N 207 HIS HA H N N 208 HIS HB2 H N N 209 HIS HB3 H N N 210 HIS HD1 H N N 211 HIS HD2 H N N 212 HIS HE1 H N N 213 HIS HE2 H N N 214 HIS HXT H N N 215 HOH O O N N 216 HOH H1 H N N 217 HOH H2 H N N 218 ILE N N N N 219 ILE CA C N S 220 ILE C C N N 221 ILE O O N N 222 ILE CB C N S 223 ILE CG1 C N N 224 ILE CG2 C N N 225 ILE CD1 C N N 226 ILE OXT O N N 227 ILE H H N N 228 ILE H2 H N N 229 ILE HA H N N 230 ILE HB H N N 231 ILE HG12 H N N 232 ILE HG13 H N N 233 ILE HG21 H N N 234 ILE HG22 H N N 235 ILE HG23 H N N 236 ILE HD11 H N N 237 ILE HD12 H N N 238 ILE HD13 H N N 239 ILE HXT H N N 240 LEU N N N N 241 LEU CA C N S 242 LEU C C N N 243 LEU O O N N 244 LEU CB C N N 245 LEU CG C N N 246 LEU CD1 C N N 247 LEU CD2 C N N 248 LEU OXT O N N 249 LEU H H N N 250 LEU H2 H N N 251 LEU HA H N N 252 LEU HB2 H N N 253 LEU HB3 H N N 254 LEU HG H N N 255 LEU HD11 H N N 256 LEU HD12 H N N 257 LEU HD13 H N N 258 LEU HD21 H N N 259 LEU HD22 H N N 260 LEU HD23 H N N 261 LEU HXT H N N 262 LYS N N N N 263 LYS CA C N S 264 LYS C C N N 265 LYS O O N N 266 LYS CB C N N 267 LYS CG C N N 268 LYS CD C N N 269 LYS CE C N N 270 LYS NZ N N N 271 LYS OXT O N N 272 LYS H H N N 273 LYS H2 H N N 274 LYS HA H N N 275 LYS HB2 H N N 276 LYS HB3 H N N 277 LYS HG2 H N N 278 LYS HG3 H N N 279 LYS HD2 H N N 280 LYS HD3 H N N 281 LYS HE2 H N N 282 LYS HE3 H N N 283 LYS HZ1 H N N 284 LYS HZ2 H N N 285 LYS HZ3 H N N 286 LYS HXT H N N 287 MET N N N N 288 MET CA C N S 289 MET C C N N 290 MET O O N N 291 MET CB C N N 292 MET CG C N N 293 MET SD S N N 294 MET CE C N N 295 MET OXT O N N 296 MET H H N N 297 MET H2 H N N 298 MET HA H N N 299 MET HB2 H N N 300 MET HB3 H N N 301 MET HG2 H N N 302 MET HG3 H N N 303 MET HE1 H N N 304 MET HE2 H N N 305 MET HE3 H N N 306 MET HXT H N N 307 PHE N N N N 308 PHE CA C N S 309 PHE C C N N 310 PHE O O N N 311 PHE CB C N N 312 PHE CG C Y N 313 PHE CD1 C Y N 314 PHE CD2 C Y N 315 PHE CE1 C Y N 316 PHE CE2 C Y N 317 PHE CZ C Y N 318 PHE OXT O N N 319 PHE H H N N 320 PHE H2 H N N 321 PHE HA H N N 322 PHE HB2 H N N 323 PHE HB3 H N N 324 PHE HD1 H N N 325 PHE HD2 H N N 326 PHE HE1 H N N 327 PHE HE2 H N N 328 PHE HZ H N N 329 PHE HXT H N N 330 PRO N N N N 331 PRO CA C N S 332 PRO C C N N 333 PRO O O N N 334 PRO CB C N N 335 PRO CG C N N 336 PRO CD C N N 337 PRO OXT O N N 338 PRO H H N N 339 PRO HA H N N 340 PRO HB2 H N N 341 PRO HB3 H N N 342 PRO HG2 H N N 343 PRO HG3 H N N 344 PRO HD2 H N N 345 PRO HD3 H N N 346 PRO HXT H N N 347 SER N N N N 348 SER CA C N S 349 SER C C N N 350 SER O O N N 351 SER CB C N N 352 SER OG O N N 353 SER OXT O N N 354 SER H H N N 355 SER H2 H N N 356 SER HA H N N 357 SER HB2 H N N 358 SER HB3 H N N 359 SER HG H N N 360 SER HXT H N N 361 