data_9VQ1 # _entry.id 9VQ1 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.409 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9VQ1 pdb_00009vq1 10.2210/pdb9vq1/pdb WWPDB D_1300061208 ? ? BMRB 36770 ? 10.13018/BMR36770 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-02-11 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr . _pdbx_database_status.entry_id 9VQ1 _pdbx_database_status.recvd_initial_deposition_date 2025-07-04 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBC _pdbx_database_status.status_code_cs . _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'NMR solution structures of BRD4 ET domain in complex with ASXL1 peptide' _pdbx_database_related.db_id 36770 _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email leizeng@jlu.edu.cn _pdbx_contact_author.name_first Zeng _pdbx_contact_author.name_last Lei _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-4236-6735 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Zeng, L.' 1 ? 'Zhou, M.-M.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Recruitment of BRD4 to the ASXL1 genomic targets depends on the extra-terminal domain of BRD4' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Selvam, K.' 1 ? primary 'Lu, S.' 2 ? primary 'Messmer, C.' 3 ? primary 'Pang, Y.' 4 ? primary 'Biswas, S.' 5 ? primary 'Khalil, M.' 6 ? primary 'Zhang, P.' 7 ? primary 'Lauberth, S.M.' 8 ? primary 'Tulaiha, R.' 9 ? primary 'Zhou, M.-M.' 10 ? primary 'Lauberth, S.M.' 11 ? primary 'Blanco, M.A.' 12 ? primary 'Yang, F.-C.' 13 ? primary 'Affar, E.B.' 14 ? primary 'Zhao, Z.' 15 ? primary 'Zeng, L.' 16 ? primary 'Wang, L.' 17 ? primary 'Kutateladze, T.G.' 18 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Bromodomain-containing protein 4' 9745.136 1 ? ? ? ? 2 polymer syn 'Polycomb group protein ASXL1' 1675.113 1 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 'Protein HUNK1' 2 'Additional sex combs-like protein 1' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;SEEEDKCKPMSYEEKRQLSLDINKLPGEKLGRVVHIIQSREPSLKNSNPDEIEIDFETLKPSTLRELERYVTSCLRKKRK PQA ; ;SEEEDKCKPMSYEEKRQLSLDINKLPGEKLGRVVHIIQSREPSLKNSNPDEIEIDFETLKPSTLRELERYVTSCLRKKRK PQA ; A ? 2 'polypeptide(L)' no yes '(ACE)KVPPIRIQLSRIKP' XKVPPIRIQLSRIKP B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 GLU n 1 3 GLU n 1 4 GLU n 1 5 ASP n 1 6 LYS n 1 7 CYS n 1 8 LYS n 1 9 PRO n 1 10 MET n 1 11 SER n 1 12 TYR n 1 13 GLU n 1 14 GLU n 1 15 LYS n 1 16 ARG n 1 17 GLN n 1 18 LEU n 1 19 SER n 1 20 LEU n 1 21 ASP n 1 22 ILE n 1 23 ASN n 1 24 LYS n 1 25 LEU n 1 26 PRO n 1 27 GLY n 1 28 GLU n 1 29 LYS n 1 30 LEU n 1 31 GLY n 1 32 ARG n 1 33 VAL n 1 34 VAL n 1 35 HIS n 1 36 ILE n 1 37 ILE n 1 38 GLN n 1 39 SER n 1 40 ARG n 1 41 GLU n 1 42 PRO n 1 43 SER n 1 44 LEU n 1 45 LYS n 1 46 ASN n 1 47 SER n 1 48 ASN n 1 49 PRO n 1 50 ASP n 1 51 GLU n 1 52 ILE n 1 53 GLU n 1 54 ILE n 1 55 ASP n 1 56 PHE n 1 57 GLU n 1 58 THR n 1 59 LEU n 1 60 LYS n 1 61 PRO n 1 62 SER n 1 63 THR n 1 64 LEU n 1 65 ARG n 1 66 GLU n 1 67 LEU n 1 68 GLU n 1 69 ARG n 1 70 TYR n 1 71 VAL n 1 72 THR n 1 73 SER n 1 74 CYS n 1 75 LEU n 1 76 ARG n 1 77 LYS n 1 78 LYS n 1 79 ARG n 1 80 LYS n 1 81 PRO n 1 82 GLN n 1 83 ALA n 2 1 ACE n 2 2 LYS n 2 3 VAL n 2 4 PRO n 2 5 PRO n 2 6 ILE n 2 7 ARG n 2 8 ILE n 2 9 GLN n 2 10 LEU n 2 11 SER n 2 12 ARG n 2 13 ILE n 2 14 LYS n 2 15 PRO n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 83 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'BRD4, HUNK1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ;Escherichia coli 'BL21-Gold(DE3)pLysS AG' ; _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 866768 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 15 _pdbx_entity_src_syn.organism_scientific 'Homo sapiens' _pdbx_entity_src_syn.organism_common_name human _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ACE non-polymer . 'ACETYL GROUP' ? 'C2 H4 O' 44.053 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 1 SER SER A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 ASP 5 5 5 ASP ASP A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 CYS 7 7 7 CYS CYS A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 MET 10 10 10 MET MET A . n A 1 11 SER 11 11 11 SER SER A . n A 1 12 TYR 12 12 12 TYR TYR A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 ASN 23 23 23 ASN ASN A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 PRO 26 26 26 PRO PRO A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 ARG 32 32 32 ARG ARG A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 HIS 35 35 35 HIS HIS A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 ILE 37 37 37 ILE ILE A . n A 1 38 GLN 38 38 38 GLN GLN A . n A 1 39 SER 39 39 39 SER SER A . n A 1 40 ARG 40 40 40 ARG ARG A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 PRO 42 42 42 PRO PRO A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 ASN 46 46 46 ASN ASN A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 ASN 48 48 48 ASN ASN A . n A 1 49 PRO 49 49 49 PRO PRO A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 ILE 54 54 54 ILE ILE A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 PHE 56 56 56 PHE PHE A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 THR 58 58 58 THR THR A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 PRO 61 61 61 PRO PRO A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 THR 63 63 63 THR THR A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 ARG 65 65 65 ARG ARG A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 ARG 69 69 69 ARG ARG A . n A 1 70 TYR 70 70 70 TYR TYR A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 THR 72 72 72 THR THR A . n A 1 73 SER 73 73 73 SER SER A . n A 1 74 CYS 74 74 74 CYS CYS A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 ARG 76 76 76 ARG ARG A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 ARG 79 79 79 ARG ARG A . n A 1 80 LYS 80 80 80 LYS LYS A . n A 1 81 PRO 81 81 81 PRO PRO A . n A 1 82 GLN 82 82 82 GLN GLN A . n A 1 83 ALA 83 83 83 ALA ALA A . n B 2 1 ACE 1 201 201 ACE ACE B . n B 2 2 LYS 2 202 202 LYS LYS B . n B 2 3 VAL 3 203 203 VAL VAL B . n B 2 4 PRO 4 204 204 PRO PRO B . n B 2 5 PRO 5 205 205 PRO PRO B . n B 2 6 ILE 6 206 206 ILE ILE B . n B 2 7 ARG 7 207 207 ARG ARG B . n B 2 8 ILE 8 208 208 ILE ILE B . n B 2 9 GLN 9 209 209 GLN GLN B . n B 2 10 LEU 10 210 210 LEU LEU B . n B 2 11 SER 11 211 211 SER SER B . n B 2 12 ARG 12 212 212 ARG ARG B . n B 2 13 ILE 13 213 213 ILE ILE B . n B 2 14 LYS 14 214 214 LYS LYS B . n B 2 15 PRO 15 215 215 PRO PRO B . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id ACE _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id ACE _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9VQ1 _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 9VQ1 _struct.title 'NMR solution structures of BRD4 ET domain in complex with ASXL1 peptide' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9VQ1 _struct_keywords.text 'ASXL1, BRD4, BAP1, ET domain, PROTEIN BINDING' _struct_keywords.pdbx_keywords 'PROTEIN BINDING' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP BRD4_HUMAN O60885 ? 1 ;SEEEDKCKPMSYEEKRQLSLDINKLPGEKLGRVVHIIQSREPSLKNSNPDEIEIDFETLKPSTLRELERYVTSCLRKKRK PQA ; 601 2 UNP ASXL1_HUMAN Q8IXJ9 ? 2 KVPPIRIQLSRIKP 568 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 9VQ1 A 1 ? 83 ? O60885 601 ? 683 ? 1 83 2 2 9VQ1 B 2 ? 15 ? Q8IXJ9 568 ? 581 ? 202 215 # _struct_ref_seq_dif.align_id 2 _struct_ref_seq_dif.pdbx_pdb_id_code 9VQ1 _struct_ref_seq_dif.mon_id ACE _struct_ref_seq_dif.pdbx_pdb_strand_id B _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q8IXJ9 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details acetylation _struct_ref_seq_dif.pdbx_auth_seq_num 201 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'NMR Distance Restraints' _pdbx_struct_assembly_auth_evidence.details 'not applicable' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0 _pdbx_struct_oper_list.matrix[1][2] 0.0 _pdbx_struct_oper_list.matrix[1][3] 0.0 _pdbx_struct_oper_list.vector[1] 0.0 _pdbx_struct_oper_list.matrix[2][1] 0.0 _pdbx_struct_oper_list.matrix[2][2] 1.0 _pdbx_struct_oper_list.matrix[2][3] 0.0 _pdbx_struct_oper_list.vector[2] 0.0 _pdbx_struct_oper_list.matrix[3][1] 0.0 _pdbx_struct_oper_list.matrix[3][2] 0.0 _pdbx_struct_oper_list.matrix[3][3] 1.0 _pdbx_struct_oper_list.vector[3] 0.0 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLU A 2 ? CYS A 7 ? GLU A 2 CYS A 7 1 ? 6 HELX_P HELX_P2 AA2 SER A 11 ? ASN A 23 ? SER A 11 ASN A 23 1 ? 13 HELX_P HELX_P3 AA3 PRO A 26 ? GLU A 41 ? PRO A 26 GLU A 41 1 ? 16 HELX_P HELX_P4 AA4 LYS A 60 ? LEU A 75 ? LYS A 60 LEU A 75 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag both _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id B _struct_conn.ptnr1_label_comp_id ACE _struct_conn.ptnr1_label_seq_id 1 _struct_conn.ptnr1_label_atom_id C _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id LYS _struct_conn.ptnr2_label_seq_id 2 _struct_conn.ptnr2_label_atom_id N _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id B _struct_conn.ptnr1_auth_comp_id ACE _struct_conn.ptnr1_auth_seq_id 201 _struct_conn.ptnr2_auth_asym_id B _struct_conn.ptnr2_auth_comp_id LYS _struct_conn.ptnr2_auth_seq_id 202 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.325 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id ACE _pdbx_modification_feature.label_asym_id B _pdbx_modification_feature.label_seq_id 1 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id LYS _pdbx_modification_feature.modified_residue_label_asym_id B _pdbx_modification_feature.modified_residue_label_seq_id 2 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id ACE _pdbx_modification_feature.auth_asym_id B _pdbx_modification_feature.auth_seq_id 201 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id LYS _pdbx_modification_feature.modified_residue_auth_asym_id B _pdbx_modification_feature.modified_residue_auth_seq_id 202 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom . _pdbx_modification_feature.modified_residue_id_linking_atom . _pdbx_modification_feature.modified_residue_id LYS _pdbx_modification_feature.ref_pcm_id 20 _pdbx_modification_feature.ref_comp_id ACE _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Terminal acetylation' # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLU A 51 ? ILE A 54 ? GLU A 51 ILE A 54 AA1 2 ILE B 6 ? GLN B 9 ? ILE B 206 GLN B 209 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id ILE _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 54 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 54 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id ILE _pdbx_struct_sheet_hbond.range_2_label_asym_id B _pdbx_struct_sheet_hbond.range_2_label_seq_id 6 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_2_auth_asym_id B _pdbx_struct_sheet_hbond.range_2_auth_seq_id 206 # _pdbx_entry_details.entry_id 9VQ1 _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 3 OE1 A GLU 57 ? ? HZ2 B LYS 202 ? ? 1.60 2 4 O A LYS 15 ? ? HG A SER 19 ? ? 1.59 3 5 OE2 A GLU 41 ? ? HZ2 A LYS 60 ? ? 1.59 4 11 O A LEU 18 ? ? H A ILE 22 ? ? 1.59 5 19 O A SER 11 ? ? H A LYS 15 ? ? 1.56 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 2 ? ? -95.46 -68.18 2 1 ASN A 48 ? ? 179.75 143.84 3 1 PRO A 81 ? ? -76.39 34.05 4 2 GLU A 2 ? ? -93.60 -67.20 5 2 LYS A 45 ? ? 65.92 -68.65 6 2 ASN A 46 ? ? -173.24 99.23 7 2 ASN A 48 ? ? 175.39 144.65 8 2 ARG B 212 ? ? 61.56 -174.51 9 2 ILE B 213 ? ? 65.53 108.97 10 3 GLU A 2 ? ? -94.36 -68.13 11 3 LEU A 44 ? ? -146.87 53.07 12 3 LYS A 45 ? ? -69.77 87.71 13 3 ASN A 46 ? ? 59.48 76.01 14 3 ASN A 48 ? ? -178.03 143.00 15 3 GLN A 82 ? ? -146.79 38.08 16 3 SER B 211 ? ? -102.98 79.06 17 3 LYS B 214 ? ? 69.63 132.09 18 4 GLU A 2 ? ? -96.99 -67.35 19 4 CYS A 7 ? ? 48.26 97.27 20 4 ASN A 46 ? ? 52.83 86.02 21 4 ASN A 48 ? ? -173.88 148.29 22 4 LYS A 78 ? ? 68.47 93.78 23 4 PRO A 81 ? ? -50.90 100.71 24 4 SER B 211 ? ? 66.94 107.47 25 4 LYS B 214 ? ? -161.10 -52.44 26 5 GLU A 2 ? ? -95.11 -68.48 27 5 ASN A 46 ? ? 49.44 70.55 28 5 ASN A 48 ? ? -172.77 143.79 29 5 GLN A 82 ? ? 70.21 -68.30 30 6 GLU A 2 ? ? -94.49 -68.29 31 6 CYS A 7 ? ? 61.84 124.32 32 6 LYS A 45 ? ? 66.08 -75.51 33 6 ASN A 46 ? ? -154.74 77.32 34 6 ASN A 48 ? ? 175.88 146.21 35 6 LYS A 78 ? ? -136.37 -51.87 36 6 ILE B 213 ? ? 65.34 80.10 37 7 GLU A 2 ? ? -96.69 -68.76 38 7 CYS A 7 ? ? 46.23 98.48 39 7 LEU A 44 ? ? -92.27 -77.22 40 7 LYS A 45 ? ? 46.98 74.53 41 7 ASN A 46 ? ? 54.98 73.05 42 7 ASN A 48 ? ? 179.49 144.33 43 7 ARG A 79 ? ? -68.17 96.41 44 7 SER B 211 ? ? -121.18 -150.47 45 7 ARG B 212 ? ? 73.52 116.86 46 8 GLU A 2 ? ? -94.93 -67.76 47 8 ASN A 46 ? ? 57.69 79.72 48 8 ASN A 48 ? ? -174.46 146.07 49 8 LYS A 80 ? ? 64.96 111.82 50 8 PRO A 81 ? ? -52.38 89.99 51 8 ARG B 212 ? ? 59.41 96.18 52 9 GLU A 2 ? ? -95.45 -65.49 53 9 CYS A 7 ? ? 73.39 170.69 54 9 ASN A 46 ? ? 70.66 -46.59 55 9 SER A 47 ? ? 74.05 -41.77 56 9 ASN A 48 ? ? 176.12 157.46 57 9 LYS A 80 ? ? -156.19 78.64 58 10 GLU A 2 ? ? -95.41 -68.27 59 10 LEU A 44 ? ? -92.05 -81.85 60 10 LYS A 45 ? ? 52.79 77.22 61 10 ASN A 46 ? ? 51.54 80.17 62 10 ASN A 48 ? ? -179.79 145.63 63 10 LYS A 77 ? ? -125.33 -159.41 64 10 LYS B 214 ? ? 67.74 158.12 65 11 GLU A 2 ? ? -95.38 -65.03 66 11 CYS A 7 ? ? 71.74 132.55 67 11 ASN A 46 ? ? 52.68 73.99 68 11 LYS A 77 ? ? -99.60 43.39 69 11 PRO A 81 ? ? -49.05 99.40 70 11 ARG B 212 ? ? -108.62 65.37 71 12 GLU A 2 ? ? -96.15 -63.22 72 12 LEU A 44 ? ? -92.03 -63.58 73 12 ASN A 46 ? ? 48.31 70.66 74 12 ASN A 48 ? ? 179.94 144.47 75 12 PRO A 81 ? ? -56.73 95.61 76 13 GLU A 2 ? ? -97.00 -69.73 77 13 LEU A 44 ? ? -114.95 62.90 78 13 ASN A 46 ? ? 53.60 78.00 79 13 ASN A 48 ? ? -177.61 143.85 80 13 LYS A 77 ? ? -108.40 -162.44 81 13 PRO A 81 ? ? -68.83 67.60 82 13 SER B 211 ? ? -68.33 97.29 83 13 ILE B 213 ? ? -165.80 63.74 84 14 GLU A 2 ? ? -94.72 -68.29 85 14 CYS A 7 ? ? 177.09 139.90 86 14 LYS A 45 ? ? -47.25 95.11 87 14 ASN A 48 ? ? -173.13 143.74 88 14 PRO A 81 ? ? -59.44 94.96 89 15 GLU A 2 ? ? -93.76 -68.22 90 15 ASN A 46 ? ? 57.43 78.08 91 15 ASN A 48 ? ? 175.81 142.80 92 16 GLU A 2 ? ? -95.44 -69.03 93 16 CYS A 7 ? ? 56.07 119.93 94 16 ASN A 46 ? ? 52.16 85.75 95 16 ASN A 48 ? ? -177.35 149.79 96 16 LYS A 80 ? ? 57.53 85.66 97 16 PRO A 81 ? ? -65.38 73.80 98 16 SER B 211 ? ? -114.85 -84.52 99 17 GLU A 2 ? ? -97.00 -68.56 100 17 LEU A 44 ? ? -84.88 -71.35 101 17 ASN A 46 ? ? 56.12 86.52 102 17 ASN A 48 ? ? -179.27 146.26 103 17 ASP A 55 ? ? -103.09 78.91 104 17 PRO A 81 ? ? -62.67 91.00 105 17 ARG B 212 ? ? -133.50 -72.50 106 17 LYS B 214 ? ? 77.18 141.15 107 18 GLU A 2 ? ? -94.94 -68.79 108 18 CYS A 7 ? ? 56.38 113.13 109 18 ASN A 46 ? ? 44.28 84.18 110 18 ASN A 48 ? ? 178.38 145.24 111 18 PRO A 81 ? ? -68.05 86.07 112 18 LYS B 214 ? ? 52.52 122.83 113 19 GLU A 2 ? ? -96.75 -67.08 114 19 CYS A 7 ? ? 63.98 106.13 115 19 ASN A 46 ? ? 54.49 75.56 116 19 ASN A 48 ? ? 178.92 145.85 117 19 GLN A 82 ? ? -95.51 34.85 118 20 GLU A 2 ? ? -98.72 -72.18 119 20 CYS A 7 ? ? 48.74 105.97 120 20 LEU A 44 ? ? -90.58 -77.72 121 20 LYS A 45 ? ? 48.66 73.36 122 20 ASN A 46 ? ? 52.79 75.10 123 20 ASN A 48 ? ? 179.64 142.72 124 20 LYS A 77 ? ? -117.57 54.98 125 20 ILE B 213 ? ? 51.04 72.04 # _pdbx_nmr_ensemble.entry_id 9VQ1 _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 9VQ1 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '137 mM sodium chloride, 10 mM sodium phosphate, 2 mM DTT, 90% H2O/10% D2O' '90% H2O/10% D2O' 15N_sample solution ? 2 '137 mM sodium chloride, 10 mM sodium phosphate, 2 mM DTT, 100% D2O' '100% D2O' 13C_sample solution ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'sodium chloride' 137 ? mM 'natural abundance' 1 'sodium phosphate' 10 ? mM 'natural abundance' 1 DTT 2 ? mM 'natural abundance' 2 'sodium chloride' 137 ? mM 'natural abundance' 2 'sodium phosphate' 10 ? mM 'natural abundance' 2 DTT 2 ? mM 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.4 _pdbx_nmr_exptl_sample_conditions.ionic_strength 150 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '3D 1H-15N NOESY' 2 isotropic 2 1 2 '3D 1H-13C NOESY aliphatic' 2 isotropic 3 1 2 '3D 1H-13C NOESY aromatic' 2 isotropic 4 1 2 '3D 1H-13C filtered-NOESY aliphatic' 2 isotropic 5 1 2 '3D 1H-13C filtered-NOESY aromatic' 2 isotropic 6 1 1 '2D 1H-15N HSQC' 1 isotropic # _pdbx_nmr_refine.entry_id 9VQ1 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement ARIA ? ;Linge, O'Donoghue and Nilges ; 2 'structure calculation' CNS ? 'Brunger, Adams, Clore, Gros, Nilges and Read' 3 'chemical shift assignment' NMRView ? 'Johnson, One Moon Scientific' 4 'data analysis' NMRView ? 'Johnson, One Moon Scientific' 5 collection TopSpin ? 'Bruker Biospin' 6 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ACE C C N N 1 ACE O O N N 2 ACE CH3 C N N 3 ACE H H N N 4 ACE H1 H N N 5 ACE H2 H N N 6 ACE H3 H N N 7 ALA N N N N 8 ALA CA C N S 9 ALA C C N N 10 ALA O O N N 11 ALA CB C N N 12 ALA OXT O N N 13 ALA H H N N 14 ALA H2 H N N 15 ALA HA H N N 16 ALA HB1 H N N 17 ALA HB2 H N N 18 ALA HB3 H N N 19 ALA HXT H N N 20 ARG N N N N 21 ARG CA C N S 22 ARG C C N N 23 ARG O O N N 24 ARG CB C N N 25 ARG CG C N N 26 ARG CD C N N 27 ARG NE N N N 28 ARG CZ C N N 29 ARG NH1 N N N 30 ARG NH2 N N N 31 ARG OXT O N N 32 ARG H H N N 33 ARG H2 H N N 34 ARG HA H N N 35 ARG HB2 H N N 36 ARG HB3 H N N 37 ARG HG2 H N N 38 ARG HG3 H N N 39 ARG HD2 H N N 40 ARG HD3 H N N 41 ARG HE H N N 42 ARG HH11 H N N 43 ARG HH12 H N N 44 ARG HH21 H N N 45 ARG HH22 H N N 46 ARG HXT H N N 47 ASN N N N N 48 ASN CA C N S 49 ASN C C N N 50 ASN O O N N 51 ASN CB C N N 52 ASN CG C N N 53 ASN OD1 O N N 54 ASN ND2 N N N 55 ASN OXT O N N 56 ASN H H N N 57 ASN H2 H N N 58 ASN HA H N N 59 ASN HB2 H N N 60 ASN HB3 H N N 61 ASN HD21 H N N 62 ASN HD22 H N N 63 ASN HXT H N N 64 ASP N N N N 65 ASP CA C N S 66 ASP C C N N 67 ASP O O N N 68 ASP CB C N N 69 ASP CG C N N 70 ASP OD1 O N N 71 ASP OD2 O N N 72 ASP OXT O N N 73 ASP H H N N 74 ASP H2 H N N 75 ASP HA H N N 76 ASP HB2 H N N 77 ASP HB3 H N N 78 ASP HD2 H N N 79 ASP HXT H N N 80 CYS N N N N 81 CYS CA C N R 82 CYS C C N N 83 CYS O O N N 84 CYS CB C N N 85 CYS SG S N N 86 CYS OXT O N N 87 CYS H H N N 88 CYS H2 H N N 89 CYS HA H N N 90 CYS HB2 H N N 91 CYS HB3 H N N 92 CYS HG H N N 93 CYS HXT H N N 94 GLN N N N N 95 GLN CA C N S 96 GLN C C N N 97 GLN O O N N 98 GLN CB C N N 99 GLN CG C N N 100 GLN CD C N N 101 GLN OE1 O N N 102 GLN NE2 N N N 103 GLN OXT O N N 104 GLN H H N N 105 GLN H2 H N N 106 GLN HA H N N 107 GLN HB2 H N N 108 GLN HB3 H N N 109 GLN HG2 H N N 110 GLN HG3 H N N 111 GLN HE21 H N N 112 GLN HE22 H N N 113 GLN HXT H N N 114 GLU N N N N 115 GLU CA C N S 116 GLU C C N N 117 GLU O O N N 118 GLU CB C N N 119 GLU CG C N N 120 GLU CD C N N 121 GLU OE1 O N N 122 GLU OE2 O N N 123 GLU OXT O N N 124 GLU H H N N 125 GLU H2 H N N 126 GLU HA H N N 127 GLU HB2 H N N 128 GLU HB3 H N N 129 GLU HG2 H N N 130 GLU HG3 H N N 131 GLU HE2 H N N 132 GLU HXT H N N 133 GLY N N N N 134 GLY CA C N N 135 GLY C C N N 136 GLY O O N N 137 GLY OXT O N N 138 GLY H H N N 139 GLY H2 H N N 140 GLY HA2 H N N 141 GLY HA3 H N N 142 GLY HXT H N N 143 HIS N N N N 144 HIS CA C N S 145 HIS C C N N 146 HIS O O N N 147 HIS CB C N N 148 HIS CG C Y N 149 HIS ND1 N Y N 150 HIS CD2 C Y N 151 HIS CE1 C Y N 152 HIS NE2 N Y N 153 HIS OXT O N N 154 HIS H H N N 155 HIS H2 H N N 156 HIS HA H N N 157 HIS HB2 H N N 158 HIS HB3 H N N 159 HIS HD1 H N N 160 HIS HD2 H N N 161 HIS HE1 H N N 162 HIS HE2 H N N 163 HIS HXT H N N 164 ILE N N N N 165 ILE CA C N S 166 ILE C C N N 167 ILE O O N N 168 ILE CB C N S 169 ILE CG1 C N N 170 ILE CG2 C N N 171 ILE CD1 C N N 172 ILE OXT O N N 173 ILE H H N N 174 ILE H2 H N N 175 ILE HA H N N 176 ILE HB H N N 177 ILE HG12 H N N 178 ILE HG13 H N N 179 ILE HG21 H N N 180 ILE HG22 H N N 181 ILE HG23 H N N 182 ILE HD11 H N N 183 ILE HD12 H N N 184 ILE HD13 H N N 185 ILE HXT H N N 186 LEU N N N N 187 LEU CA C N S 188 LEU C C N N 189 LEU O O N N 190 LEU CB C N N 191 LEU CG C N N 192 LEU CD1 C N N 193 LEU CD2 C N N 194 LEU OXT O N N 195 LEU H H N N 196 LEU H2 H N N 197 LEU HA H N N 198 LEU HB2 H N N 199 LEU HB3 H N N 200 LEU HG H N N 201 LEU HD11 H N N 202 LEU HD12 H N N 203 LEU HD13 H N N 204 LEU HD21 H N N 205 LEU HD22 H N N 206 LEU HD23 H N N 207 LEU HXT H N N 208 LYS N N N N 209 LYS CA C N S 210 LYS C C N N 211 LYS O O N N 212 LYS CB C N N 213 LYS CG C N N 214 LYS CD C N N 215 LYS CE C N N 216 LYS NZ N N N 217 LYS OXT O N N 218 LYS H H N N 219 LYS H2 H N N 220 LYS HA H N N 221 LYS HB2 H N N 222 LYS HB3 H N N 223 LYS HG2 H N N 224 LYS HG3 H N N 225 LYS HD2 H N N 226 LYS HD3 H N N 227 LYS HE2 H N N 228 LYS HE3 H N N 229 LYS HZ1 H N N 230 LYS HZ2 H N N 231 LYS HZ3 H N N 232 LYS HXT H N N 233 MET N N N N 234 MET CA C N S 235 MET C C N N 236 MET O O N N 237 MET CB C N N 238 MET CG C N N 239 MET SD S N N 240 MET CE C N N 241 MET OXT O N N 242 MET H H N N 243 MET H2 H N N 244 MET HA H N N 245 MET HB2 H N N 246 MET HB3 H N N 247 MET HG2 H N N 248 MET HG3 H N N 249 MET HE1 H N N 250 MET HE2 H N N 251 MET HE3 H N N 252 MET HXT H N N 253 PHE N N N N 254 PHE CA C N S 255 PHE C C N N 256 PHE O O N N 257 PHE CB C N N 258 PHE CG C Y N 259 PHE CD1 C Y N 260 PHE CD2 C Y N 261 PHE CE1 C Y N 262 PHE CE2 C Y N 263 PHE CZ C Y N 264 PHE OXT O N N 265 PHE H H N N 266 PHE H2 H N N 267 PHE HA H N N 268 PHE HB2 H N N 269 PHE HB3 H N N 270 PHE HD1 H N N 271 PHE HD2 H N N 272 PHE HE1 H N N 273 PHE HE2 H N N 274 PHE HZ H N N 275 PHE HXT H N N 276 PRO N N N N 277 PRO CA C N S 278 PRO C C N N 279 PRO O O N N 280 PRO CB C N N 281 PRO CG C N N 282 PRO CD C N N 283 PRO OXT O N N 284 PRO H H N N 285 PRO HA H N N 286 PRO HB2 H N N 287 PRO HB3 H N N 288 PRO HG2 H N N 289 PRO HG3 H N N 290 PRO HD2 H N N 291 PRO HD3 H N N 292 PRO HXT H N N 293 SER N N N N 294 SER CA C N S 295 SER C C N N 296 SER O O N N 297 SER CB C N N 298 SER OG O N N 299 SER OXT O N N 300 SER H H N N 301 SER H2 H N N 302 SER HA H N N 303 SER HB2 H N N 304 SER HB3 H N N 305 SER HG H N N 306 SER HXT H N N 307 THR N N N N 308 THR CA C N S 309 THR C C N N 310 THR O O N N 311 THR CB C N R 312 THR OG1 O N N 313 THR CG2 C N N 314 THR OXT O N N 315 THR H H N N 316 THR H2 H N N 317 THR HA H N N 318 THR HB H N N 319 THR HG1 H N N 320 THR HG21 H N N 321 THR HG22 H N N 322 THR HG23 H N N 323 THR HXT H N N 324 TYR N N N N 325 TYR CA C N S 326 TYR C C N N 327 TYR O O N N 328 TYR CB C N N 329 TYR CG C Y N 330 TYR CD1 C Y N 331 TYR CD2 C Y N 332 TYR CE1 C Y N 333 TYR CE2 C Y N 334 TYR CZ C Y N 335 TYR OH O N N 336 TYR OXT O N N 337 TYR H H N N 338 TYR H2 H N N 339 TYR HA H N N 340 TYR HB2 H N N 341 TYR HB3 H N N 342 TYR HD1 H N N 343 TYR HD2 H N N 344 TYR HE1 H N N 345 TYR HE2 H N N 346 TYR HH H N N 347 TYR HXT H N N 348 VAL N N N N 349 VAL CA C N S 350 VAL C C N N 351 VAL O O N N 352 VAL CB C N N 353 VAL CG1 C N N 354 VAL CG2 C N N 355 VAL OXT O N N 356 VAL H H N N 357 VAL H2 H N N 358 VAL HA H N N 359 VAL HB H N N 360 VAL HG11 H N N 361 VAL HG12 H N N 362 VAL HG13 H N N 363 VAL HG21 H N N 364 VAL HG22 H N N 365 VAL HG23 H N N 366 VAL HXT H N N 367 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ACE C O doub N N 1 ACE C CH3 sing N N 2 ACE C H sing N N 3 ACE CH3 H1 sing N N 4 ACE CH3 H2 sing N N 5 ACE CH3 H3 sing N N 6 ALA N CA sing N N 7 ALA N H sing N N 8 ALA N H2 sing N N 9 ALA CA C sing N N 10 ALA CA CB sing N N 11 ALA CA HA sing N N 12 ALA C O doub N N 13 ALA C OXT sing N N 14 ALA CB HB1 sing N N 15 ALA CB HB2 sing N N 16 ALA CB HB3 sing N N 17 ALA OXT HXT sing N N 18 ARG N CA sing N N 19 ARG N H sing N N 20 ARG N H2 sing N N 21 ARG CA C sing N N 22 ARG CA CB sing N N 23 ARG CA HA sing N N 24 ARG C O doub N N 25 ARG C OXT sing N N 26 ARG CB CG sing N N 27 ARG CB HB2 sing N N 28 ARG CB HB3 sing N N 29 ARG CG CD sing N N 30 ARG CG HG2 sing N N 31 ARG CG HG3 sing N N 32 ARG CD NE sing N N 33 ARG CD HD2 sing N N 34 ARG CD HD3 sing N N 35 ARG NE CZ sing N N 36 ARG NE HE sing N N 37 ARG CZ NH1 sing N N 38 ARG CZ NH2 doub N N 39 ARG NH1 HH11 sing N N 40 ARG NH1 HH12 sing N N 41 ARG NH2 HH21 sing N N 42 ARG NH2 HH22 sing N N 43 ARG OXT HXT sing N N 44 ASN N CA sing N N 45 ASN N H sing N N 46 ASN N H2 sing N N 47 ASN CA C sing N N 48 ASN CA CB sing N N 49 ASN CA HA sing N N 50 ASN C O doub N N 51 ASN C OXT sing N N 52 ASN CB CG sing N N 53 ASN CB HB2 sing N N 54 ASN CB HB3 sing N N 55 ASN CG OD1 doub N N 56 ASN CG ND2 sing N N 57 ASN ND2 HD21 sing N N 58 ASN ND2 HD22 sing N N 59 ASN OXT HXT sing N N 60 ASP N CA sing N N 61 ASP N H sing N N 62 ASP N H2 sing N N 63 ASP CA C sing N N 64 ASP CA CB sing N N 65 ASP CA HA sing N N 66 ASP C O doub N N 67 ASP C OXT sing N N 68 ASP CB CG sing N N 69 ASP CB HB2 sing N N 70 ASP CB HB3 sing N N 71 ASP CG OD1 doub N N 72 ASP CG OD2 sing N N 73 ASP OD2 HD2 sing N N 74 ASP OXT HXT sing N N 75 CYS N CA sing N N 76 CYS N H sing N N 77 CYS N H2 sing N N 78 CYS CA C sing N N 79 CYS CA CB sing N N 80 CYS CA HA sing N N 81 CYS C O doub N N 82 CYS C OXT sing N N 83 CYS CB SG sing N N 84 CYS CB HB2 sing N N 85 CYS CB HB3 sing N N 86 CYS SG HG sing N N 87 CYS OXT HXT sing N N 88 GLN N CA sing N N 89 GLN N H sing N N 90 GLN N H2 sing N N 91 GLN CA C sing N N 92 GLN CA CB sing N N 93 GLN CA HA sing N N 94 GLN C O doub N N 95 GLN C OXT sing N N 96 GLN CB CG sing N N 97 GLN CB HB2 sing N N 98 GLN CB HB3 sing N N 99 GLN CG CD sing N N 100 GLN CG HG2 sing N N 101 GLN CG HG3 sing N N 102 GLN CD OE1 doub N N 103 GLN CD NE2 sing N N 104 GLN NE2 HE21 sing N N 105 GLN NE2 HE22 sing N N 106 GLN OXT HXT sing N N 107 GLU N CA sing N N 108 GLU N H sing N N 109 GLU N H2 sing N N 110 GLU CA C sing N N 111 GLU CA CB sing N N 112 GLU CA HA sing N N 113 GLU C O doub N N 114 GLU C OXT sing N N 115 GLU CB CG sing N N 116 GLU CB HB2 sing N N 117 GLU CB HB3 sing N N 118 GLU CG CD sing N N 119 GLU CG HG2 sing N N 120 GLU CG HG3 sing N N 121 GLU CD OE1 doub N N 122 GLU CD OE2 sing N N 123 GLU OE2 HE2 sing N N 124 GLU OXT HXT sing N N 125 GLY N CA sing N N 126 GLY N H sing N N 127 GLY N H2 sing N N 128 GLY CA C sing N N 129 GLY CA HA2 sing N N 130 GLY CA HA3 sing N N 131 GLY C O doub N N 132 GLY C OXT sing N N 133 GLY OXT HXT sing N N 134 HIS N CA sing N N 135 HIS N H sing N N 136 HIS N H2 sing N N 137 HIS CA C sing N N 138 HIS CA CB sing N N 139 HIS CA HA sing N N 140 HIS C O doub N N 141 HIS C OXT sing N N 142 HIS CB CG sing N N 143 HIS CB HB2 sing N N 144 HIS CB HB3 sing N N 145 HIS CG ND1 sing Y N 146 HIS CG CD2 doub Y N 147 HIS ND1 CE1 doub Y N 148 HIS ND1 HD1 sing N N 149 HIS CD2 NE2 sing Y N 150 HIS CD2 HD2 sing N N 151 HIS CE1 NE2 sing Y N 152 HIS CE1 HE1 sing N N 153 HIS NE2 HE2 sing N N 154 HIS OXT HXT sing N N 155 ILE N CA sing N N 156 ILE N H sing N N 157 ILE N H2 sing N N 158 ILE CA C sing N N 159 ILE CA CB sing N N 160 ILE CA HA sing N N 161 ILE C O doub N N 162 ILE C OXT sing N N 163 ILE CB CG1 sing N N 164 ILE CB CG2 sing N N 165 ILE CB HB sing N N 166 ILE CG1 CD1 sing N N 167 ILE CG1 HG12 sing N N 168 ILE CG1 HG13 sing N N 169 ILE CG2 HG21 sing N N 170 ILE CG2 HG22 sing N N 171 ILE CG2 HG23 sing N N 172 ILE CD1 HD11 sing N N 173 ILE CD1 HD12 sing N N 174 ILE CD1 HD13 sing N N 175 ILE OXT HXT sing N N 176 LEU N CA sing N N 177 LEU N H sing N N 178 LEU N H2 sing N N 179 LEU CA C sing N N 180 LEU CA CB sing N N 181 LEU CA HA sing N N 182 LEU C O doub N N 183 LEU C OXT sing N N 184 LEU CB CG sing N N 185 LEU CB HB2 sing N N 186 LEU CB HB3 sing N N 187 LEU CG CD1 sing N N 188 LEU CG CD2 sing N N 189 LEU CG HG sing N N 190 LEU CD1 HD11 sing N N 191 LEU CD1 HD12 sing N N 192 LEU CD1 HD13 sing N N 193 LEU CD2 HD21 sing N N 194 LEU CD2 HD22 sing N N 195 LEU CD2 HD23 sing N N 196 LEU OXT HXT sing N N 197 LYS N CA sing N N 198 LYS N H sing N N 199 LYS N H2 sing N N 200 LYS CA C sing N N 201 LYS CA CB sing N N 202 LYS CA HA sing N N 203 LYS C O doub N N 204 LYS C OXT sing N N 205 LYS CB CG sing N N 206 LYS CB HB2 sing N N 207 LYS CB HB3 sing N N 208 LYS CG CD sing N N 209 LYS CG HG2 sing N N 210 LYS CG HG3 sing N N 211 LYS CD CE sing N N 212 LYS CD HD2 sing N N 213 LYS CD HD3 sing N N 214 LYS CE NZ sing N N 215 LYS CE HE2 sing N N 216 LYS CE HE3 sing N N 217 LYS NZ HZ1 sing N N 218 LYS NZ HZ2 sing N N 219 LYS NZ HZ3 sing N N 220 LYS OXT HXT sing N N 221 MET N CA sing N N 222 MET N H sing N N 223 MET N H2 sing N N 224 MET CA C sing N N 225 MET CA CB sing N N 226 MET CA HA sing N N 227 MET C O doub N N 228 MET C OXT sing N N 229 MET CB CG sing N N 230 MET CB HB2 sing N N 231 MET CB HB3 sing N N 232 MET CG SD sing N N 233 MET CG HG2 sing N N 234 MET CG HG3 sing N N 235 MET SD CE sing N N 236 MET CE HE1 sing N N 237 MET CE HE2 sing N N 238 MET CE HE3 sing N N 239 MET OXT HXT sing N N 240 PHE N CA sing N N 241 PHE N H sing N N 242 PHE N H2 sing N N 243 PHE CA C sing N N 244 PHE CA CB sing N N 245 PHE CA HA sing N N 246 PHE C O doub N N 247 PHE C OXT sing N N 248 PHE CB CG sing N N 249 PHE CB HB2 sing N N 250 PHE CB HB3 sing N N 251 PHE CG CD1 doub Y N 252 PHE CG CD2 sing Y N 253 PHE CD1 CE1 sing Y N 254 PHE CD1 HD1 sing N N 255 PHE CD2 CE2 doub Y N 256 PHE CD2 HD2 sing N N 257 PHE CE1 CZ doub Y N 258 PHE CE1 HE1 sing N N 259 PHE CE2 CZ sing Y N 260 PHE CE2 HE2 sing N N 261 PHE CZ HZ sing N N 262 PHE OXT HXT sing N N 263 PRO N CA sing N N 264 PRO N CD sing N N 265 PRO N H sing N N 266 PRO CA C sing N N 267 PRO CA CB sing N N 268 PRO CA HA sing N N 269 PRO C O doub N N 270 PRO C OXT sing N N 271 PRO CB CG sing N N 272 PRO CB HB2 sing N N 273 PRO CB HB3 sing N N 274 PRO CG CD sing N N 275 PRO CG HG2 sing N N 276 PRO CG HG3 sing N N 277 PRO CD HD2 sing N N 278 PRO CD HD3 sing N N 279 PRO OXT HXT sing N N 280 SER N CA sing N N 281 SER N H sing N N 282 SER N H2 sing N N 283 SER CA C sing N N 284 SER CA CB sing N N 285 SER CA HA sing N N 286 SER C O doub N N 287 SER C OXT sing N N 288 SER CB OG sing N N 289 SER CB HB2 sing N N 290 SER CB HB3 sing N N 291 SER OG HG sing N N 292 SER OXT HXT sing N N 293 THR N CA sing N N 294 THR N H sing N N 295 THR N H2 sing N N 296 THR CA C sing N N 297 THR CA CB sing N N 298 THR CA HA sing N N 299 THR C O doub N N 300 THR C OXT sing N N 301 THR CB OG1 sing N N 302 THR CB CG2 sing N N 303 THR CB HB sing N N 304 THR OG1 HG1 sing N N 305 THR CG2 HG21 sing N N 306 THR CG2 HG22 sing N N 307 THR CG2 HG23 sing N N 308 THR OXT HXT sing N N 309 TYR N CA sing N N 310 TYR N H sing N N 311 TYR N H2 sing N N 312 TYR CA C sing N N 313 TYR CA CB sing N N 314 TYR CA HA sing N N 315 TYR C O doub N N 316 TYR C OXT sing N N 317 TYR CB CG sing N N 318 TYR CB HB2 sing N N 319 TYR CB HB3 sing N N 320 TYR CG CD1 doub Y N 321 TYR CG CD2 sing Y N 322 TYR CD1 CE1 sing Y N 323 TYR CD1 HD1 sing N N 324 TYR CD2 CE2 doub Y N 325 TYR CD2 HD2 sing N N 326 TYR CE1 CZ doub Y N 327 TYR CE1 HE1 sing N N 328 TYR CE2 CZ sing Y N 329 TYR CE2 HE2 sing N N 330 TYR CZ OH sing N N 331 TYR OH HH sing N N 332 TYR OXT HXT sing N N 333 VAL N CA sing N N 334 VAL N H sing N N 335 VAL N H2 sing N N 336 VAL CA C sing N N 337 VAL CA CB sing N N 338 VAL CA HA sing N N 339 VAL C O doub N N 340 VAL C OXT sing N N 341 VAL CB CG1 sing N N 342 VAL CB CG2 sing N N 343 VAL CB HB sing N N 344 VAL CG1 HG11 sing N N 345 VAL CG1 HG12 sing N N 346 VAL CG1 HG13 sing N N 347 VAL CG2 HG21 sing N N 348 VAL CG2 HG22 sing N N 349 VAL CG2 HG23 sing N N 350 VAL OXT HXT sing N N 351 # _pdbx_audit_support.funding_organization 'National Natural Science Foundation of China (NSFC)' _pdbx_audit_support.country China _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 'AVANCE NEO' ? Bruker 600 ? 2 'AVANCE NEO' ? Bruker 800 ? # _atom_sites.entry_id 9VQ1 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ #