data_9VR0 # _entry.id 9VR0 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.413 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9VR0 pdb_00009vr0 10.2210/pdb9vr0/pdb WWPDB D_1300061218 ? ? BMRB 36771 ? 10.13018/BMR36771 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2025-07-30 ? 2 'Structure model' 1 1 2026-05-06 ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' struct_conf # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 2 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_citation.title' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr . _pdbx_database_status.entry_id 9VR0 _pdbx_database_status.recvd_initial_deposition_date 2025-07-05 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs . _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'NMR solution structure of termini-truncated oxidized cytochrome c552 from Thioalkalivibrio paradoxus' _pdbx_database_related.db_id 36771 _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email edvbon@mail.ru _pdbx_contact_author.name_first Eduard _pdbx_contact_author.name_last Bocharov _pdbx_contact_author.name_mi Valerievich _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-3635-1609 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Britikov, V.V.' 1 0000-0002-1330-9539 'Britikova, E.V.' 2 0000-0003-2612-9024 'Rakitina, T.V.' 3 0000-0002-3096-8659 'Dergousova, N.I.' 4 0000-0002-4312-0825 'Tikhonova, T.V.' 5 0000-0003-4264-8676 'Popov, V.O.' 6 0000-0002-0133-7962 'Bocharov, E.V.' 7 0000-0002-3635-1609 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'NMR solution structure of termini-truncated oxidized cytochrome c552 from Thioalkalivibrio paradoxus.' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Britikov, V.V.' 1 0000-0002-1330-9539 primary 'Britikova, E.V.' 2 0000-0003-2612-9024 primary 'Rakitina, T.V.' 3 0000-0002-3096-8659 primary 'Dergousova, N.I.' 4 0000-0002-4312-0825 primary 'Tikhonova, T.V.' 5 0000-0003-4264-8676 primary 'Popov, V.O.' 6 0000-0002-0133-7962 primary 'Bocharov, E.V.' 7 0000-0002-3635-1609 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Cytochrome c552' 13772.092 1 ? ? ? ? 2 non-polymer syn 'HEME C' 618.503 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSGWEVPEAEIHRENPIPPDARSLDQGGVLYAEHCVRCHGETLRGDGPDAHDLDPPVADLVEHAPHHSDGDLAYRVRIG RGPMPGFGDALDERDIWDLVNFMRDRAQGAALAGTNGLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSGWEVPEAEIHRENPIPPDARSLDQGGVLYAEHCVRCHGETLRGDGPDAHDLDPPVADLVEHAPHHSDGDLAYRVRIG RGPMPGFGDALDERDIWDLVNFMRDRAQGAALAGTNGLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'HEME C' _pdbx_entity_nonpoly.comp_id HEC # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 GLY n 1 5 TRP n 1 6 GLU n 1 7 VAL n 1 8 PRO n 1 9 GLU n 1 10 ALA n 1 11 GLU n 1 12 ILE n 1 13 HIS n 1 14 ARG n 1 15 GLU n 1 16 ASN n 1 17 PRO n 1 18 ILE n 1 19 PRO n 1 20 PRO n 1 21 ASP n 1 22 ALA n 1 23 ARG n 1 24 SER n 1 25 LEU n 1 26 ASP n 1 27 GLN n 1 28 GLY n 1 29 GLY n 1 30 VAL n 1 31 LEU n 1 32 TYR n 1 33 ALA n 1 34 GLU n 1 35 HIS n 1 36 CYS n 1 37 VAL n 1 38 ARG n 1 39 CYS n 1 40 HIS n 1 41 GLY n 1 42 GLU n 1 43 THR n 1 44 LEU n 1 45 ARG n 1 46 GLY n 1 47 ASP n 1 48 GLY n 1 49 PRO n 1 50 ASP n 1 51 ALA n 1 52 HIS n 1 53 ASP n 1 54 LEU n 1 55 ASP n 1 56 PRO n 1 57 PRO n 1 58 VAL n 1 59 ALA n 1 60 ASP n 1 61 LEU n 1 62 VAL n 1 63 GLU n 1 64 HIS n 1 65 ALA n 1 66 PRO n 1 67 HIS n 1 68 HIS n 1 69 SER n 1 70 ASP n 1 71 GLY n 1 72 ASP n 1 73 LEU n 1 74 ALA n 1 75 TYR n 1 76 ARG n 1 77 VAL n 1 78 ARG n 1 79 ILE n 1 80 GLY n 1 81 ARG n 1 82 GLY n 1 83 PRO n 1 84 MET n 1 85 PRO n 1 86 GLY n 1 87 PHE n 1 88 GLY n 1 89 ASP n 1 90 ALA n 1 91 LEU n 1 92 ASP n 1 93 GLU n 1 94 ARG n 1 95 ASP n 1 96 ILE n 1 97 TRP n 1 98 ASP n 1 99 LEU n 1 100 VAL n 1 101 ASN n 1 102 PHE n 1 103 MET n 1 104 ARG n 1 105 ASP n 1 106 ARG n 1 107 ALA n 1 108 GLN n 1 109 GLY n 1 110 ALA n 1 111 ALA n 1 112 LEU n 1 113 ALA n 1 114 GLY n 1 115 THR n 1 116 ASN n 1 117 GLY n 1 118 LEU n 1 119 GLU n 1 120 HIS n 1 121 HIS n 1 122 HIS n 1 123 HIS n 1 124 HIS n 1 125 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 125 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene WP_006748979.1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Thioalkalivibrio paradoxus ARh 1' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 713585 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HEC non-polymer . 'HEME C' ? 'C34 H34 Fe N4 O4' 618.503 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 20 ? ? ? A . n A 1 2 GLY 2 21 21 GLY GLY A . n A 1 3 SER 3 22 22 SER SER A . n A 1 4 GLY 4 23 23 GLY GLY A . n A 1 5 TRP 5 24 24 TRP TRP A . n A 1 6 GLU 6 25 25 GLU GLU A . n A 1 7 VAL 7 26 26 VAL VAL A . n A 1 8 PRO 8 27 27 PRO PRO A . n A 1 9 GLU 9 28 28 GLU GLU A . n A 1 10 ALA 10 29 29 ALA ALA A . n A 1 11 GLU 11 30 30 GLU GLU A . n A 1 12 ILE 12 31 31 ILE ILE A . n A 1 13 HIS 13 32 32 HIS HIS A . n A 1 14 ARG 14 33 33 ARG ARG A . n A 1 15 GLU 15 34 34 GLU GLU A . n A 1 16 ASN 16 35 35 ASN ASN A . n A 1 17 PRO 17 36 36 PRO PRO A . n A 1 18 ILE 18 37 37 ILE ILE A . n A 1 19 PRO 19 38 38 PRO PRO A . n A 1 20 PRO 20 39 39 PRO PRO A . n A 1 21 ASP 21 40 40 ASP ASP A . n A 1 22 ALA 22 41 41 ALA ALA A . n A 1 23 ARG 23 42 42 ARG ARG A . n A 1 24 SER 24 43 43 SER SER A . n A 1 25 LEU 25 44 44 LEU LEU A . n A 1 26 ASP 26 45 45 ASP ASP A . n A 1 27 GLN 27 46 46 GLN GLN A . n A 1 28 GLY 28 47 47 GLY GLY A . n A 1 29 GLY 29 48 48 GLY GLY A . n A 1 30 VAL 30 49 49 VAL VAL A . n A 1 31 LEU 31 50 50 LEU LEU A . n A 1 32 TYR 32 51 51 TYR TYR A . n A 1 33 ALA 33 52 52 ALA ALA A . n A 1 34 GLU 34 53 53 GLU GLU A . n A 1 35 HIS 35 54 54 HIS HIS A . n A 1 36 CYS 36 55 55 CYS CYS A . n A 1 37 VAL 37 56 56 VAL VAL A . n A 1 38 ARG 38 57 57 ARG ARG A . n A 1 39 CYS 39 58 58 CYS CYS A . n A 1 40 HIS 40 59 59 HIS HIS A . n A 1 41 GLY 41 60 60 GLY GLY A . n A 1 42 GLU 42 61 61 GLU GLU A . n A 1 43 THR 43 62 62 THR THR A . n A 1 44 LEU 44 63 63 LEU LEU A . n A 1 45 ARG 45 64 64 ARG ARG A . n A 1 46 GLY 46 65 65 GLY GLY A . n A 1 47 ASP 47 66 66 ASP ASP A . n A 1 48 GLY 48 67 67 GLY GLY A . n A 1 49 PRO 49 68 68 PRO PRO A . n A 1 50 ASP 50 69 69 ASP ASP A . n A 1 51 ALA 51 70 70 ALA ALA A . n A 1 52 HIS 52 71 71 HIS HIS A . n A 1 53 ASP 53 72 72 ASP ASP A . n A 1 54 LEU 54 73 73 LEU LEU A . n A 1 55 ASP 55 74 74 ASP ASP A . n A 1 56 PRO 56 75 75 PRO PRO A . n A 1 57 PRO 57 76 76 PRO PRO A . n A 1 58 VAL 58 77 77 VAL VAL A . n A 1 59 ALA 59 78 78 ALA ALA A . n A 1 60 ASP 60 79 79 ASP ASP A . n A 1 61 LEU 61 80 80 LEU LEU A . n A 1 62 VAL 62 81 81 VAL VAL A . n A 1 63 GLU 63 82 82 GLU GLU A . n A 1 64 HIS 64 83 83 HIS HIS A . n A 1 65 ALA 65 84 84 ALA ALA A . n A 1 66 PRO 66 85 85 PRO PRO A . n A 1 67 HIS 67 86 86 HIS HIS A . n A 1 68 HIS 68 87 87 HIS HIS A . n A 1 69 SER 69 88 88 SER SER A . n A 1 70 ASP 70 89 89 ASP ASP A . n A 1 71 GLY 71 90 90 GLY GLY A . n A 1 72 ASP 72 91 91 ASP ASP A . n A 1 73 LEU 73 92 92 LEU LEU A . n A 1 74 ALA 74 93 93 ALA ALA A . n A 1 75 TYR 75 94 94 TYR TYR A . n A 1 76 ARG 76 95 95 ARG ARG A . n A 1 77 VAL 77 96 96 VAL VAL A . n A 1 78 ARG 78 97 97 ARG ARG A . n A 1 79 ILE 79 98 98 ILE ILE A . n A 1 80 GLY 80 99 99 GLY GLY A . n A 1 81 ARG 81 100 100 ARG ARG A . n A 1 82 GLY 82 101 101 GLY GLY A . n A 1 83 PRO 83 102 102 PRO PRO A . n A 1 84 MET 84 103 103 MET MET A . n A 1 85 PRO 85 104 104 PRO PRO A . n A 1 86 GLY 86 105 105 GLY GLY A . n A 1 87 PHE 87 106 106 PHE PHE A . n A 1 88 GLY 88 107 107 GLY GLY A . n A 1 89 ASP 89 108 108 ASP ASP A . n A 1 90 ALA 90 109 109 ALA ALA A . n A 1 91 LEU 91 110 110 LEU LEU A . n A 1 92 ASP 92 111 111 ASP ASP A . n A 1 93 GLU 93 112 112 GLU GLU A . n A 1 94 ARG 94 113 113 ARG ARG A . n A 1 95 ASP 95 114 114 ASP ASP A . n A 1 96 ILE 96 115 115 ILE ILE A . n A 1 97 TRP 97 116 116 TRP TRP A . n A 1 98 ASP 98 117 117 ASP ASP A . n A 1 99 LEU 99 118 118 LEU LEU A . n A 1 100 VAL 100 119 119 VAL VAL A . n A 1 101 ASN 101 120 120 ASN ASN A . n A 1 102 PHE 102 121 121 PHE PHE A . n A 1 103 MET 103 122 122 MET MET A . n A 1 104 ARG 104 123 123 ARG ARG A . n A 1 105 ASP 105 124 124 ASP ASP A . n A 1 106 ARG 106 125 125 ARG ARG A . n A 1 107 ALA 107 126 126 ALA ALA A . n A 1 108 GLN 108 127 127 GLN GLN A . n A 1 109 GLY 109 128 128 GLY GLY A . n A 1 110 ALA 110 129 129 ALA ALA A . n A 1 111 ALA 111 130 130 ALA ALA A . n A 1 112 LEU 112 131 131 LEU LEU A . n A 1 113 ALA 113 132 132 ALA ALA A . n A 1 114 GLY 114 133 133 GLY GLY A . n A 1 115 THR 115 134 134 THR THR A . n A 1 116 ASN 116 135 135 ASN ASN A . n A 1 117 GLY 117 136 136 GLY GLY A . n A 1 118 LEU 118 137 ? ? ? A . n A 1 119 GLU 119 138 ? ? ? A . n A 1 120 HIS 120 139 ? ? ? A . n A 1 121 HIS 121 140 ? ? ? A . n A 1 122 HIS 122 141 ? ? ? A . n A 1 123 HIS 123 142 ? ? ? A . n A 1 124 HIS 124 143 ? ? ? A . n A 1 125 HIS 125 144 ? ? ? A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id HEC _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id HEC _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id HEC _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 201 _pdbx_nonpoly_scheme.auth_seq_num 145 _pdbx_nonpoly_scheme.pdb_mon_id HEC _pdbx_nonpoly_scheme.auth_mon_id HEC _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9VR0 _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 9VR0 _struct.title 'NMR solution structure of termini-truncated oxidized cytochrome c552 from Thioalkalivibrio paradoxus' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9VR0 _struct_keywords.text 'thiocyanate dehydrogenase electron acceptor, cytochrome c552, class I cytochrome c, hemeprotein, periplasmic, ELECTRON TRANSPORT' _struct_keywords.pdbx_keywords 'ELECTRON TRANSPORT' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A8J0PCM1_9GAMM _struct_ref.pdbx_db_accession A0A8J0PCM1 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;GSGWEVPEAEIHRENPIPPDARSLDQGGVLYAEHCVRCHGETLRGDGPDAHDLDPPVADLVEHAPHHSDGDLAYRVRIGR GPMPGFGDALDERDIWDLVNFMRDRAQGAALAGTNG ; _struct_ref.pdbx_align_begin 21 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9VR0 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 117 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A8J0PCM1 _struct_ref_seq.db_align_beg 21 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 136 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 21 _struct_ref_seq.pdbx_auth_seq_align_end 136 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9VR0 MET A 1 ? UNP A0A8J0PCM1 ? ? 'initiating methionine' 20 1 1 9VR0 LEU A 118 ? UNP A0A8J0PCM1 ? ? 'expression tag' 137 2 1 9VR0 GLU A 119 ? UNP A0A8J0PCM1 ? ? 'expression tag' 138 3 1 9VR0 HIS A 120 ? UNP A0A8J0PCM1 ? ? 'expression tag' 139 4 1 9VR0 HIS A 121 ? UNP A0A8J0PCM1 ? ? 'expression tag' 140 5 1 9VR0 HIS A 122 ? UNP A0A8J0PCM1 ? ? 'expression tag' 141 6 1 9VR0 HIS A 123 ? UNP A0A8J0PCM1 ? ? 'expression tag' 142 7 1 9VR0 HIS A 124 ? UNP A0A8J0PCM1 ? ? 'expression tag' 143 8 1 9VR0 HIS A 125 ? UNP A0A8J0PCM1 ? ? 'expression tag' 144 9 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details 'not applicable' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0 _pdbx_struct_oper_list.matrix[1][2] 0.0 _pdbx_struct_oper_list.matrix[1][3] 0.0 _pdbx_struct_oper_list.vector[1] 0.0 _pdbx_struct_oper_list.matrix[2][1] 0.0 _pdbx_struct_oper_list.matrix[2][2] 1.0 _pdbx_struct_oper_list.matrix[2][3] 0.0 _pdbx_struct_oper_list.vector[2] 0.0 _pdbx_struct_oper_list.matrix[3][1] 0.0 _pdbx_struct_oper_list.matrix[3][2] 0.0 _pdbx_struct_oper_list.matrix[3][3] 1.0 _pdbx_struct_oper_list.vector[3] 0.0 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 8 ? HIS A 13 ? PRO A 27 HIS A 32 1 ? 6 HELX_P HELX_P2 AA2 ASP A 21 ? HIS A 35 ? ASP A 40 HIS A 54 1 ? 15 HELX_P HELX_P3 AA3 CYS A 36 ? GLY A 41 ? CYS A 55 GLY A 60 1 ? 6 HELX_P HELX_P4 AA4 GLY A 48 ? ASP A 53 ? GLY A 67 ASP A 72 5 ? 6 HELX_P HELX_P5 AA5 ASP A 60 ? HIS A 68 ? ASP A 79 HIS A 87 1 ? 9 HELX_P HELX_P6 AA6 SER A 69 ? GLY A 80 ? SER A 88 GLY A 99 1 ? 12 HELX_P HELX_P7 AA7 ASP A 92 ? ALA A 113 ? ASP A 111 ALA A 132 1 ? 22 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale none ? A CYS 36 SG ? ? ? 1_555 B HEC . CAB ? ? A CYS 55 A HEC 201 1_555 ? ? ? ? ? ? ? 1.812 ? ? covale2 covale none ? A CYS 39 SG ? ? ? 1_555 B HEC . CAC ? ? A CYS 58 A HEC 201 1_555 ? ? ? ? ? ? ? 1.816 ? ? metalc1 metalc ? ? A HIS 40 NE2 ? ? ? 1_555 B HEC . FE ? ? A HIS 59 A HEC 201 1_555 ? ? ? ? ? ? ? 1.962 ? ? metalc2 metalc ? ? A MET 84 SD ? ? ? 1_555 B HEC . FE ? ? A MET 103 A HEC 201 1_555 ? ? ? ? ? ? ? 2.449 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 40 ? A HIS 59 ? 1_555 FE ? B HEC . ? A HEC 201 ? 1_555 NA ? B HEC . ? A HEC 201 ? 1_555 89.8 ? 2 NE2 ? A HIS 40 ? A HIS 59 ? 1_555 FE ? B HEC . ? A HEC 201 ? 1_555 NB ? B HEC . ? A HEC 201 ? 1_555 89.3 ? 3 NA ? B HEC . ? A HEC 201 ? 1_555 FE ? B HEC . ? A HEC 201 ? 1_555 NB ? B HEC . ? A HEC 201 ? 1_555 90.0 ? 4 NE2 ? A HIS 40 ? A HIS 59 ? 1_555 FE ? B HEC . ? A HEC 201 ? 1_555 NC ? B HEC . ? A HEC 201 ? 1_555 89.7 ? 5 NA ? B HEC . ? A HEC 201 ? 1_555 FE ? B HEC . ? A HEC 201 ? 1_555 NC ? B HEC . ? A HEC 201 ? 1_555 179.5 ? 6 NB ? B HEC . ? A HEC 201 ? 1_555 FE ? B HEC . ? A HEC 201 ? 1_555 NC ? B HEC . ? A HEC 201 ? 1_555 90.0 ? 7 NE2 ? A HIS 40 ? A HIS 59 ? 1_555 FE ? B HEC . ? A HEC 201 ? 1_555 ND ? B HEC . ? A HEC 201 ? 1_555 90.2 ? 8 NA ? B HEC . ? A HEC 201 ? 1_555 FE ? B HEC . ? A HEC 201 ? 1_555 ND ? B HEC . ? A HEC 201 ? 1_555 89.9 ? 9 NB ? B HEC . ? A HEC 201 ? 1_555 FE ? B HEC . ? A HEC 201 ? 1_555 ND ? B HEC . ? A HEC 201 ? 1_555 179.5 ? 10 NC ? B HEC . ? A HEC 201 ? 1_555 FE ? B HEC . ? A HEC 201 ? 1_555 ND ? B HEC . ? A HEC 201 ? 1_555 90.0 ? 11 NE2 ? A HIS 40 ? A HIS 59 ? 1_555 FE ? B HEC . ? A HEC 201 ? 1_555 SD ? A MET 84 ? A MET 103 ? 1_555 175.3 ? 12 NA ? B HEC . ? A HEC 201 ? 1_555 FE ? B HEC . ? A HEC 201 ? 1_555 SD ? A MET 84 ? A MET 103 ? 1_555 90.1 ? 13 NB ? B HEC . ? A HEC 201 ? 1_555 FE ? B HEC . ? A HEC 201 ? 1_555 SD ? A MET 84 ? A MET 103 ? 1_555 86.1 ? 14 NC ? B HEC . ? A HEC 201 ? 1_555 FE ? B HEC . ? A HEC 201 ? 1_555 SD ? A MET 84 ? A MET 103 ? 1_555 90.4 ? 15 ND ? B HEC . ? A HEC 201 ? 1_555 FE ? B HEC . ? A HEC 201 ? 1_555 SD ? A MET 84 ? A MET 103 ? 1_555 94.4 ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 HEC B . ? CYS A 36 ? HEC A 201 ? 1_555 CYS A 55 ? 1_555 CAB SG CYS 2 HEC None Heme/heme-like 2 HEC B . ? CYS A 39 ? HEC A 201 ? 1_555 CYS A 58 ? 1_555 CAC SG CYS 3 HEC None Heme/heme-like # _pdbx_entry_details.entry_id 9VR0 _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HD1 A HIS 87 ? ? OD1 A ASP 91 ? ? 1.59 2 6 HD1 A HIS 87 ? ? OD1 A ASP 91 ? ? 1.57 3 9 OD2 A ASP 91 ? ? HH12 A ARG 100 ? ? 1.56 4 9 HD1 A HIS 83 ? ? O2A A HEC 201 ? ? 1.60 5 16 HD1 A HIS 83 ? ? O1A A HEC 201 ? ? 1.57 6 20 HH A TYR 51 ? ? HD1 A HIS 59 ? ? 1.23 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 22 ? ? -142.87 34.23 2 1 ASP A 40 ? ? -166.43 -145.40 3 1 HIS A 54 ? ? -127.88 -58.46 4 1 ASP A 74 ? ? -103.97 -63.31 5 1 ALA A 78 ? ? 69.42 151.56 6 1 ARG A 100 ? ? -158.44 78.06 7 2 ASP A 40 ? ? -173.07 -152.99 8 2 ALA A 78 ? ? 74.71 146.82 9 2 ARG A 100 ? ? -170.12 -76.12 10 2 LEU A 131 ? ? -104.50 63.55 11 3 HIS A 59 ? ? -132.89 -30.85 12 3 ASP A 79 ? ? -68.97 97.18 13 3 LEU A 131 ? ? -105.39 65.86 14 4 PRO A 39 ? ? -67.17 90.43 15 4 ASP A 40 ? ? -155.13 -159.98 16 4 ALA A 78 ? ? 72.03 157.47 17 4 ARG A 100 ? ? -167.00 89.14 18 4 ALA A 109 ? ? -138.14 -44.47 19 5 GLU A 25 ? ? -102.85 77.11 20 5 ASP A 40 ? ? -161.30 -164.32 21 5 HIS A 54 ? ? -130.50 -45.03 22 6 PRO A 39 ? ? -65.90 95.29 23 6 ASP A 40 ? ? -160.37 -160.92 24 6 HIS A 54 ? ? -131.91 -48.50 25 6 ARG A 100 ? ? -153.88 37.90 26 7 PRO A 39 ? ? -69.89 78.98 27 7 ALA A 78 ? ? 70.94 149.11 28 8 PRO A 39 ? ? -67.65 79.20 29 8 HIS A 54 ? ? -130.61 -47.54 30 8 ARG A 100 ? ? -145.98 32.83 31 8 LEU A 131 ? ? -81.81 40.45 32 8 ASN A 135 ? ? -136.86 -40.84 33 9 ASP A 40 ? ? -145.43 -157.08 34 9 HIS A 59 ? ? -136.78 -47.37 35 9 ALA A 70 ? ? -87.46 35.34 36 9 ARG A 100 ? ? -166.46 78.86 37 9 PRO A 102 ? ? -91.15 31.31 38 9 ASN A 135 ? ? -136.38 -47.40 39 10 PRO A 39 ? ? -67.55 73.89 40 10 ASP A 40 ? ? -133.63 -158.68 41 10 ARG A 100 ? ? -162.87 90.01 42 10 LEU A 131 ? ? -95.01 38.55 43 11 PRO A 39 ? ? -61.50 93.92 44 11 ASP A 79 ? ? -69.05 98.10 45 11 ARG A 100 ? ? 178.19 124.36 46 12 PRO A 39 ? ? -66.27 78.98 47 12 ASP A 40 ? ? -132.64 -158.97 48 12 HIS A 54 ? ? -130.86 -35.51 49 12 ARG A 100 ? ? -170.00 96.50 50 12 ALA A 109 ? ? -129.32 -52.36 51 13 PRO A 39 ? ? -67.16 79.90 52 13 ARG A 100 ? ? -163.01 70.10 53 13 LEU A 131 ? ? -101.87 47.52 54 14 ASP A 40 ? ? -146.92 -132.94 55 14 HIS A 54 ? ? -130.66 -40.61 56 14 ARG A 100 ? ? -151.57 38.54 57 14 LEU A 131 ? ? -92.44 51.51 58 15 GLU A 25 ? ? -105.17 78.68 59 15 PRO A 39 ? ? -68.01 76.35 60 15 ARG A 100 ? ? -171.67 118.24 61 16 PRO A 39 ? ? -67.09 79.33 62 16 HIS A 59 ? ? -145.73 -43.69 63 17 PRO A 39 ? ? -63.71 86.95 64 17 ALA A 109 ? ? -135.79 -62.55 65 18 GLU A 25 ? ? -106.17 78.27 66 18 PRO A 39 ? ? -63.07 92.79 67 18 HIS A 54 ? ? -132.21 -50.55 68 18 LEU A 131 ? ? -85.09 -72.40 69 19 SER A 22 ? ? -151.51 82.97 70 19 PRO A 39 ? ? -66.84 84.46 71 19 ASP A 40 ? ? -150.48 -159.02 72 19 ALA A 70 ? ? -87.50 34.63 73 19 HIS A 71 ? ? -130.14 -32.14 74 19 ARG A 100 ? ? -173.69 97.35 75 20 PRO A 39 ? ? -69.66 78.93 76 20 HIS A 54 ? ? -131.39 -31.44 77 20 ASP A 79 ? ? -68.61 98.49 78 20 ARG A 100 ? ? -166.44 103.66 79 20 PRO A 102 ? ? -88.22 30.89 # _pdbx_nmr_ensemble.entry_id 9VR0 _pdbx_nmr_ensemble.conformers_calculated_total_number 128 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 9VR0 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria medoid # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '0.6 mM [U-100% 13C; U-100% 15N] Cytochrome c552, 50 mM sodium phosphate buffer, 95% H2O/5% D2O' '95% H2O/5% D2O' 15N_13C_sample solution ? 2 '0.6 mM Cytochrome c552, 50 mM sodium phosphate buffer, 95% H2O/5% D2O' '95% H2O/5% D2O' unlabeled_sample solution ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'Cytochrome c552' 0.6 ? mM '[U-100% 13C; U-100% 15N]' 1 'sodium phosphate buffer' 50 ? mM 'natural abundance' 2 'Cytochrome c552' 0.6 ? mM 'natural abundance' 2 'sodium phosphate buffer' 50 ? mM 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 50 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 1 '2D 1H-13C HSQC aliphatic' 1 isotropic 3 1 1 '2D 1H-13C HSQC aromatic' 1 isotropic 4 1 1 '3D 1H-15N NOESY' 1 isotropic 5 1 1 '3D 1H-15N TOCSY' 1 isotropic 6 1 1 '3D 1H-13C NOESY aliphatic' 1 isotropic 7 1 1 '3D HNCA' 1 isotropic 8 1 1 '3D HN(CO)CA' 1 isotropic 9 1 1 '3D HNCO' 1 isotropic 10 1 1 '3D HCACO' 1 isotropic 11 1 1 '3D HNHA' 1 isotropic 12 1 1 '3D HCCH-TOCSY' 1 isotropic 13 1 1 '3D HNCACB' 1 isotropic 14 1 1 '3D HBHA(CO)NH' 1 isotropic 15 1 1 '3D H(CCO)NH' 1 isotropic 16 1 2 '2D 1H-1H NOESY' 1 isotropic 17 1 2 '2D 1H-1H TOCSY' 1 isotropic # _pdbx_nmr_refine.entry_id 9VR0 _pdbx_nmr_refine.method 'molecular dynamics' _pdbx_nmr_refine.details 'explicit water refinment' _pdbx_nmr_refine.software_ordinal 2 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'chemical shift assignment' 'CcpNmr Analysis' 2.5.2 CCPN 2 refinement CNS 1.3 'Brunger, Adams, Clore, Gros, Nilges and Read' 3 'structure calculation' CNS 1.3 'Brunger, Adams, Clore, Gros, Nilges and Read' 4 'chemical shift assignment' ARIA 2.3 ;Linge, O'Donoghue and Nilges ; 5 'peak picking' 'CcpNmr Analysis' 2.5.2 CCPN 6 collection TopSpin 3.2 'Bruker Biospin' 7 processing TopSpin 3.2 'Bruker Biospin' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 20 ? A MET 1 2 1 Y 1 A LEU 137 ? A LEU 118 3 1 Y 1 A GLU 138 ? A GLU 119 4 1 Y 1 A HIS 139 ? A HIS 120 5 1 Y 1 A HIS 140 ? A HIS 121 6 1 Y 1 A HIS 141 ? A HIS 122 7 1 Y 1 A HIS 142 ? A HIS 123 8 1 Y 1 A HIS 143 ? A HIS 124 9 1 Y 1 A HIS 144 ? A HIS 125 10 2 Y 1 A MET 20 ? A MET 1 11 2 Y 1 A LEU 137 ? A LEU 118 12 2 Y 1 A GLU 138 ? A GLU 119 13 2 Y 1 A HIS 139 ? A HIS 120 14 2 Y 1 A HIS 140 ? A HIS 121 15 2 Y 1 A HIS 141 ? A HIS 122 16 2 Y 1 A HIS 142 ? A HIS 123 17 2 Y 1 A HIS 143 ? A HIS 124 18 2 Y 1 A HIS 144 ? A HIS 125 19 3 Y 1 A MET 20 ? A MET 1 20 3 Y 1 A LEU 137 ? A LEU 118 21 3 Y 1 A GLU 138 ? A GLU 119 22 3 Y 1 A HIS 139 ? A HIS 120 23 3 Y 1 A HIS 140 ? A HIS 121 24 3 Y 1 A HIS 141 ? A HIS 122 25 3 Y 1 A HIS 142 ? A HIS 123 26 3 Y 1 A HIS 143 ? A HIS 124 27 3 Y 1 A HIS 144 ? A HIS 125 28 4 Y 1 A MET 20 ? A MET 1 29 4 Y 1 A LEU 137 ? A LEU 118 30 4 Y 1 A GLU 138 ? A GLU 119 31 4 Y 1 A HIS 139 ? A HIS 120 32 4 Y 1 A HIS 140 ? A HIS 121 33 4 Y 1 A HIS 141 ? A HIS 122 34 4 Y 1 A HIS 142 ? A HIS 123 35 4 Y 1 A HIS 143 ? A HIS 124 36 4 Y 1 A HIS 144 ? A HIS 125 37 5 Y 1 A MET 20 ? A MET 1 38 5 Y 1 A LEU 137 ? A LEU 118 39 5 Y 1 A GLU 138 ? A GLU 119 40 5 Y 1 A HIS 139 ? A HIS 120 41 5 Y 1 A HIS 140 ? A HIS 121 42 5 Y 1 A HIS 141 ? A HIS 122 43 5 Y 1 A HIS 142 ? A HIS 123 44 5 Y 1 A HIS 143 ? A HIS 124 45 5 Y 1 A HIS 144 ? A HIS 125 46 6 Y 1 A MET 20 ? A MET 1 47 6 Y 1 A LEU 137 ? A LEU 118 48 6 Y 1 A GLU 138 ? A GLU 119 49 6 Y 1 A HIS 139 ? A HIS 120 50 6 Y 1 A HIS 140 ? A HIS 121 51 6 Y 1 A HIS 141 ? A HIS 122 52 6 Y 1 A HIS 142 ? A HIS 123 53 6 Y 1 A HIS 143 ? A HIS 124 54 6 Y 1 A HIS 144 ? A HIS 125 55 7 Y 1 A MET 20 ? A MET 1 56 7 Y 1 A LEU 137 ? A LEU 118 57 7 Y 1 A GLU 138 ? A GLU 119 58 7 Y 1 A HIS 139 ? A HIS 120 59 7 Y 1 A HIS 140 ? A HIS 121 60 7 Y 1 A HIS 141 ? A HIS 122 61 7 Y 1 A HIS 142 ? A HIS 123 62 7 Y 1 A HIS 143 ? A HIS 124 63 7 Y 1 A HIS 144 ? A HIS 125 64 8 Y 1 A MET 20 ? A MET 1 65 8 Y 1 A LEU 137 ? A LEU 118 66 8 Y 1 A GLU 138 ? A GLU 119 67 8 Y 1 A HIS 139 ? A HIS 120 68 8 Y 1 A HIS 140 ? A HIS 121 69 8 Y 1 A HIS 141 ? A HIS 122 70 8 Y 1 A HIS 142 ? A HIS 123 71 8 Y 1 A HIS 143 ? A HIS 124 72 8 Y 1 A HIS 144 ? A HIS 125 73 9 Y 1 A MET 20 ? A MET 1 74 9 Y 1 A LEU 137 ? A LEU 118 75 9 Y 1 A GLU 138 ? A GLU 119 76 9 Y 1 A HIS 139 ? A HIS 120 77 9 Y 1 A HIS 140 ? A HIS 121 78 9 Y 1 A HIS 141 ? A HIS 122 79 9 Y 1 A HIS 142 ? A HIS 123 80 9 Y 1 A HIS 143 ? A HIS 124 81 9 Y 1 A HIS 144 ? A HIS 125 82 10 Y 1 A MET 20 ? A MET 1 83 10 Y 1 A LEU 137 ? A LEU 118 84 10 Y 1 A GLU 138 ? A GLU 119 85 10 Y 1 A HIS 139 ? A HIS 120 86 10 Y 1 A HIS 140 ? A HIS 121 87 10 Y 1 A HIS 141 ? A HIS 122 88 10 Y 1 A HIS 142 ? A HIS 123 89 10 Y 1 A HIS 143 ? A HIS 124 90 10 Y 1 A HIS 144 ? A HIS 125 91 11 Y 1 A MET 20 ? A MET 1 92 11 Y 1 A LEU 137 ? A LEU 118 93 11 Y 1 A GLU 138 ? A GLU 119 94 11 Y 1 A HIS 139 ? A HIS 120 95 11 Y 1 A HIS 140 ? A HIS 121 96 11 Y 1 A HIS 141 ? A HIS 122 97 11 Y 1 A HIS 142 ? A HIS 123 98 11 Y 1 A HIS 143 ? A HIS 124 99 11 Y 1 A HIS 144 ? A HIS 125 100 12 Y 1 A MET 20 ? A MET 1 101 12 Y 1 A LEU 137 ? A LEU 118 102 12 Y 1 A GLU 138 ? A GLU 119 103 12 Y 1 A HIS 139 ? A HIS 120 104 12 Y 1 A HIS 140 ? A HIS 121 105 12 Y 1 A HIS 141 ? A HIS 122 106 12 Y 1 A HIS 142 ? A HIS 123 107 12 Y 1 A HIS 143 ? A HIS 124 108 12 Y 1 A HIS 144 ? A HIS 125 109 13 Y 1 A MET 20 ? A MET 1 110 13 Y 1 A LEU 137 ? A LEU 118 111 13 Y 1 A GLU 138 ? A GLU 119 112 13 Y 1 A HIS 139 ? A HIS 120 113 13 Y 1 A HIS 140 ? A HIS 121 114 13 Y 1 A HIS 141 ? A HIS 122 115 13 Y 1 A HIS 142 ? A HIS 123 116 13 Y 1 A HIS 143 ? A HIS 124 117 13 Y 1 A HIS 144 ? A HIS 125 118 14 Y 1 A MET 20 ? A MET 1 119 14 Y 1 A LEU 137 ? A LEU 118 120 14 Y 1 A GLU 138 ? A GLU 119 121 14 Y 1 A HIS 139 ? A HIS 120 122 14 Y 1 A HIS 140 ? A HIS 121 123 14 Y 1 A HIS 141 ? A HIS 122 124 14 Y 1 A HIS 142 ? A HIS 123 125 14 Y 1 A HIS 143 ? A HIS 124 126 14 Y 1 A HIS 144 ? A HIS 125 127 15 Y 1 A MET 20 ? A MET 1 128 15 Y 1 A LEU 137 ? A LEU 118 129 15 Y 1 A GLU 138 ? A GLU 119 130 15 Y 1 A HIS 139 ? A HIS 120 131 15 Y 1 A HIS 140 ? A HIS 121 132 15 Y 1 A HIS 141 ? A HIS 122 133 15 Y 1 A HIS 142 ? A HIS 123 134 15 Y 1 A HIS 143 ? A HIS 124 135 15 Y 1 A HIS 144 ? A HIS 125 136 16 Y 1 A MET 20 ? A MET 1 137 16 Y 1 A LEU 137 ? A LEU 118 138 16 Y 1 A GLU 138 ? A GLU 119 139 16 Y 1 A HIS 139 ? A HIS 120 140 16 Y 1 A HIS 140 ? A HIS 121 141 16 Y 1 A HIS 141 ? A HIS 122 142 16 Y 1 A HIS 142 ? A HIS 123 143 16 Y 1 A HIS 143 ? A HIS 124 144 16 Y 1 A HIS 144 ? A HIS 125 145 17 Y 1 A MET 20 ? A MET 1 146 17 Y 1 A LEU 137 ? A LEU 118 147 17 Y 1 A GLU 138 ? A GLU 119 148 17 Y 1 A HIS 139 ? A HIS 120 149 17 Y 1 A HIS 140 ? A HIS 121 150 17 Y 1 A HIS 141 ? A HIS 122 151 17 Y 1 A HIS 142 ? A HIS 123 152 17 Y 1 A HIS 143 ? A HIS 124 153 17 Y 1 A HIS 144 ? A HIS 125 154 18 Y 1 A MET 20 ? A MET 1 155 18 Y 1 A LEU 137 ? A LEU 118 156 18 Y 1 A GLU 138 ? A GLU 119 157 18 Y 1 A HIS 139 ? A HIS 120 158 18 Y 1 A HIS 140 ? A HIS 121 159 18 Y 1 A HIS 141 ? A HIS 122 160 18 Y 1 A HIS 142 ? A HIS 123 161 18 Y 1 A HIS 143 ? A HIS 124 162 18 Y 1 A HIS 144 ? A HIS 125 163 19 Y 1 A MET 20 ? A MET 1 164 19 Y 1 A LEU 137 ? A LEU 118 165 19 Y 1 A GLU 138 ? A GLU 119 166 19 Y 1 A HIS 139 ? A HIS 120 167 19 Y 1 A HIS 140 ? A HIS 121 168 19 Y 1 A HIS 141 ? A HIS 122 169 19 Y 1 A HIS 142 ? A HIS 123 170 19 Y 1 A HIS 143 ? A HIS 124 171 19 Y 1 A HIS 144 ? A HIS 125 172 20 Y 1 A MET 20 ? A MET 1 173 20 Y 1 A LEU 137 ? A LEU 118 174 20 Y 1 A GLU 138 ? A GLU 119 175 20 Y 1 A HIS 139 ? A HIS 120 176 20 Y 1 A HIS 140 ? A HIS 121 177 20 Y 1 A HIS 141 ? A HIS 122 178 20 Y 1 A HIS 142 ? A HIS 123 179 20 Y 1 A HIS 143 ? A HIS 124 180 20 Y 1 A HIS 144 ? A HIS 125 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HEC FE FE N N 137 HEC CHA C N N 138 HEC CHB C N N 139 HEC CHC C N N 140 HEC CHD C N N 141 HEC NA N Y N 142 HEC C1A C Y N 143 HEC C2A C Y N 144 HEC C3A C Y N 145 HEC C4A C Y N 146 HEC CMA C N N 147 HEC CAA C N N 148 HEC CBA C N N 149 HEC CGA C N N 150 HEC O1A O N N 151 HEC O2A O N N 152 HEC NB N Y N 153 HEC C1B C Y N 154 HEC C2B C Y N 155 HEC C3B C Y N 156 HEC C4B C Y N 157 HEC CMB C N N 158 HEC CAB C N N 159 HEC CBB C N N 160 HEC NC N Y N 161 HEC C1C C Y N 162 HEC C2C C Y N 163 HEC C3C C Y N 164 HEC C4C C Y N 165 HEC CMC C N N 166 HEC CAC C N N 167 HEC CBC C N N 168 HEC ND N Y N 169 HEC C1D C Y N 170 HEC C2D C Y N 171 HEC C3D C Y N 172 HEC C4D C Y N 173 HEC CMD C N N 174 HEC CAD C N N 175 HEC CBD C N N 176 HEC CGD C N N 177 HEC O1D O N N 178 HEC O2D O N N 179 HEC HHA H N N 180 HEC HHB H N N 181 HEC HHC H N N 182 HEC HHD H N N 183 HEC HMA1 H N N 184 HEC HMA2 H N N 185 HEC HMA3 H N N 186 HEC HAA1 H N N 187 HEC HAA2 H N N 188 HEC HBA1 H N N 189 HEC HBA2 H N N 190 HEC H2A H N N 191 HEC HMB1 H N N 192 HEC HMB2 H N N 193 HEC HMB3 H N N 194 HEC HAB H N N 195 HEC HBB1 H N N 196 HEC HBB2 H N N 197 HEC HBB3 H N N 198 HEC HMC1 H N N 199 HEC HMC2 H N N 200 HEC HMC3 H N N 201 HEC HAC H N N 202 HEC HBC1 H N N 203 HEC HBC2 H N N 204 HEC HBC3 H N N 205 HEC HMD1 H N N 206 HEC HMD2 H N N 207 HEC HMD3 H N N 208 HEC HAD1 H N N 209 HEC HAD2 H N N 210 HEC HBD1 H N N 211 HEC HBD2 H N N 212 HEC H2D H N N 213 HIS N N N N 214 HIS CA C N S 215 HIS C C N N 216 HIS O O N N 217 HIS CB C N N 218 HIS CG C Y N 219 HIS ND1 N Y N 220 HIS CD2 C Y N 221 HIS CE1 C Y N 222 HIS NE2 N Y N 223 HIS OXT O N N 224 HIS H H N N 225 HIS H2 H N N 226 HIS HA H N N 227 HIS HB2 H N N 228 HIS HB3 H N N 229 HIS HD1 H N N 230 HIS HD2 H N N 231 HIS HE1 H N N 232 HIS HE2 H N N 233 HIS HXT H N N 234 ILE N N N N 235 ILE CA C N S 236 ILE C C N N 237 ILE O O N N 238 ILE CB C N S 239 ILE CG1 C N N 240 ILE CG2 C N N 241 ILE CD1 C N N 242 ILE OXT O N N 243 ILE H H N N 244 ILE H2 H N N 245 ILE HA H N N 246 ILE HB H N N 247 ILE HG12 H N N 248 ILE HG13 H N N 249 ILE HG21 H N N 250 ILE HG22 H N N 251 ILE HG23 H N N 252 ILE HD11 H N N 253 ILE HD12 H N N 254 ILE HD13 H N N 255 ILE HXT H N N 256 LEU N N N N 257 LEU CA C N S 258 LEU C C N N 259 LEU O O N N 260 LEU CB C N N 261 LEU CG C N N 262 LEU CD1 C N N 263 LEU CD2 C N N 264 LEU OXT O N N 265 LEU H H N N 266 LEU H2 H N N 267 LEU HA H N N 268 LEU HB2 H N N 269 LEU HB3 H N N 270 LEU HG H N N 271 LEU HD11 H N N 272 LEU HD12 H N N 273 LEU HD13 H N N 274 LEU HD21 H N N 275 LEU HD22 H N N 276 LEU HD23 H N N 277 LEU HXT H N N 278 MET N N N N 279 MET CA C N S 280 MET C C N N 281 MET O O N N 282 MET CB C N N 283 MET CG C N N 284 MET SD S N N 285 MET CE C N N 286 MET OXT O N N 287 MET H H N N 288 MET H2 H N N 289 MET HA H N N 290 MET HB2 H N N 291 MET HB3 H N N 292 MET HG2 H N N 293 MET HG3 H N N 294 MET HE1 H N N 295 MET HE2 H N N 296 MET HE3 H N N 297 MET HXT H N N 298 PHE N N N N 299 PHE CA C N S 300 PHE C C N N 301 PHE O O N N 302 PHE CB C N N 303 PHE CG C Y N 304 PHE CD1 C Y N 305 PHE CD2 C Y N 306 PHE CE1 C Y N 307 PHE CE2 C Y N 308 PHE CZ C Y N 309 PHE OXT O N N 310 PHE H H N N 311 PHE H2 H N N 312 PHE HA H N N 313 PHE HB2 H N N 314 PHE HB3 H N N 315 PHE HD1 H N N 316 PHE HD2 H N N 317 PHE HE1 H N N 318 PHE HE2 H N N 319 PHE HZ H N N 320 PHE HXT H N N 321 PRO N N N N 322 PRO CA C N S 323 PRO C C N N 324 PRO O O N N 325 PRO CB C N N 326 PRO CG C N N 327 PRO CD C N N 328 PRO OXT O N N 329 PRO H H N N 330 PRO HA H N N 331 PRO HB2 H N N 332 PRO HB3 H N N 333 PRO HG2 H N N 334 PRO HG3 H N N 335 PRO HD2 H N N 336 PRO HD3 H N N 337 PRO HXT H N N 338 SER N N N N 339 SER CA C N S 340 SER C C N N 341 SER O O N N 342 SER CB C N N 343 SER OG O N N 344 SER OXT O N N 345 SER H H N N 346 SER H2 H N N 347 SER HA H N N 348 SER HB2 H N N 349 SER HB3 H N N 350 SER HG H N N 351 SER HXT H N N 352 THR N N N N 353 THR CA C N S 354 THR C C N N 355 THR O O N N 356 THR CB C N R 357 THR OG1 O N N 358 THR CG2 C N N 359 THR OXT O N N 360 THR H H N N 361 THR H2 H N N 362 THR HA H N N 363 THR HB H N N 364 THR HG1 H N N 365 THR HG21 H N N 366 THR HG22 H N N 367 THR HG23 H N N 368 THR HXT H N N 369 TRP N N N N 370 TRP CA C N S 371 TRP C C N N 372 TRP O O N N 373 TRP CB C N N 374 TRP CG C Y N 375 TRP CD1 C Y N 376 TRP CD2 C Y N 377 TRP NE1 N Y N 378 TRP CE2 C Y N 379 TRP CE3 C Y N 380 TRP CZ2 C Y N 381 TRP CZ3 C Y N 382 TRP CH2 C Y N 383 TRP OXT O N N 384 TRP H H N N 385 TRP H2 H N N 386 TRP HA H N N 387 TRP HB2 H N N 388 TRP HB3 H N N 389 TRP HD1 H N N 390 TRP HE1 H N N 391 TRP HE3 H N N 392 TRP HZ2 H N N 393 TRP HZ3 H N N 394 TRP HH2 H N N 395 TRP HXT H N N 396 TYR N N N N 397 TYR CA C N S 398 TYR C C N N 399 TYR O O N N 400 TYR CB C N N 401 TYR CG C Y N 402 TYR CD1 C Y N 403 TYR CD2 C Y N 404 TYR CE1 C Y N 405 TYR CE2 C Y N 406 TYR CZ C Y N 407 TYR OH O N N 408 TYR OXT O N N 409 TYR H H N N 410 TYR H2 H N N 411 TYR HA H N N 412 TYR HB2 H N N 413 TYR HB3 H N N 414 TYR HD1 H N N 415 TYR HD2 H N N 416 TYR HE1 H N N 417 TYR HE2 H N N 418 TYR HH H N N 419 TYR HXT H N N 420 VAL N N N N 421 VAL CA C N S 422 VAL C C N N 423 VAL O O N N 424 VAL CB C N N 425 VAL CG1 C N N 426 VAL CG2 C N N 427 VAL OXT O N N 428 VAL H H N N 429 VAL H2 H N N 430 VAL HA H N N 431 VAL HB H N N 432 VAL HG11 H N N 433 VAL HG12 H N N 434 VAL HG13 H N N 435 VAL HG21 H N N 436 VAL HG22 H N N 437 VAL HG23 H N N 438 VAL HXT H N N 439 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HEC FE NA sing N N 129 HEC FE NB sing N N 130 HEC FE NC sing N N 131 HEC FE ND sing N N 132 HEC CHA C1A doub N N 133 HEC CHA C4D sing N N 134 HEC CHA HHA sing N N 135 HEC CHB C4A doub N N 136 HEC CHB C1B sing N N 137 HEC CHB HHB sing N N 138 HEC CHC C4B doub N N 139 HEC CHC C1C sing N N 140 HEC CHC HHC sing N N 141 HEC CHD C4C doub N N 142 HEC CHD C1D sing N N 143 HEC CHD HHD sing N N 144 HEC NA C1A sing Y N 145 HEC NA C4A sing Y N 146 HEC C1A C2A sing Y N 147 HEC C2A C3A doub Y N 148 HEC C2A CAA sing N N 149 HEC C3A C4A sing Y N 150 HEC C3A CMA sing N N 151 HEC CMA HMA1 sing N N 152 HEC CMA HMA2 sing N N 153 HEC CMA HMA3 sing N N 154 HEC CAA CBA sing N N 155 HEC CAA HAA1 sing N N 156 HEC CAA HAA2 sing N N 157 HEC CBA CGA sing N N 158 HEC CBA HBA1 sing N N 159 HEC CBA HBA2 sing N N 160 HEC CGA O1A doub N N 161 HEC CGA O2A sing N N 162 HEC O2A H2A sing N N 163 HEC NB C1B sing Y N 164 HEC NB C4B sing Y N 165 HEC C1B C2B doub Y N 166 HEC C2B C3B sing Y N 167 HEC C2B CMB sing N N 168 HEC C3B C4B sing Y N 169 HEC C3B CAB doub N E 170 HEC CMB HMB1 sing N N 171 HEC CMB HMB2 sing N N 172 HEC CMB HMB3 sing N N 173 HEC CAB CBB sing N N 174 HEC CAB HAB sing N N 175 HEC CBB HBB1 sing N N 176 HEC CBB HBB2 sing N N 177 HEC CBB HBB3 sing N N 178 HEC NC C1C sing Y N 179 HEC NC C4C sing Y N 180 HEC C1C C2C doub Y N 181 HEC C2C C3C sing Y N 182 HEC C2C CMC sing N N 183 HEC C3C C4C sing Y N 184 HEC C3C CAC doub N E 185 HEC CMC HMC1 sing N N 186 HEC CMC HMC2 sing N N 187 HEC CMC HMC3 sing N N 188 HEC CAC CBC sing N N 189 HEC CAC HAC sing N N 190 HEC CBC HBC1 sing N N 191 HEC CBC HBC2 sing N N 192 HEC CBC HBC3 sing N N 193 HEC ND C1D sing Y N 194 HEC ND C4D sing Y N 195 HEC C1D C2D doub Y N 196 HEC C2D C3D sing Y N 197 HEC C2D CMD sing N N 198 HEC C3D C4D doub Y N 199 HEC C3D CAD sing N N 200 HEC CMD HMD1 sing N N 201 HEC CMD HMD2 sing N N 202 HEC CMD HMD3 sing N N 203 HEC CAD CBD sing N N 204 HEC CAD HAD1 sing N N 205 HEC CAD HAD2 sing N N 206 HEC CBD CGD sing N N 207 HEC CBD HBD1 sing N N 208 HEC CBD HBD2 sing N N 209 HEC CGD O1D doub N N 210 HEC CGD O2D sing N N 211 HEC O2D H2D sing N N 212 HIS N CA sing N N 213 HIS N H sing N N 214 HIS N H2 sing N N 215 HIS CA C sing N N 216 HIS CA CB sing N N 217 HIS CA HA sing N N 218 HIS C O doub N N 219 HIS C OXT sing N N 220 HIS CB CG sing N N 221 HIS CB HB2 sing N N 222 HIS CB HB3 sing N N 223 HIS CG ND1 sing Y N 224 HIS CG CD2 doub Y N 225 HIS ND1 CE1 doub Y N 226 HIS ND1 HD1 sing N N 227 HIS CD2 NE2 sing Y N 228 HIS CD2 HD2 sing N N 229 HIS CE1 NE2 sing Y N 230 HIS CE1 HE1 sing N N 231 HIS NE2 HE2 sing N N 232 HIS OXT HXT sing N N 233 ILE N CA sing N N 234 ILE N H sing N N 235 ILE N H2 sing N N 236 ILE CA C sing N N 237 ILE CA CB sing N N 238 ILE CA HA sing N N 239 ILE C O doub N N 240 ILE C OXT sing N N 241 ILE CB CG1 sing N N 242 ILE CB CG2 sing N N 243 ILE CB HB sing N N 244 ILE CG1 CD1 sing N N 245 ILE CG1 HG12 sing N N 246 ILE CG1 HG13 sing N N 247 ILE CG2 HG21 sing N N 248 ILE CG2 HG22 sing N N 249 ILE CG2 HG23 sing N N 250 ILE CD1 HD11 sing N N 251 ILE CD1 HD12 sing N N 252 ILE CD1 HD13 sing N N 253 ILE OXT HXT sing N N 254 LEU N CA sing N N 255 LEU N H sing N N 256 LEU N H2 sing N N 257 LEU CA C sing N N 258 LEU CA CB sing N N 259 LEU CA HA sing N N 260 LEU C O doub N N 261 LEU C OXT sing N N 262 LEU CB CG sing N N 263 LEU CB HB2 sing N N 264 LEU CB HB3 sing N N 265 LEU CG CD1 sing N N 266 LEU CG CD2 sing N N 267 LEU CG HG sing N N 268 LEU CD1 HD11 sing N N 269 LEU CD1 HD12 sing N N 270 LEU CD1 HD13 sing N N 271 LEU CD2 HD21 sing N N 272 LEU CD2 HD22 sing N N 273 LEU CD2 HD23 sing N N 274 LEU OXT HXT sing N N 275 MET N CA sing N N 276 MET N H sing N N 277 MET N H2 sing N N 278 MET CA C sing N N 279 MET CA CB sing N N 280 MET CA HA sing N N 281 MET C O doub N N 282 MET C OXT sing N N 283 MET CB CG sing N N 284 MET CB HB2 sing N N 285 MET CB HB3 sing N N 286 MET CG SD sing N N 287 MET CG HG2 sing N N 288 MET CG HG3 sing N N 289 MET SD CE sing N N 290 MET CE HE1 sing N N 291 MET CE HE2 sing N N 292 MET CE HE3 sing N N 293 MET OXT HXT sing N N 294 PHE N CA sing N N 295 PHE N H sing N N 296 PHE N H2 sing N N 297 PHE CA C sing N N 298 PHE CA CB sing N N 299 PHE CA HA sing N N 300 PHE C O doub N N 301 PHE C OXT sing N N 302 PHE CB CG sing N N 303 PHE CB HB2 sing N N 304 PHE CB HB3 sing N N 305 PHE CG CD1 doub Y N 306 PHE CG CD2 sing Y N 307 PHE CD1 CE1 sing Y N 308 PHE CD1 HD1 sing N N 309 PHE CD2 CE2 doub Y N 310 PHE CD2 HD2 sing N N 311 PHE CE1 CZ doub Y N 312 PHE CE1 HE1 sing N N 313 PHE CE2 CZ sing Y N 314 PHE CE2 HE2 sing N N 315 PHE CZ HZ sing N N 316 PHE OXT HXT sing N N 317 PRO N CA sing N N 318 PRO N CD sing N N 319 PRO N H sing N N 320 PRO CA C sing N N 321 PRO CA CB sing N N 322 PRO CA HA sing N N 323 PRO C O doub N N 324 PRO C OXT sing N N 325 PRO CB CG sing N N 326 PRO CB HB2 sing N N 327 PRO CB HB3 sing N N 328 PRO CG CD sing N N 329 PRO CG HG2 sing N N 330 PRO CG HG3 sing N N 331 PRO CD HD2 sing N N 332 PRO CD HD3 sing N N 333 PRO OXT HXT sing N N 334 SER N CA sing N N 335 SER N H sing N N 336 SER N H2 sing N N 337 SER CA C sing N N 338 SER CA CB sing N N 339 SER CA HA sing N N 340 SER C O doub N N 341 SER C OXT sing N N 342 SER CB OG sing N N 343 SER CB HB2 sing N N 344 SER CB HB3 sing N N 345 SER OG HG sing N N 346 SER OXT HXT sing N N 347 THR N CA sing N N 348 THR N H sing N N 349 THR N H2 sing N N 350 THR CA C sing N N 351 THR CA CB sing N N 352 THR CA HA sing N N 353 THR C O doub N N 354 THR C OXT sing N N 355 THR CB OG1 sing N N 356 THR CB CG2 sing N N 357 THR CB HB sing N N 358 THR OG1 HG1 sing N N 359 THR CG2 HG21 sing N N 360 THR CG2 HG22 sing N N 361 THR CG2 HG23 sing N N 362 THR OXT HXT sing N N 363 TRP N CA sing N N 364 TRP N H sing N N 365 TRP N H2 sing N N 366 TRP CA C sing N N 367 TRP CA CB sing N N 368 TRP CA HA sing N N 369 TRP C O doub N N 370 TRP C OXT sing N N 371 TRP CB CG sing N N 372 TRP CB HB2 sing N N 373 TRP CB HB3 sing N N 374 TRP CG CD1 doub Y N 375 TRP CG CD2 sing Y N 376 TRP CD1 NE1 sing Y N 377 TRP CD1 HD1 sing N N 378 TRP CD2 CE2 doub Y N 379 TRP CD2 CE3 sing Y N 380 TRP NE1 CE2 sing Y N 381 TRP NE1 HE1 sing N N 382 TRP CE2 CZ2 sing Y N 383 TRP CE3 CZ3 doub Y N 384 TRP CE3 HE3 sing N N 385 TRP CZ2 CH2 doub Y N 386 TRP CZ2 HZ2 sing N N 387 TRP CZ3 CH2 sing Y N 388 TRP CZ3 HZ3 sing N N 389 TRP CH2 HH2 sing N N 390 TRP OXT HXT sing N N 391 TYR N CA sing N N 392 TYR N H sing N N 393 TYR N H2 sing N N 394 TYR CA C sing N N 395 TYR CA CB sing N N 396 TYR CA HA sing N N 397 TYR C O doub N N 398 TYR C OXT sing N N 399 TYR CB CG sing N N 400 TYR CB HB2 sing N N 401 TYR CB HB3 sing N N 402 TYR CG CD1 doub Y N 403 TYR CG CD2 sing Y N 404 TYR CD1 CE1 sing Y N 405 TYR CD1 HD1 sing N N 406 TYR CD2 CE2 doub Y N 407 TYR CD2 HD2 sing N N 408 TYR CE1 CZ doub Y N 409 TYR CE1 HE1 sing N N 410 TYR CE2 CZ sing Y N 411 TYR CE2 HE2 sing N N 412 TYR CZ OH sing N N 413 TYR OH HH sing N N 414 TYR OXT HXT sing N N 415 VAL N CA sing N N 416 VAL N H sing N N 417 VAL N H2 sing N N 418 VAL CA C sing N N 419 VAL CA CB sing N N 420 VAL CA HA sing N N 421 VAL C O doub N N 422 VAL C OXT sing N N 423 VAL CB CG1 sing N N 424 VAL CB CG2 sing N N 425 VAL CB HB sing N N 426 VAL CG1 HG11 sing N N 427 VAL CG1 HG12 sing N N 428 VAL CG1 HG13 sing N N 429 VAL CG2 HG21 sing N N 430 VAL CG2 HG22 sing N N 431 VAL CG2 HG23 sing N N 432 VAL OXT HXT sing N N 433 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Belarusian Republican Foundation for Fundamental Research' Belarus X23RSF-091 1 'Russian Science Foundation' 'Russian Federation' 23-44-10021 2 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE III' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.details ? # _atom_sites.entry_id 9VR0 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C FE H N O S # loop_ #