THR N N N N 362 THR CA C N S 363 THR C C N N 364 THR O O N N 365 THR CB C N R 366 THR OG1 O N N 367 THR CG2 C N N 368 THR OXT O N N 369 THR H H N N 370 THR H2 H N N 371 THR HA H N N 372 THR HB H N N 373 THR HG1 H N N 374 THR HG21 H N N 375 THR HG22 H N N 376 THR HG23 H N N 377 THR HXT H N N 378 TRP N N N N 379 TRP CA C N S 380 TRP C C N N 381 TRP O O N N 382 TRP CB C N N 383 TRP CG C Y N 384 TRP CD1 C Y N 385 TRP CD2 C Y N 386 TRP NE1 N Y N 387 TRP CE2 C Y N 388 TRP CE3 C Y N 389 TRP CZ2 C Y N 390 TRP CZ3 C Y N 391 TRP CH2 C Y N 392 TRP OXT O N N 393 TRP H H N N 394 TRP H2 H N N 395 TRP HA H N N 396 TRP HB2 H N N 397 TRP HB3 H N N 398 TRP HD1 H N N 399 TRP HE1 H N N 400 TRP HE3 H N N 401 TRP HZ2 H N N 402 TRP HZ3 H N N 403 TRP HH2 H N N 404 TRP HXT H N N 405 TYR N N N N 406 TYR CA C N S 407 TYR C C N N 408 TYR O O N N 409 TYR CB C N N 410 TYR CG C Y N 411 TYR CD1 C Y N 412 TYR CD2 C Y N 413 TYR CE1 C Y N 414 TYR CE2 C Y N 415 TYR CZ C Y N 416 TYR OH O N N 417 TYR OXT O N N 418 TYR H H N N 419 TYR H2 H N N 420 TYR HA H N N 421 TYR HB2 H N N 422 TYR HB3 H N N 423 TYR HD1 H N N 424 TYR HD2 H N N 425 TYR HE1 H N N 426 TYR HE2 H N N 427 TYR HH H N N 428 TYR HXT H N N 429 VAL N N N N 430 VAL CA C N S 431 VAL C C N N 432 VAL O O N N 433 VAL CB C N N 434 VAL CG1 C N N 435 VAL CG2 C N N 436 VAL OXT O N N 437 VAL H H N N 438 VAL H2 H N N 439 VAL HA H N N 440 VAL HB H N N 441 VAL HG11 H N N 442 VAL HG12 H N N 443 VAL HG13 H N N 444 VAL HG21 H N N 445 VAL HG22 H N N 446 VAL HG23 H N N 447 VAL HXT H N N 448 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 EDO C1 O1 sing N N 83 EDO C1 C2 sing N N 84 EDO C1 H11 sing N N 85 EDO C1 H12 sing N N 86 EDO O1 HO1 sing N N 87 EDO C2 O2 sing N N 88 EDO C2 H21 sing N N 89 EDO C2 H22 sing N N 90 EDO O2 HO2 sing N N 91 FRU C1 C2 sing N N 92 FRU C1 O1 sing N N 93 FRU C1 H11 sing N N 94 FRU C1 H12 sing N N 95 FRU C2 C3 sing N N 96 FRU C2 O2 sing N N 97 FRU C2 O5 sing N N 98 FRU C3 C4 sing N N 99 FRU C3 O3 sing N N 100 FRU C3 H3 sing N N 101 FRU C4 C5 sing N N 102 FRU C4 O4 sing N N 103 FRU C4 H4 sing N N 104 FRU C5 C6 sing N N 105 FRU C5 O5 sing N N 106 FRU C5 H5 sing N N 107 FRU C6 O6 sing N N 108 FRU C6 H61 sing N N 109 FRU C6 H62 sing N N 110 FRU O1 HO1 sing N N 111 FRU O2 HO2 sing N N 112 FRU O3 HO3 sing N N 113 FRU O4 HO4 sing N N 114 FRU O6 HO6 sing N N 115 GLC C1 C2 sing N N 116 GLC C1 O1 sing N N 117 GLC C1 O5 sing N N 118 GLC C1 H1 sing N N 119 GLC C2 C3 sing N N 120 GLC C2 O2 sing N N 121 GLC C2 H2 sing N N 122 GLC C3 C4 sing N N 123 GLC C3 O3 sing N N 124 GLC C3 H3 sing N N 125 GLC C4 C5 sing N N 126 GLC C4 O4 sing N N 127 GLC C4 H4 sing N N 128 GLC C5 C6 sing N N 129 GLC C5 O5 sing N N 130 GLC C5 H5 sing N N 131 GLC C6 O6 sing N N 132 GLC C6 H61 sing N N 133 GLC C6 H62 sing N N 134 GLC O1 HO1 sing N N 135 GLC O2 HO2 sing N N 136 GLC O3 HO3 sing N N 137 GLC O4 HO4 sing N N 138 GLC O6 HO6 sing N N 139 GLN N CA sing N N 140 GLN N H sing N N 141 GLN N H2 sing N N 142 GLN CA C sing N N 143 GLN CA CB sing N N 144 GLN CA HA sing N N 145 GLN C O doub N N 146 GLN C OXT sing N N 147 GLN CB CG sing N N 148 GLN CB HB2 sing N N 149 GLN CB HB3 sing N N 150 GLN CG CD sing N N 151 GLN CG HG2 sing N N 152 GLN CG HG3 sing N N 153 GLN CD OE1 doub N N 154 GLN CD NE2 sing N N 155 GLN NE2 HE21 sing N N 156 GLN NE2 HE22 sing N N 157 GLN OXT HXT sing N N 158 GLU N CA sing N N 159 GLU N H sing N N 160 GLU N H2 sing N N 161 GLU CA C sing N N 162 GLU CA CB sing N N 163 GLU CA HA sing N N 164 GLU C O doub N N 165 GLU C OXT sing N N 166 GLU CB CG sing N N 167 GLU CB HB2 sing N N 168 GLU CB HB3 sing N N 169 GLU CG CD sing N N 170 GLU CG HG2 sing N N 171 GLU CG HG3 sing N N 172 GLU CD OE1 doub N N 173 GLU CD OE2 sing N N 174 GLU OE2 HE2 sing N N 175 GLU OXT HXT sing N N 176 GLY N CA sing N N 177 GLY N H sing N N 178 GLY N H2 sing N N 179 GLY CA C sing N N 180 GLY CA HA2 sing N N 181 GLY CA HA3 sing N N 182 GLY C O doub N N 183 GLY C OXT sing N N 184 GLY OXT HXT sing N N 185 HIS N CA sing N N 186 HIS N H sing N N 187 HIS N H2 sing N N 188 HIS CA C sing N N 189 HIS CA CB sing N N 190 HIS CA HA sing N N 191 HIS C O doub N N 192 HIS C OXT sing N N 193 HIS CB CG sing N N 194 HIS CB HB2 sing N N 195 HIS CB HB3 sing N N 196 HIS CG ND1 sing Y N 197 HIS CG CD2 doub Y N 198 HIS ND1 CE1 doub Y N 199 HIS ND1 HD1 sing N N 200 HIS CD2 NE2 sing Y N 201 HIS CD2 HD2 sing N N 202 HIS CE1 NE2 sing Y N 203 HIS CE1 HE1 sing N N 204 HIS NE2 HE2 sing N N 205 HIS OXT HXT sing N N 206 HOH O H1 sing N N 207 HOH O H2 sing N N 208 ILE N CA sing N N 209 ILE N H sing N N 210 ILE N H2 sing N N 211 ILE CA C sing N N 212 ILE CA CB sing N N 213 ILE CA HA sing N N 214 ILE C O doub N N 215 ILE C OXT sing N N 216 ILE CB CG1 sing N N 217 ILE CB CG2 sing N N 218 ILE CB HB sing N N 219 ILE CG1 CD1 sing N N 220 ILE CG1 HG12 sing N N 221 ILE CG1 HG13 sing N N 222 ILE CG2 HG21 sing N N 223 ILE CG2 HG22 sing N N 224 ILE CG2 HG23 sing N N 225 ILE CD1 HD11 sing N N 226 ILE CD1 HD12 sing N N 227 ILE CD1 HD13 sing N N 228 ILE OXT HXT sing N N 229 LEU N CA sing N N 230 LEU N H sing N N 231 LEU N H2 sing N N 232 LEU CA C sing N N 233 LEU CA CB sing N N 234 LEU CA HA sing N N 235 LEU C O doub N N 236 LEU C OXT sing N N 237 LEU CB CG sing N N 238 LEU CB HB2 sing N N 239 LEU CB HB3 sing N N 240 LEU CG CD1 sing N N 241 LEU CG CD2 sing N N 242 LEU CG HG sing N N 243 LEU CD1 HD11 sing N N 244 LEU CD1 HD12 sing N N 245 LEU CD1 HD13 sing N N 246 LEU CD2 HD21 sing N N 247 LEU CD2 HD22 sing N N 248 LEU CD2 HD23 sing N N 249 LEU OXT HXT sing N N 250 LYS N CA sing N N 251 LYS N H sing N N 252 LYS N H2 sing N N 253 LYS CA C sing N N 254 LYS CA CB sing N N 255 LYS CA HA sing N N 256 LYS C O doub N N 257 LYS C OXT sing N N 258 LYS CB CG sing N N 259 LYS CB HB2 sing N N 260 LYS CB HB3 sing N N 261 LYS CG CD sing N N 262 LYS CG HG2 sing N N 263 LYS CG HG3 sing N N 264 LYS CD CE sing N N 265 LYS CD HD2 sing N N 266 LYS CD HD3 sing N N 267 LYS CE NZ sing N N 268 LYS CE HE2 sing N N 269 LYS CE HE3 sing N N 270 LYS NZ HZ1 sing N N 271 LYS NZ HZ2 sing N N 272 LYS NZ HZ3 sing N N 273 LYS OXT HXT sing N N 274 MET N CA sing N N 275 MET N H sing N N 276 MET N H2 sing N N 277 MET CA C sing N N 278 MET CA CB sing N N 279 MET CA HA sing N N 280 MET C O doub N N 281 MET C OXT sing N N 282 MET CB CG sing N N 283 MET CB HB2 sing N N 284 MET CB HB3 sing N N 285 MET CG SD sing N N 286 MET CG HG2 sing N N 287 MET CG HG3 sing N N 288 MET SD CE sing N N 289 MET CE HE1 sing N N 290 MET CE HE2 sing N N 291 MET CE HE3 sing N N 292 MET OXT HXT sing N N 293 PHE N CA sing N N 294 PHE N H sing N N 295 PHE N H2 sing N N 296 PHE CA C sing N N 297 PHE CA CB sing N N 298 PHE CA HA sing N N 299 PHE C O doub N N 300 PHE C OXT sing N N 301 PHE CB CG sing N N 302 PHE CB HB2 sing N N 303 PHE CB HB3 sing N N 304 PHE CG CD1 doub Y N 305 PHE CG CD2 sing Y N 306 PHE CD1 CE1 sing Y N 307 PHE CD1 HD1 sing N N 308 PHE CD2 CE2 doub Y N 309 PHE CD2 HD2 sing N N 310 PHE CE1 CZ doub Y N 311 PHE CE1 HE1 sing N N 312 PHE CE2 CZ sing Y N 313 PHE CE2 HE2 sing N N 314 PHE CZ HZ sing N N 315 PHE OXT HXT sing N N 316 PRO N CA sing N N 317 PRO N CD sing N N 318 PRO N H sing N N 319 PRO CA C sing N N 320 PRO CA CB sing N N 321 PRO CA HA sing N N 322 PRO C O doub N N 323 PRO C OXT sing N N 324 PRO CB CG sing N N 325 PRO CB HB2 sing N N 326 PRO CB HB3 sing N N 327 PRO CG CD sing N N 328 PRO CG HG2 sing N N 329 PRO CG HG3 sing N N 330 PRO CD HD2 sing N N 331 PRO CD HD3 sing N N 332 PRO OXT HXT sing N N 333 SER N CA sing N N 334 SER N H sing N N 335 SER N H2 sing N N 336 SER CA C sing N N 337 SER CA CB sing N N 338 SER CA HA sing N N 339 SER C O doub N N 340 SER C OXT sing N N 341 SER CB OG sing N N 342 SER CB HB2 sing N N 343 SER CB HB3 sing N N 344 SER OG HG sing N N 345 SER OXT HXT sing N N 346 THR N CA sing N N 347 THR N H sing N N 348 THR N H2 sing N N 349 THR CA C sing N N 350 THR CA CB sing N N 351 THR CA HA sing N N 352 THR C O doub N N 353 THR C OXT sing N N 354 THR CB OG1 sing N N 355 THR CB CG2 sing N N 356 THR CB HB sing N N 357 THR OG1 HG1 sing N N 358 THR CG2 HG21 sing N N 359 THR CG2 HG22 sing N N 360 THR CG2 HG23 