data_9VF8 # _entry.id 9VF8 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.408 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9VF8 pdb_00009vf8 10.2210/pdb9vf8/pdb WWPDB D_1300060013 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2025-06-25 ? 2 'Structure model' 1 1 2025-12-17 ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.journal_volume' 7 2 'Structure model' '_citation.page_first' 8 2 'Structure model' '_citation.page_last' 9 2 'Structure model' '_citation.pdbx_database_id_DOI' 10 2 'Structure model' '_citation.pdbx_database_id_PubMed' 11 2 'Structure model' '_citation.title' 12 2 'Structure model' '_citation.year' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9VF8 _pdbx_database_status.recvd_initial_deposition_date 2025-06-10 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 3 _pdbx_contact_author.email ivan.gushchin@phystech.edu _pdbx_contact_author.name_first Ivan _pdbx_contact_author.name_last Gushchin _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-5348-6070 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Semenov, O.' 1 0000-0001-9470-0013 'Nazarenko, V.' 2 ? 'Yudenko, A.' 3 ? 'Remeeva, A.' 4 ? 'Borshchevskiy, V.' 5 ? 'Yang, Y.' 6 ? 'Gushchin, I.' 7 0000-0002-5348-6070 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Struct.Biol. _citation.journal_id_ASTM JSBIEM _citation.journal_id_CSD 0803 _citation.journal_id_ISSN 1095-8657 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 218 _citation.language ? _citation.page_first 108268 _citation.page_last 108268 _citation.title 'Structural characterization of Meiothermus ruber LOV domain.' _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.jsb.2025.108268 _citation.pdbx_database_id_PubMed 41349808 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Semenov, O.' 1 ? primary 'Nazarenko, V.' 2 ? primary 'Yudenko, A.' 3 ? primary 'Kovalev, K.' 4 ? primary 'Goncharov, I.' 5 ? primary 'Natarov, I.' 6 ? primary 'Mikhailov, A.' 7 ? primary 'Kuznetsova, E.' 8 ? primary 'Nikolaev, A.' 9 ? primary 'Yang, Y.' 10 ? primary 'Sluchanko, N.N.' 11 ? primary 'Borshchevskiy, V.' 12 ? primary 'Remeeva, A.' 13 ? primary 'Gushchin, I.' 14 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'histidine kinase' 12714.391 1 2.7.13.3 ? ? ? 2 non-polymer nat 'FLAVIN MONONUCLEOTIDE' 456.344 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MAGVVITDAQLPDYPIVYCNPGFVQLTGYPSEEVLGRNCRFLQGPATNPETVARLRRAIHEGRPAHVLLLNYRKDGQPFW NDLRIAPVRDVEGRLTHFVGIQSDVSHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MAGVVITDAQLPDYPIVYCNPGFVQLTGYPSEEVLGRNCRFLQGPATNPETVARLRRAIHEGRPAHVLLLNYRKDGQPFW NDLRIAPVRDVEGRLTHFVGIQSDVSHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'FLAVIN MONONUCLEOTIDE' _pdbx_entity_nonpoly.comp_id FMN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 GLY n 1 4 VAL n 1 5 VAL n 1 6 ILE n 1 7 THR n 1 8 ASP n 1 9 ALA n 1 10 GLN n 1 11 LEU n 1 12 PRO n 1 13 ASP n 1 14 TYR n 1 15 PRO n 1 16 ILE n 1 17 VAL n 1 18 TYR n 1 19 CYS n 1 20 ASN n 1 21 PRO n 1 22 GLY n 1 23 PHE n 1 24 VAL n 1 25 GLN n 1 26 LEU n 1 27 THR n 1 28 GLY n 1 29 TYR n 1 30 PRO n 1 31 SER n 1 32 GLU n 1 33 GLU n 1 34 VAL n 1 35 LEU n 1 36 GLY n 1 37 ARG n 1 38 ASN n 1 39 CYS n 1 40 ARG n 1 41 PHE n 1 42 LEU n 1 43 GLN n 1 44 GLY n 1 45 PRO n 1 46 ALA n 1 47 THR n 1 48 ASN n 1 49 PRO n 1 50 GLU n 1 51 THR n 1 52 VAL n 1 53 ALA n 1 54 ARG n 1 55 LEU n 1 56 ARG n 1 57 ARG n 1 58 ALA n 1 59 ILE n 1 60 HIS n 1 61 GLU n 1 62 GLY n 1 63 ARG n 1 64 PRO n 1 65 ALA n 1 66 HIS n 1 67 VAL n 1 68 LEU n 1 69 LEU n 1 70 LEU n 1 71 ASN n 1 72 TYR n 1 73 ARG n 1 74 LYS n 1 75 ASP n 1 76 GLY n 1 77 GLN n 1 78 PRO n 1 79 PHE n 1 80 TRP n 1 81 ASN n 1 82 ASP n 1 83 LEU n 1 84 ARG n 1 85 ILE n 1 86 ALA n 1 87 PRO n 1 88 VAL n 1 89 ARG n 1 90 ASP n 1 91 VAL n 1 92 GLU n 1 93 GLY n 1 94 ARG n 1 95 LEU n 1 96 THR n 1 97 HIS n 1 98 PHE n 1 99 VAL n 1 100 GLY n 1 101 ILE n 1 102 GLN n 1 103 SER n 1 104 ASP n 1 105 VAL n 1 106 SER n 1 107 HIS n 1 108 HIS n 1 109 HIS n 1 110 HIS n 1 111 HIS n 1 112 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 112 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'Mrub_1259, K649_05955' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'DSM 1279' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Meiothermus ruber DSM 1279' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 504728 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FMN non-polymer . 'FLAVIN MONONUCLEOTIDE' 'RIBOFLAVIN MONOPHOSPHATE' 'C17 H21 N4 O9 P' 456.344 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 14 ? ? ? A . n A 1 2 ALA 2 15 15 ALA ALA A . n A 1 3 GLY 3 16 16 GLY GLY A . n A 1 4 VAL 4 17 17 VAL VAL A . n A 1 5 VAL 5 18 18 VAL VAL A . n A 1 6 ILE 6 19 19 ILE ILE A . n A 1 7 THR 7 20 20 THR THR A . n A 1 8 ASP 8 21 21 ASP ASP A . n A 1 9 ALA 9 22 22 ALA ALA A . n A 1 10 GLN 10 23 23 GLN GLN A . n A 1 11 LEU 11 24 24 LEU LEU A . n A 1 12 PRO 12 25 25 PRO PRO A . n A 1 13 ASP 13 26 26 ASP ASP A . n A 1 14 TYR 14 27 27 TYR TYR A . n A 1 15 PRO 15 28 28 PRO PRO A . n A 1 16 ILE 16 29 29 ILE ILE A . n A 1 17 VAL 17 30 30 VAL VAL A . n A 1 18 TYR 18 31 31 TYR TYR A . n A 1 19 CYS 19 32 32 CYS CYS A . n A 1 20 ASN 20 33 33 ASN ASN A . n A 1 21 PRO 21 34 34 PRO PRO A . n A 1 22 GLY 22 35 35 GLY GLY A . n A 1 23 PHE 23 36 36 PHE PHE A . n A 1 24 VAL 24 37 37 VAL VAL A . n A 1 25 GLN 25 38 38 GLN GLN A . n A 1 26 LEU 26 39 39 LEU LEU A . n A 1 27 THR 27 40 40 THR THR A . n A 1 28 GLY 28 41 41 GLY GLY A . n A 1 29 TYR 29 42 42 TYR TYR A . n A 1 30 PRO 30 43 43 PRO PRO A . n A 1 31 SER 31 44 44 SER SER A . n A 1 32 GLU 32 45 45 GLU GLU A . n A 1 33 GLU 33 46 46 GLU GLU A . n A 1 34 VAL 34 47 47 VAL VAL A . n A 1 35 LEU 35 48 48 LEU LEU A . n A 1 36 GLY 36 49 49 GLY GLY A . n A 1 37 ARG 37 50 50 ARG ARG A . n A 1 38 ASN 38 51 51 ASN ASN A . n A 1 39 CYS 39 52 52 CYS CYS A . n A 1 40 ARG 40 53 53 ARG ARG A . n A 1 41 PHE 41 54 54 PHE PHE A . n A 1 42 LEU 42 55 55 LEU LEU A . n A 1 43 GLN 43 56 56 GLN GLN A . n A 1 44 GLY 44 57 57 GLY GLY A . n A 1 45 PRO 45 58 58 PRO PRO A . n A 1 46 ALA 46 59 59 ALA ALA A . n A 1 47 THR 47 60 60 THR THR A . n A 1 48 ASN 48 61 61 ASN ASN A . n A 1 49 PRO 49 62 62 PRO PRO A . n A 1 50 GLU 50 63 63 GLU GLU A . n A 1 51 THR 51 64 64 THR THR A . n A 1 52 VAL 52 65 65 VAL VAL A . n A 1 53 ALA 53 66 66 ALA ALA A . n A 1 54 ARG 54 67 67 ARG ARG A . n A 1 55 LEU 55 68 68 LEU LEU A . n A 1 56 ARG 56 69 69 ARG ARG A . n A 1 57 ARG 57 70 70 ARG ARG A . n A 1 58 ALA 58 71 71 ALA ALA A . n A 1 59 ILE 59 72 72 ILE ILE A . n A 1 60 HIS 60 73 73 HIS HIS A . n A 1 61 GLU 61 74 74 GLU GLU A . n A 1 62 GLY 62 75 75 GLY GLY A . n A 1 63 ARG 63 76 76 ARG ARG A . n A 1 64 PRO 64 77 77 PRO PRO A . n A 1 65 ALA 65 78 78 ALA ALA A . n A 1 66 HIS 66 79 79 HIS HIS A . n A 1 67 VAL 67 80 80 VAL VAL A . n A 1 68 LEU 68 81 81 LEU LEU A . n A 1 69 LEU 69 82 82 LEU LEU A . n A 1 70 LEU 70 83 83 LEU LEU A . n A 1 71 ASN 71 84 84 ASN ASN A . n A 1 72 TYR 72 85 85 TYR TYR A . n A 1 73 ARG 73 86 86 ARG ARG A . n A 1 74 LYS 74 87 87 LYS LYS A . n A 1 75 ASP 75 88 88 ASP ASP A . n A 1 76 GLY 76 89 89 GLY GLY A . n A 1 77 GLN 77 90 90 GLN GLN A . n A 1 78 PRO 78 91 91 PRO PRO A . n A 1 79 PHE 79 92 92 PHE PHE A . n A 1 80 TRP 80 93 93 TRP TRP A . n A 1 81 ASN 81 94 94 ASN ASN A . n A 1 82 ASP 82 95 95 ASP ASP A . n A 1 83 LEU 83 96 96 LEU LEU A . n A 1 84 ARG 84 97 97 ARG ARG A . n A 1 85 ILE 85 98 98 ILE ILE A . n A 1 86 ALA 86 99 99 ALA ALA A . n A 1 87 PRO 87 100 100 PRO PRO A . n A 1 88 VAL 88 101 101 VAL VAL A . n A 1 89 ARG 89 102 102 ARG ARG A . n A 1 90 ASP 90 103 103 ASP ASP A . n A 1 91 VAL 91 104 104 VAL VAL A . n A 1 92 GLU 92 105 105 GLU GLU A . n A 1 93 GLY 93 106 106 GLY GLY A . n A 1 94 ARG 94 107 107 ARG ARG A . n A 1 95 LEU 95 108 108 LEU LEU A . n A 1 96 THR 96 109 109 THR THR A . n A 1 97 HIS 97 110 110 HIS HIS A . n A 1 98 PHE 98 111 111 PHE PHE A . n A 1 99 VAL 99 112 112 VAL VAL A . n A 1 100 GLY 100 113 113 GLY GLY A . n A 1 101 ILE 101 114 114 ILE ILE A . n A 1 102 GLN 102 115 115 GLN GLN A . n A 1 103 SER 103 116 116 SER SER A . n A 1 104 ASP 104 117 117 ASP ASP A . n A 1 105 VAL 105 118 118 VAL VAL A . n A 1 106 SER 106 119 119 SER SER A . n A 1 107 HIS 107 120 ? ? ? A . n A 1 108 HIS 108 121 ? ? ? A . n A 1 109 HIS 109 122 ? ? ? A . n A 1 110 HIS 110 123 ? ? ? A . n A 1 111 HIS 111 124 ? ? ? A . n A 1 112 HIS 112 125 ? ? ? A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id FMN _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id FMN _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id FMN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 201 _pdbx_nonpoly_scheme.auth_seq_num 201 _pdbx_nonpoly_scheme.pdb_mon_id FMN _pdbx_nonpoly_scheme.auth_mon_id FMN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . ? 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? STARANISO ? ? ? . ? 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . ? 3 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0430 ? 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . ? 5 # _cell.angle_alpha 90.0000 _cell.angle_alpha_esd ? _cell.angle_beta 90.0000 _cell.angle_beta_esd ? _cell.angle_gamma 90.0000 _cell.angle_gamma_esd ? _cell.entry_id 9VF8 _cell.details ? _cell.formula_units_Z ? _cell.length_a 78.5930 _cell.length_a_esd ? _cell.length_b 78.5930 _cell.length_b_esd ? _cell.length_c 73.3810 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9VF8 _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9VF8 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 4.31 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 71.47 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M Ammonium sulfate 0.1 M Sodium cacodylate 6.5 30 % w/v PEG 8000' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER2 X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2023-05-27 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97918 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL17UM' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97918 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL17UM _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 9VF8 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.352 _reflns.d_resolution_low 44.303 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 2991 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 91.1 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 21.69 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 5.13 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.5432 _reflns.pdbx_Rpim_I_all 0.1174 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 64878 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.987 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.5299 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] 1.0000 _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] 0.0000 _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] 0.0000 _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] 0.0000 _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] 1.0000 _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] 0.0000 _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] 0.0000 _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] 0.0000 _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] 1.0000 _reflns.pdbx_aniso_diffraction_limit_1 3.347 _reflns.pdbx_aniso_diffraction_limit_2 3.347 _reflns.pdbx_aniso_diffraction_limit_3 3.680 _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] 1.0000 _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] 0.0000 _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] 0.0000 _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] 0.0000 _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] 1.0000 _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] 0.0000 _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] 0.0000 _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] 0.0000 _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] 1.0000 _reflns.pdbx_aniso_B_tensor_eigenvalue_1 0.0000 _reflns.pdbx_aniso_B_tensor_eigenvalue_2 0.0000 _reflns.pdbx_aniso_B_tensor_eigenvalue_3 39.6522 _reflns.pdbx_orthogonalization_convention pdb _reflns.pdbx_percent_possible_ellipsoidal 91.1 _reflns.pdbx_percent_possible_spherical 83.4 _reflns.pdbx_percent_possible_ellipsoidal_anomalous 89.9 _reflns.pdbx_percent_possible_spherical_anomalous 82.0 _reflns.pdbx_redundancy_anomalous 12.53 _reflns.pdbx_CC_half_anomalous 0.075 _reflns.pdbx_absDiff_over_sigma_anomalous 0.670 _reflns.pdbx_percent_possible_anomalous 89.9 _reflns.pdbx_observed_signal_threshold 1.20 _reflns.pdbx_signal_type 'local ' _reflns.pdbx_signal_details 'averaging_radius = 0.0808/Ang.' _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.percent_possible_all _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 7.077 44.303 ? 7.67 8118 8118 ? 426 426 ? ? ? ? ? ? ? ? ? ? ? 19.06 ? ? ? 0.1242 0.0280 ? 1 ? 0.989 ? ? 99.8 ? 0.1207 ? 99.8 99.8 99.6 99.6 12.45 0.059 0.359 99.6 5.539 7.077 ? 6.49 8959 8959 ? 428 428 ? ? ? ? ? ? ? ? ? ? ? 20.93 ? ? ? 0.2759 0.0609 ? 2 ? 0.995 ? ? 100.0 ? 0.2689 ? 100.0 100.0 100.0 100.0 12.26 0.155 0.488 100.0 4.807 5.539 ? 7.02 8708 8708 ? 427 427 ? ? ? ? ? ? ? ? ? ? ? 20.39 ? ? ? 0.4268 0.0974 ? 3 ? 0.984 ? ? 100.0 ? 0.4151 ? 100.0 100.0 100.0 100.0 11.73 -0.001 0.579 100.0 4.336 4.807 ? 6.52 9202 9202 ? 427 427 ? ? ? ? ? ? ? ? ? ? ? 21.55 ? ? ? 0.6608 0.1460 ? 4 ? 0.984 ? ? 99.8 ? 0.6439 ? 99.8 99.8 100.0 100.0 12.08 0.184 0.742 100.0 4.016 4.336 ? 4.59 9768 9768 ? 428 428 ? ? ? ? ? ? ? ? ? ? ? 22.82 ? ? ? 1.0703 0.2264 ? 5 ? 0.955 ? ? 100.0 ? 1.0453 ? 100.0 100.0 100.0 100.0 12.75 0.050 0.819 100.0 3.767 4.016 ? 2.30 10392 10392 ? 430 430 ? ? ? ? ? ? ? ? ? ? ? 24.17 ? ? ? 2.3864 0.4847 ? 6 ? 0.878 ? ? 99.8 ? 2.3350 ? 99.8 99.8 99.7 99.7 13.43 -0.047 0.815 99.7 3.352 3.767 ? 1.34 9731 9731 ? 425 425 ? ? ? ? ? ? ? ? ? ? ? 22.90 ? ? ? 4.2668 0.8687 ? 7 ? 0.847 ? ? 59.4 ? 4.1742 ? 59.4 41.9 58.1 41.3 12.86 -0.184 0.768 58.1 # _refine.aniso_B[1][1] -0.749 _refine.aniso_B[1][2] 0.000 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][2] -0.749 _refine.aniso_B[2][3] 0.000 _refine.aniso_B[3][3] 1.499 _refine.B_iso_max ? _refine.B_iso_mean 83.668 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.910 _refine.correlation_coeff_Fo_to_Fc_free 0.871 _refine.details 'Hydrogens have been added in their riding positions' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9VF8 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.352 _refine.ls_d_res_low 44.303 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 2991 _refine.ls_number_reflns_R_free 134 _refine.ls_number_reflns_R_work 2857 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 83.292 _refine.ls_percent_reflns_R_free 4.480 _refine.ls_R_factor_all 0.244 _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.2721 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2422 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'MASK BULK SOLVENT' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free 0.540 _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 33.250 _refine.overall_SU_ML 0.503 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 3.352 _refine_hist.d_res_low 44.303 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 860 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 829 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 31 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.002 0.012 883 ? r_bond_refined_d ? ? ? 'X-RAY DIFFRACTION' ? 0.000 0.016 820 ? r_bond_other_d ? ? ? 'X-RAY DIFFRACTION' ? 1.057 1.815 1210 ? r_angle_refined_deg ? ? ? 'X-RAY DIFFRACTION' ? 0.315 1.749 1875 ? r_angle_other_deg ? ? ? 'X-RAY DIFFRACTION' ? 3.352 5.000 104 ? r_dihedral_angle_1_deg ? ? ? 'X-RAY DIFFRACTION' ? 1.338 5.000 10 ? r_dihedral_angle_2_deg ? ? ? 'X-RAY DIFFRACTION' ? 9.984 10.000 128 ? r_dihedral_angle_3_deg ? ? ? 'X-RAY DIFFRACTION' ? 6.739 10.000 43 ? r_dihedral_angle_6_deg ? ? ? 'X-RAY DIFFRACTION' ? 0.037 0.200 131 ? r_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 1070 ? r_gen_planes_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.000 0.020 216 ? r_gen_planes_other ? ? ? 'X-RAY DIFFRACTION' ? 0.214 0.200 184 ? r_nbd_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.254 0.200 782 ? r_symmetry_nbd_other ? ? ? 'X-RAY DIFFRACTION' ? 0.185 0.200 444 ? r_nbtor_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.083 0.200 428 ? r_symmetry_nbtor_other ? ? ? 'X-RAY DIFFRACTION' ? 0.187 0.200 11 ? r_xyhbond_nbd_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.040 0.200 1 ? r_symmetry_xyhbond_nbd_other ? ? ? 'X-RAY DIFFRACTION' ? 0.241 0.200 12 ? r_symmetry_nbd_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.219 0.200 71 ? r_nbd_other ? ? ? 'X-RAY DIFFRACTION' ? 13.027 7.924 419 ? r_mcbond_it ? ? ? 'X-RAY DIFFRACTION' ? 13.024 7.924 419 ? r_mcbond_other ? ? ? 'X-RAY DIFFRACTION' ? 19.237 14.295 522 ? r_mcangle_it ? ? ? 'X-RAY DIFFRACTION' ? 19.219 14.301 523 ? r_mcangle_other ? ? ? 'X-RAY DIFFRACTION' ? 12.835 8.659 464 ? r_scbond_it ? ? ? 'X-RAY DIFFRACTION' ? 12.815 8.660 461 ? r_scbond_other ? ? ? 'X-RAY DIFFRACTION' ? 19.433 15.444 688 ? r_scangle_it ? ? ? 'X-RAY DIFFRACTION' ? 19.419 15.435 689 ? r_scangle_other ? ? ? 'X-RAY DIFFRACTION' ? 24.524 83.813 1018 ? r_lrange_it ? ? ? 'X-RAY DIFFRACTION' ? 24.513 83.779 1019 ? r_lrange_other ? ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 3.352 3.439 . . 0 29 11.5538 . . . . 0.643 . . . . . . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.439 3.532 . . 3 61 25.9109 . . . . 0.533 . . . . . . . . . . . . . . . 0.593 'X-RAY DIFFRACTION' 3.532 3.634 . . 3 97 41.8410 . . . . 0.486 . . . . . . . . . . . . . . . 0.665 'X-RAY DIFFRACTION' 3.634 3.745 . . 6 190 80.6584 . . . . 0.469 . . . . . . . . . . . . . . . 0.345 'X-RAY DIFFRACTION' 3.745 3.867 . . 11 212 98.2379 . . . . 0.443 . . . . . . . . . . . . . . . 0.552 'X-RAY DIFFRACTION' 3.867 4.002 . . 11 216 100.0000 . . . . 0.360 . . . . . . . . . . . . . . . 0.137 'X-RAY DIFFRACTION' 4.002 4.152 . . 15 198 100.0000 . . . . 0.298 . . . . . . . . . . . . . . . 0.358 'X-RAY DIFFRACTION' 4.152 4.320 . . 8 203 100.0000 . . . . 0.234 . . . . . . . . . . . . . . . 0.415 'X-RAY DIFFRACTION' 4.320 4.510 . . 9 184 99.4845 . . . . 0.217 . . . . . . . . . . . . . . . 0.247 'X-RAY DIFFRACTION' 4.510 4.727 . . 12 181 100.0000 . . . . 0.223 . . . . . . . . . . . . . . . 0.286 'X-RAY DIFFRACTION' 4.727 4.980 . . 11 181 100.0000 . . . . 0.179 . . . . . . . . . . . . . . . 0.192 'X-RAY DIFFRACTION' 4.980 5.278 . . 9 164 100.0000 . . . . 0.192 . . . . . . . . . . . . . . . 0.222 'X-RAY DIFFRACTION' 5.278 5.636 . . 3 165 100.0000 . . . . 0.182 . . . . . . . . . . . . . . . 0.149 'X-RAY DIFFRACTION' 5.636 6.080 . . 9 144 100.0000 . . . . 0.221 . . . . . . . . . . . . . . . 0.217 'X-RAY DIFFRACTION' 6.080 6.648 . . 7 143 100.0000 . . . . 0.245 . . . . . . . . . . . . . . . 0.280 'X-RAY DIFFRACTION' 6.648 7.412 . . 6 126 100.0000 . . . . 0.206 . . . . . . . . . . . . . . . 0.315 'X-RAY DIFFRACTION' 7.412 8.519 . . 5 114 100.0000 . . . . 0.203 . . . . . . . . . . . . . . . 0.433 'X-RAY DIFFRACTION' 8.519 10.338 . . 6 103 100.0000 . . . . 0.164 . . . . . . . . . . . . . . . 0.232 'X-RAY DIFFRACTION' 10.338 14.239 . . 0 86 100.0000 . . . . 0.203 . . . . . . . . . . . . . . . . 'X-RAY DIFFRACTION' 14.239 44.303 . . 0 60 96.7742 . . . . 0.421 . . . . . . . . . . . . . . . . # _struct.entry_id 9VF8 _struct.title 'Structure of Meiothermus ruber Mrub_1259 LOV domain (MrLOV)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9VF8 _struct_keywords.text 'LOV, FMN, photoreceptor, fluorescent protein, flavoprotein' _struct_keywords.pdbx_keywords 'FLUORESCENT PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code D3PRD8_MEIRD _struct_ref.pdbx_db_accession D3PRD8 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;AGVVITDAQLPDYPIVYCNPGFVQLTGYPSEEVLGRNCRFLQGPATNPETVARLRRAIHEGRPAHVLLLNYRKDGQPFWN DLRIAPVRDVEGRLTHFVGIQSDVS ; _struct_ref.pdbx_align_begin 15 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9VF8 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 106 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession D3PRD8 _struct_ref_seq.db_align_beg 15 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 119 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 15 _struct_ref_seq.pdbx_auth_seq_align_end 119 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9VF8 MET A 1 ? UNP D3PRD8 ? ? 'initiating methionine' 14 1 1 9VF8 HIS A 107 ? UNP D3PRD8 ? ? 'expression tag' 120 2 1 9VF8 HIS A 108 ? UNP D3PRD8 ? ? 'expression tag' 121 3 1 9VF8 HIS A 109 ? UNP D3PRD8 ? ? 'expression tag' 122 4 1 9VF8 HIS A 110 ? UNP D3PRD8 ? ? 'expression tag' 123 5 1 9VF8 HIS A 111 ? UNP D3PRD8 ? ? 'expression tag' 124 6 1 9VF8 HIS A 112 ? UNP D3PRD8 ? ? 'expression tag' 125 7 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3260 ? 1 MORE -22 ? 1 'SSA (A^2)' 10260 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 8_554 -y,-x,-z-1/2 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -36.6905000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 20 ? GLY A 28 ? ASN A 33 GLY A 41 1 ? 9 HELX_P HELX_P2 AA2 PRO A 30 ? VAL A 34 ? PRO A 43 VAL A 47 5 ? 5 HELX_P HELX_P3 AA3 ASN A 38 ? GLN A 43 ? ASN A 51 GLN A 56 5 ? 6 HELX_P HELX_P4 AA4 ASN A 48 ? GLY A 62 ? ASN A 61 GLY A 75 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 16 ? CYS A 19 ? ILE A 29 CYS A 32 AA1 2 GLY A 3 ? ASP A 8 ? GLY A 16 ASP A 21 AA1 3 LEU A 95 ? GLN A 102 ? LEU A 108 GLN A 115 AA1 4 PRO A 78 ? ARG A 89 ? PRO A 91 ARG A 102 AA1 5 ALA A 65 ? TYR A 72 ? ALA A 78 TYR A 85 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O VAL A 17 ? O VAL A 30 N ILE A 6 ? N ILE A 19 AA1 2 3 N VAL A 5 ? N VAL A 18 O GLY A 100 ? O GLY A 113 AA1 3 4 O HIS A 97 ? O HIS A 110 N VAL A 88 ? N VAL A 101 AA1 4 5 O PHE A 79 ? O PHE A 92 N ASN A 71 ? N ASN A 84 # _pdbx_entry_details.entry_id 9VF8 _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 26 ? ? 84.86 -22.64 2 1 TYR A 27 ? ? 63.39 71.97 3 1 TYR A 31 ? ? -170.18 139.85 4 1 CYS A 52 ? ? -68.10 19.41 5 1 ARG A 86 ? ? -62.44 -175.62 6 1 ASP A 103 ? ? -101.57 -146.08 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 14 ? A MET 1 2 1 Y 1 A HIS 120 ? A HIS 107 3 1 Y 1 A HIS 121 ? A HIS 108 4 1 Y 1 A HIS 122 ? A HIS 109 5 1 Y 1 A HIS 123 ? A HIS 110 6 1 Y 1 A HIS 124 ? A HIS 111 7 1 Y 1 A HIS 125 ? A HIS 112 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 FMN N1 N N N 88 FMN C2 C N N 89 FMN O2 O N N 90 FMN N3 N N N 91 FMN C4 C N N 92 FMN O4 O N N 93 FMN C4A C N N 94 FMN N5 N N N 95 FMN C5A C Y N 96 FMN C6 C Y N 97 FMN C7 C Y N 98 FMN C7M C N N 99 FMN C8 C Y N 100 FMN C8M C N N 101 FMN C9 C Y N 102 FMN C9A C Y N 103 FMN N10 N N N 104 FMN C10 C N N 105 FMN "C1'" C N N 106 FMN "C2'" C N S 107 FMN "O2'" O N N 108 FMN "C3'" C N S 109 FMN "O3'" O N N 110 FMN "C4'" C N R 111 FMN "O4'" O N N 112 FMN "C5'" C N N 113 FMN "O5'" O N N 114 FMN P P N N 115 FMN O1P O N N 116 FMN O2P O N N 117 FMN O3P O N N 118 FMN HN3 H N N 119 FMN H6 H N N 120 FMN HM71 H N N 121 FMN HM72 H N N 122 FMN HM73 H N N 123 FMN HM81 H N N 124 FMN HM82 H N N 125 FMN HM83 H N N 126 FMN H9 H N N 127 FMN "H1'1" H N N 128 FMN "H1'2" H N N 129 FMN "H2'" H N N 130 FMN "HO2'" H N N 131 FMN "H3'" H N N 132 FMN "HO3'" H N N 133 FMN "H4'" H N N 134 FMN "HO4'" H N N 135 FMN "H5'1" H N N 136 FMN "H5'2" H N N 137 FMN HOP2 H N N 138 FMN HOP3 H N N 139 GLN N N N N 140 GLN CA C N S 141 GLN C C N N 142 GLN O O N N 143 GLN CB C N N 144 GLN CG C N N 145 GLN CD C N N 146 GLN OE1 O N N 147 GLN NE2 N N N 148 GLN OXT O N N 149 GLN H H N N 150 GLN H2 H N N 151 GLN HA H N N 152 GLN HB2 H N N 153 GLN HB3 H N N 154 GLN HG2 H N N 155 GLN HG3 H N N 156 GLN HE21 H N N 157 GLN HE22 H N N 158 GLN HXT H N N 159 GLU N N N N 160 GLU CA C N S 161 GLU C C N N 162 GLU O O N N 163 GLU CB C N N 164 GLU CG C N N 165 GLU CD C N N 166 GLU OE1 O N N 167 GLU OE2 O N N 168 GLU OXT O N N 169 GLU H H N N 170 GLU H2 H N N 171 GLU HA H N N 172 GLU HB2 H N N 173 GLU HB3 H N N 174 GLU HG2 H N N 175 GLU HG3 H N N 176 GLU HE2 H N N 177 GLU HXT H N N 178 GLY N N N N 179 GLY CA C N N 180 GLY C C N N 181 GLY O O N N 182 GLY OXT O N N 183 GLY H H N N 184 GLY H2 H N N 185 GLY HA2 H N N 186 GLY HA3 H N N 187 GLY HXT H N N 188 HIS N N N N 189 HIS CA C N S 190 HIS C C N N 191 HIS O O N N 192 HIS CB C N N 193 HIS CG C Y N 194 HIS ND1 N Y N 195 HIS CD2 C Y N 196 HIS CE1 C Y N 197 HIS NE2 N Y N 198 HIS OXT O N N 199 HIS H H N N 200 HIS H2 H N N 201 HIS HA H N N 202 HIS HB2 H N N 203 HIS HB3 H N N 204 HIS HD1 H N N 205 HIS HD2 H N N 206 HIS HE1 H N N 207 HIS HE2 H N N 208 HIS HXT H N N 209 ILE N N N N 210 ILE CA C N S 211 ILE C C N N 212 ILE O O N N 213 ILE CB C N S 214 ILE CG1 C N N 215 ILE CG2 C N N 216 ILE CD1 C N N 217 ILE OXT O N N 218 ILE H H N N 219 ILE H2 H N N 220 ILE HA H N N 221 ILE HB H N N 222 ILE HG12 H N N 223 ILE HG13 H N N 224 ILE HG21 H N N 225 ILE HG22 H N N 226 ILE HG23 H N N 227 ILE HD11 H N N 228 ILE HD12 H N N 229 ILE HD13 H N N 230 ILE HXT H N N 231 LEU N N N N 232 LEU CA C N S 233 LEU C C N N 234 LEU O O N N 235 LEU CB C N N 236 LEU CG C N N 237 LEU CD1 C N N 238 LEU CD2 C N N 239 LEU OXT O N N 240 LEU H H N N 241 LEU H2 H N N 242 LEU HA H N N 243 LEU HB2 H N N 244 LEU HB3 H N N 245 LEU HG H N N 246 LEU HD11 H N N 247 LEU HD12 H N N 248 LEU HD13 H N N 249 LEU HD21 H N N 250 LEU HD22 H N N 251 LEU HD23 H N N 252 LEU HXT H N N 253 LYS N N N N 254 LYS CA C N S 255 LYS C C N N 256 LYS O O N N 257 LYS CB C N N 258 LYS CG C N N 259 LYS CD C N N 260 LYS CE C N N 261 LYS NZ N N N 262 LYS OXT O N N 263 LYS H H N N 264 LYS H2 H N N 265 LYS HA H N N 266 LYS HB2 H N N 267 LYS HB3 H N N 268 LYS HG2 H N N 269 LYS HG3 H N N 270 LYS HD2 H N N 271 LYS HD3 H N N 272 LYS HE2 H N N 273 LYS HE3 H N N 274 LYS HZ1 H N N 275 LYS HZ2 H N N 276 LYS HZ3 H N N 277 LYS HXT H N N 278 MET N N N N 279 MET CA C N S 280 MET C C N N 281 MET O O N N 282 MET CB C N N 283 MET CG C N N 284 MET SD S N N 285 MET CE C N N 286 MET OXT O N N 287 MET H H N N 288 MET H2 H N N 289 MET HA H N N 290 MET HB2 H N N 291 MET HB3 H N N 292 MET HG2 H N N 293 MET HG3 H N N 294 MET HE1 H N N 295 MET HE2 H N N 296 MET HE3 H N N 297 MET HXT H N N 298 PHE N N N N 299 PHE CA C N S 300 PHE C C N N 301 PHE O O N N 302 PHE CB C N N 303 PHE CG C Y N 304 PHE CD1 C Y N 305 PHE CD2 C Y N 306 PHE CE1 C Y N 307 PHE CE2 C Y N 308 PHE CZ C Y N 309 PHE OXT O N N 310 PHE H H N N 311 PHE H2 H N N 312 PHE HA H N N 313 PHE HB2 H N N 314 PHE HB3 H N N 315 PHE HD1 H N N 316 PHE HD2 H N N 317 PHE HE1 H N N 318 PHE HE2 H N N 319 PHE HZ H N N 320 PHE HXT H N N 321 PRO N N N N 322 PRO CA C N S 323 PRO C C N N 324 PRO O O N N 325 PRO CB C N N 326 PRO CG C N N 327 PRO CD C N N 328 PRO OXT O N N 329 PRO H H N N 330 PRO HA H N N 331 PRO HB2 H N N 332 PRO HB3 H N N 333 PRO HG2 H N N 334 PRO HG3 H N N 335 PRO HD2 H N N 336 PRO HD3 H N N 337 PRO HXT H N N 338 SER N N N N 339 SER CA C N S 340 SER C C N N 341 SER O O N N 342 SER CB C N N 343 SER OG O N N 344 SER OXT O N N 345 SER H H N N 346 SER H2 H N N 347 SER HA H N N 348 SER HB2 H N N 349 SER HB3 H N N 350 SER HG H N N 351 SER HXT H N N 352 THR N N N N 353 THR CA C N S 354 THR C C N N 355 THR O O N N 356 THR CB C N R 357 THR OG1 O N N 358 THR CG2 C N N 359 THR OXT O N N 360 THR H H N N 361 THR H2 H N N 362 THR HA H N N 363 THR HB H N N 364 THR HG1 H N N 365 THR HG21 H N N 366 THR HG22 H N N 367 THR HG23 H N N 368 THR HXT H N N 369 TRP N N N N 370 TRP CA C N S 371 TRP C C N N 372 TRP O O N N 373 TRP CB C N N 374 TRP CG C Y N 375 TRP CD1 C Y N 376 TRP CD2 C Y N 377 TRP NE1 N Y N 378 TRP CE2 C Y N 379 TRP CE3 C Y N 380 TRP CZ2 C Y N 381 TRP CZ3 C Y N 382 TRP CH2 C Y N 383 TRP OXT O N N 384 TRP H H N N 385 TRP H2 H N N 386 TRP HA H N N 387 TRP HB2 H N N 388 TRP HB3 H N N 389 TRP HD1 H N N 390 TRP HE1 H N N 391 TRP HE3 H N N 392 TRP HZ2 H N N 393 TRP HZ3 H N N 394 TRP HH2 H N N 395 TRP HXT H N N 396 TYR N N N N 397 TYR CA C N S 398 TYR C C N N 399 TYR O O N N 400 TYR CB C N N 401 TYR CG C Y N 402 TYR CD1 C Y N 403 TYR CD2 C Y N 404 TYR CE1 C Y N 405 TYR CE2 C Y N 406 TYR CZ C Y N 407 TYR OH O N N 408 TYR OXT O N N 409 TYR H H N N 410 TYR H2 H N N 411 TYR HA H N N 412 TYR HB2 H N N 413 TYR HB3 H N N 414 TYR HD1 H N N 415 TYR HD2 H N N 416 TYR HE1 H N N 417 TYR HE2 H N N 418 TYR HH H N N 419 TYR HXT H N N 420 VAL N N N N 421 VAL CA C N S 422 VAL C C N N 423 VAL O O N N 424 VAL CB C N N 425 VAL CG1 C N N 426 VAL CG2 C N N 427 VAL OXT O N N 428 VAL H H N N 429 VAL H2 H N N 430 VAL HA H N N 431 VAL HB H N N 432 VAL HG11 H N N 433 VAL HG12 H N N 434 VAL HG13 H N N 435 VAL HG21 H N N 436 VAL HG22 H N N 437 VAL HG23 H N N 438 VAL HXT H N N 439 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 FMN N1 C2 sing N N 83 FMN N1 C10 doub N N 84 FMN C2 O2 doub N N 85 FMN C2 N3 sing N N 86 FMN N3 C4 sing N N 87 FMN N3 HN3 sing N N 88 FMN C4 O4 doub N N 89 FMN C4 C4A sing N N 90 FMN C4A N5 doub N N 91 FMN C4A C10 sing N N 92 FMN N5 C5A sing N N 93 FMN C5A C6 doub Y N 94 FMN C5A C9A sing Y N 95 FMN C6 C7 sing Y N 96 FMN C6 H6 sing N N 97 FMN C7 C7M sing N N 98 FMN C7 C8 doub Y N 99 FMN C7M HM71 sing N N 100 FMN C7M HM72 sing N N 101 FMN C7M HM73 sing N N 102 FMN C8 C8M sing N N 103 FMN C8 C9 sing Y N 104 FMN C8M HM81 sing N N 105 FMN C8M HM82 sing N N 106 FMN C8M HM83 sing N N 107 FMN C9 C9A doub Y N 108 FMN C9 H9 sing N N 109 FMN C9A N10 sing N N 110 FMN N10 C10 sing N N 111 FMN N10 "C1'" sing N N 112 FMN "C1'" "C2'" sing N N 113 FMN "C1'" "H1'1" sing N N 114 FMN "C1'" "H1'2" sing N N 115 FMN "C2'" "O2'" sing N N 116 FMN "C2'" "C3'" sing N N 117 FMN "C2'" "H2'" sing N N 118 FMN "O2'" "HO2'" sing N N 119 FMN "C3'" "O3'" sing N N 120 FMN "C3'" "C4'" sing N N 121 FMN "C3'" "H3'" sing N N 122 FMN "O3'" "HO3'" sing N N 123 FMN "C4'" "O4'" sing N N 124 FMN "C4'" "C5'" sing N N 125 FMN "C4'" "H4'" sing N N 126 FMN "O4'" "HO4'" sing N N 127 FMN "C5'" "O5'" sing N N 128 FMN "C5'" "H5'1" sing N N 129 FMN "C5'" "H5'2" sing N N 130 FMN "O5'" P sing N N 131 FMN P O1P doub N N 132 FMN P O2P sing N N 133 FMN P O3P sing N N 134 FMN O2P HOP2 sing N N 135 FMN O3P HOP3 sing N N 136 GLN N CA sing N N 137 GLN N H sing N N 138 GLN N H2 sing N N 139 GLN CA C sing N N 140 GLN CA CB sing N N 141 GLN CA HA sing N N 142 GLN C O doub N N 143 GLN C OXT sing N N 144 GLN CB CG sing N N 145 GLN CB HB2 sing N N 146 GLN CB HB3 sing N N 147 GLN CG CD sing N N 148 GLN CG HG2 sing N N 149 GLN CG HG3 sing N N 150 GLN CD OE1 doub N N 151 GLN CD NE2 sing N N 152 GLN NE2 HE21 sing N N 153 GLN NE2 HE22 sing N N 154 GLN OXT HXT sing N N 155 GLU N CA sing N N 156 GLU N H sing N N 157 GLU N H2 sing N N 158 GLU CA C sing N N 159 GLU CA CB sing N N 160 GLU CA HA sing N N 161 GLU C O doub N N 162 GLU C OXT sing N N 163 GLU CB CG sing N N 164 GLU CB HB2 sing N N 165 GLU CB HB3 sing N N 166 GLU CG CD sing N N 167 GLU CG HG2 sing N N 168 GLU CG HG3 sing N N 169 GLU CD OE1 doub N N 170 GLU CD OE2 sing N N 171 GLU OE2 HE2 sing N N 172 GLU OXT HXT sing N N 173 GLY N CA sing N N 174 GLY N H sing N N 175 GLY N H2 sing N N 176 GLY CA C sing N N 177 GLY CA HA2 sing N N 178 GLY CA HA3 sing N N 179 GLY C O doub N N 180 GLY C OXT sing N N 181 GLY OXT HXT sing N N 182 HIS N CA sing N N 183 HIS N H sing N N 184 HIS N H2 sing N N 185 HIS CA C sing N N 186 HIS CA CB sing N N 187 HIS CA HA sing N N 188 HIS C O doub N N 189 HIS C OXT sing N N 190 HIS CB CG sing N N 191 HIS CB HB2 sing N N 192 HIS CB HB3 sing N N 193 HIS CG ND1 sing Y N 194 HIS CG CD2 doub Y N 195 HIS ND1 CE1 doub Y N 196 HIS ND1 HD1 sing N N 197 HIS CD2 NE2 sing Y N 198 HIS CD2 HD2 sing N N 199 HIS CE1 NE2 sing Y N 200 HIS CE1 HE1 sing N N 201 HIS NE2 HE2 sing N N 202 HIS OXT HXT sing N N 203 ILE N CA sing N N 204 ILE N H sing N N 205 ILE N H2 sing N N 206 ILE CA C sing N N 207 ILE CA CB sing N N 208 ILE CA HA sing N N 209 ILE C O doub N N 210 ILE C OXT sing N N 211 ILE CB CG1 sing N N 212 ILE CB CG2 sing N N 213 ILE CB HB sing N N 214 ILE CG1 CD1 sing N N 215 ILE CG1 HG12 sing N N 216 ILE CG1 HG13 sing N N 217 ILE CG2 HG21 sing N N 218 ILE CG2 HG22 sing N N 219 ILE CG2 HG23 sing N N 220 ILE CD1 HD11 sing N N 221 ILE CD1 HD12 sing N N 222 ILE CD1 HD13 sing N N 223 ILE OXT HXT sing N N 224 LEU N CA sing N N 225 LEU N H sing N N 226 LEU N H2 sing N N 227 LEU CA C sing N N 228 LEU CA CB sing N N 229 LEU CA HA sing N N 230 LEU C O doub N N 231 LEU C OXT sing N N 232 LEU CB CG sing N N 233 LEU CB HB2 sing N N 234 LEU CB HB3 sing N N 235 LEU CG CD1 sing N N 236 LEU CG CD2 sing N N 237 LEU CG HG sing N N 238 LEU CD1 HD11 sing N N 239 LEU CD1 HD12 sing N N 240 LEU CD1 HD13 sing N N 241 LEU CD2 HD21 sing N N 242 LEU CD2 HD22 sing N N 243 LEU CD2 HD23 sing N N 244 LEU OXT HXT sing N N 245 LYS N CA sing N N 246 LYS N H sing N N 247 LYS N H2 sing N N 248 LYS CA C sing N N 249 LYS CA CB sing N N 250 LYS CA HA sing N N 251 LYS C O doub N N 252 LYS C OXT sing N N 253 LYS CB CG sing N N 254 LYS CB HB2 sing N N 255 LYS CB HB3 sing N N 256 LYS CG CD sing N N 257 LYS CG HG2 sing N N 258 LYS CG HG3 sing N N 259 LYS CD CE sing N N 260 LYS CD HD2 sing N N 261 LYS CD HD3 sing N N 262 LYS CE NZ sing N N 263 LYS CE HE2 sing N N 264 LYS CE HE3 sing N N 265 LYS NZ HZ1 sing N N 266 LYS NZ HZ2 sing N N 267 LYS NZ HZ3 sing N N 268 LYS OXT HXT sing N N 269 MET N CA sing N N 270 MET N H sing N N 271 MET N H2 sing N N 272 MET CA C sing N N 273 MET CA CB sing N N 274 MET CA HA sing N N 275 MET C O doub N N 276 MET C OXT sing N N 277 MET CB CG sing N N 278 MET CB HB2 sing N N 279 MET CB HB3 sing N N 280 MET CG SD sing N N 281 MET CG HG2 sing N N 282 MET CG HG3 sing N N 283 MET SD CE sing N N 284 MET CE HE1 sing N N 285 MET CE HE2 sing N N 286 MET CE HE3 sing N N 287 MET OXT HXT sing N N 288 PHE N CA sing N N 289 PHE N H sing N N 290 PHE N H2 sing N N 291 PHE CA C sing N N 292 PHE CA CB sing N N 293 PHE CA HA sing N N 294 PHE C O doub N N 295 PHE C OXT sing N N 296 PHE CB CG sing N N 297 PHE CB HB2 sing N N 298 PHE CB HB3 sing N N 299 PHE CG CD1 doub Y N 300 PHE CG CD2 sing Y N 301 PHE CD1 CE1 sing Y N 302 PHE CD1 HD1 sing N N 303 PHE CD2 CE2 doub Y N 304 PHE CD2 HD2 sing N N 305 PHE CE1 CZ doub Y N 306 PHE CE1 HE1 sing N N 307 PHE CE2 CZ sing Y N 308 PHE CE2 HE2 sing N N 309 PHE CZ HZ sing N N 310 PHE OXT HXT sing N N 311 PRO N CA sing N N 312 PRO N CD sing N N 313 PRO N H sing N N 314 PRO CA C sing N N 315 PRO CA CB sing N N 316 PRO CA HA sing N N 317 PRO C O doub N N 318 PRO C OXT sing N N 319 PRO CB CG sing N N 320 PRO CB HB2 sing N N 321 PRO CB HB3 sing N N 322 PRO CG CD sing N N 323 PRO CG HG2 sing N N 324 PRO CG HG3 sing N N 325 PRO CD HD2 sing N N 326 PRO CD HD3 sing N N 327 PRO OXT HXT sing N N 328 SER N CA sing N N 329 SER N H sing N N 330 SER N H2 sing N N 331 SER CA C sing N N 332 SER CA CB sing N N 333 SER CA HA sing N N 334 SER C O doub N N 335 SER C OXT sing N N 336 SER CB OG sing N N 337 SER CB HB2 sing N N 338 SER CB HB3 sing N N 339 SER OG HG sing N N 340 SER OXT HXT sing N N 341 THR N CA sing N N 342 THR N H sing N N 343 THR N H2 sing N N 344 THR CA C sing N N 345 THR CA CB sing N N 346 THR CA HA sing N N 347 THR C O doub N N 348 THR C OXT sing N N 349 THR CB OG1 sing N N 350 THR CB CG2 sing N N 351 THR CB HB sing N N 352 THR OG1 HG1 sing N N 353 THR CG2 HG21 sing N N 354 THR CG2 HG22 sing N N 355 THR CG2 HG23 sing N N 356 THR OXT HXT sing N N 357 TRP N CA sing N N 358 TRP N H sing N N 359 TRP N H2 sing N N 360 TRP CA C sing N N 361 TRP CA CB sing N N 362 TRP CA HA sing N N 363 TRP C O doub N N 364 TRP C OXT sing N N 365 TRP CB CG sing N N 366 TRP CB HB2 sing N N 367 TRP CB HB3 sing N N 368 TRP CG CD1 doub Y N 369 TRP CG CD2 sing Y N 370 TRP CD1 NE1 sing Y N 371 TRP CD1 HD1 sing N N 372 TRP CD2 CE2 doub Y N 373 TRP CD2 CE3 sing Y N 374 TRP NE1 CE2 sing Y N 375 TRP NE1 HE1 sing N N 376 TRP CE2 CZ2 sing Y N 377 TRP CE3 CZ3 doub Y N 378 TRP CE3 HE3 sing N N 379 TRP CZ2 CH2 doub Y N 380 TRP CZ2 HZ2 sing N N 381 TRP CZ3 CH2 sing Y N 382 TRP CZ3 HZ3 sing N N 383 TRP CH2 HH2 sing N N 384 TRP OXT HXT sing N N 385 TYR N CA sing N N 386 TYR N H sing N N 387 TYR N H2 sing N N 388 TYR CA C sing N N 389 TYR CA CB sing N N 390 TYR CA HA sing N N 391 TYR C O doub N N 392 TYR C OXT sing N N 393 TYR CB CG sing N N 394 TYR CB HB2 sing N N 395 TYR CB HB3 sing N N 396 TYR CG CD1 doub Y N 397 TYR CG CD2 sing Y N 398 TYR CD1 CE1 sing Y N 399 TYR CD1 HD1 sing N N 400 TYR CD2 CE2 doub Y N 401 TYR CD2 HD2 sing N N 402 TYR CE1 CZ doub Y N 403 TYR CE1 HE1 sing N N 404 TYR CE2 CZ sing Y N 405 TYR CE2 HE2 sing N N 406 TYR CZ OH sing N N 407 TYR OH HH sing N N 408 TYR OXT HXT sing N N 409 VAL N CA sing N N 410 VAL N H sing N N 411 VAL N H2 sing N N 412 VAL CA C sing N N 413 VAL CA CB sing N N 414 VAL CA HA sing N N 415 VAL C O doub N N 416 VAL C OXT sing N N 417 VAL CB CG1 sing N N 418 VAL CB CG2 sing N N 419 VAL CB HB sing N N 420 VAL CG1 HG11 sing N N 421 VAL CG1 HG12 sing N N 422 VAL CG1 HG13 sing N N 423 VAL CG2 HG21 sing N N 424 VAL CG2 HG22 sing N N 425 VAL CG2 HG23 sing N N 426 VAL OXT HXT sing N N 427 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'in silico model' _pdbx_initial_refinement_model.source_name AlphaFold _pdbx_initial_refinement_model.accession_code AF-D3PRD8-F1 _pdbx_initial_refinement_model.details 'residues 15-119' # _atom_sites.entry_id 9VF8 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.012724 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012724 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013628 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.pdbx_scat_Z _atom_type.pdbx_N_electrons _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c C 6 6 2.3103 20.8439 1.0201 10.2075 1.5888 0.5687 0.8651 51.6512 0.2156 H 1 1 0.4930 10.5109 0.3229 26.1257 0.1402 3.1424 0.0408 57.7997 0.0030 N 7 7 12.2220 0.0057 3.1346 9.8933 2.0141 28.9975 1.1672 0.5826 -11.5379 O 8 8 3.0487 13.2771 2.2870 5.7011 1.5464 0.3239 0.8671 32.9089 0.2508 O-1 8 9 4.1952 12.8573 1.6411 4.1724 1.5281 47.0179 -20.3246 -0.0140 21.9602 P 15 15 6.4348 1.9067 4.1793 27.1570 1.7801 0.5260 1.4909 68.1645 1.2678 S 16 16 6.9054 1.4679 5.2035 22.2151 1.4379 0.2536 1.5863 56.1720 1.0495 # loop_ #