sing N N 361 THR OXT HXT sing N N 362 TRP N CA sing N N 363 TRP N H sing N N 364 TRP N H2 sing N N 365 TRP CA C sing N N 366 TRP CA CB sing N N 367 TRP CA HA sing N N 368 TRP C O doub N N 369 TRP C OXT sing N N 370 TRP CB CG sing N N 371 TRP CB HB2 sing N N 372 TRP CB HB3 sing N N 373 TRP CG CD1 doub Y N 374 TRP CG CD2 sing Y N 375 TRP CD1 NE1 sing Y N 376 TRP CD1 HD1 sing N N 377 TRP CD2 CE2 doub Y N 378 TRP CD2 CE3 sing Y N 379 TRP NE1 CE2 sing Y N 380 TRP NE1 HE1 sing N N 381 TRP CE2 CZ2 sing Y N 382 TRP CE3 CZ3 doub Y N 383 TRP CE3 HE3 sing N N 384 TRP CZ2 CH2 doub Y N 385 TRP CZ2 HZ2 sing N N 386 TRP CZ3 CH2 sing Y N 387 TRP CZ3 HZ3 sing N N 388 TRP CH2 HH2 sing N N 389 TRP OXT HXT sing N N 390 TYR N CA sing N N 391 TYR N H sing N N 392 TYR N H2 sing N N 393 TYR CA C sing N N 394 TYR CA CB sing N N 395 TYR CA HA sing N N 396 TYR C O doub N N 397 TYR C OXT sing N N 398 TYR CB CG sing N N 399 TYR CB HB2 sing N N 400 TYR CB HB3 sing N N 401 TYR CG CD1 doub Y N 402 TYR CG CD2 sing Y N 403 TYR CD1 CE1 sing Y N 404 TYR CD1 HD1 sing N N 405 TYR CD2 CE2 doub Y N 406 TYR CD2 HD2 sing N N 407 TYR CE1 CZ doub Y N 408 TYR CE1 HE1 sing N N 409 TYR CE2 CZ sing Y N 410 TYR CE2 HE2 sing N N 411 TYR CZ OH sing N N 412 TYR OH HH sing N N 413 TYR OXT HXT sing N N 414 VAL N CA sing N N 415 VAL N H sing N N 416 VAL N H2 sing N N 417 VAL CA C sing N N 418 VAL CA CB sing N N 419 VAL CA HA sing N N 420 VAL C O doub N N 421 VAL C OXT sing N N 422 VAL CB CG1 sing N N 423 VAL CB CG2 sing N N 424 VAL CB HB sing N N 425 VAL CG1 HG11 sing N N 426 VAL CG1 HG12 sing N N 427 VAL CG1 HG13 sing N N 428 VAL CG2 HG21 sing N N 429 VAL CG2 HG22 sing N N 430 VAL CG2 HG23 sing N N 431 VAL OXT HXT sing N N 432 # _pdbx_audit_support.funding_organization 'Japan Society for the Promotion of Science (JSPS)' _pdbx_audit_support.country Japan _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_branch_list.entity_id _pdbx_entity_branch_list.comp_id _pdbx_entity_branch_list.num _pdbx_entity_branch_list.hetero 2 FRU 1 n 2 GLC 2 n 2 GLC 3 n # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1LCL _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'P 65 2 2' _space_group.name_Hall 'P 65 2 (x,y,z+1/12)' _space_group.IT_number 179 _space_group.crystal_system hexagonal _space_group.id 1 # _atom_sites.entry_id 9UWU _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.020214 _atom_sites.fract_transf_matrix[1][2] 0.011671 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.023341 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.003791 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? 0.51345 0.48472 ? ? 24.73122 6.32584 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ #