data_9VV8 # _entry.id 9VV8 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.415 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9VV8 pdb_00009vv8 10.2210/pdb9vv8/pdb WWPDB D_1300061580 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-07-22 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9VV8 _pdbx_database_status.recvd_initial_deposition_date 2025-07-15 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBC _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _pdbx_contact_author.id _pdbx_contact_author.email _pdbx_contact_author.name_first _pdbx_contact_author.name_last _pdbx_contact_author.name_mi _pdbx_contact_author.role _pdbx_contact_author.identifier_ORCID 2 jiaweiwu@suda.edu.cn Jia-Wei Wu ? 'principal investigator/group leader' 0000-0003-0273-1686 3 duanbo@suda.edu.cn Bo Duan ? 'principal investigator/group leader' 0000-0003-0018-4092 4 zhixinwang@mail.tsinghua.edu.cn Zhi-Xin Wang ? 'principal investigator/group leader' 0000-0003-4656-2941 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Zhu, H.J.' 1 ? 'Zhang, Z.Y.' 2 ? 'Wang, J.C.' 3 ? 'Wang, Z.X.' 4 ? 'Luo, Z.P.' 5 ? 'Duan, B.' 6 ? 'Wu, J.W.' 7 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Sterol binding mechanism of a plant StART-like domain: a new sterol transport paradigm via an amphiphilic cavity' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zhu, H.J.' 1 ? primary 'Zhang, Z.Y.' 2 ? primary 'Wang, J.C.' 3 ? primary 'Wang, Z.X.' 4 ? primary 'Luo, Z.P.' 5 ? primary 'Duan, B.' 6 ? primary 'Wu, J.W.' 7 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'C2 and GRAM domain-containing protein At5g50170' 21802.254 1 ? ? ? 'The N-terminal fusion with 6xHis tag and HR3V site: MGSSHHHHHHSQDLEVLFQGPHM' 2 water nat water 18.015 91 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSSHHHHHHSQDLEVLFQGPHMMMSKVYTCDLPCDVELVMKIFGGGELERKIMEKSGCLSYASTTWESKKPGVYERRLS YKYNHYVSVFGGGVTCAQQKSPAPNDEGWILNEIVALHDVPFGDHFRVHIRYEVKKAGVDCKTSKCEVYLKIRWLKTIKF EQRISKSIMEKFRNRFKVIFDLFQKES ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSQDLEVLFQGPHMMMSKVYTCDLPCDVELVMKIFGGGELERKIMEKSGCLSYASTTWESKKPGVYERRLS YKYNHYVSVFGGGVTCAQQKSPAPNDEGWILNEIVALHDVPFGDHFRVHIRYEVKKAGVDCKTSKCEVYLKIRWLKTIKF EQRISKSIMEKFRNRFKVIFDLFQKES ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 GLN n 1 13 ASP n 1 14 LEU n 1 15 GLU n 1 16 VAL n 1 17 LEU n 1 18 PHE n 1 19 GLN n 1 20 GLY n 1 21 PRO n 1 22 HIS n 1 23 MET n 1 24 MET n 1 25 MET n 1 26 SER n 1 27 LYS n 1 28 VAL n 1 29 TYR n 1 30 THR n 1 31 CYS n 1 32 ASP n 1 33 LEU n 1 34 PRO n 1 35 CYS n 1 36 ASP n 1 37 VAL n 1 38 GLU n 1 39 LEU n 1 40 VAL n 1 41 MET n 1 42 LYS n 1 43 ILE n 1 44 PHE n 1 45 GLY n 1 46 GLY n 1 47 GLY n 1 48 GLU n 1 49 LEU n 1 50 GLU n 1 51 ARG n 1 52 LYS n 1 53 ILE n 1 54 MET n 1 55 GLU n 1 56 LYS n 1 57 SER n 1 58 GLY n 1 59 CYS n 1 60 LEU n 1 61 SER n 1 62 TYR n 1 63 ALA n 1 64 SER n 1 65 THR n 1 66 THR n 1 67 TRP n 1 68 GLU n 1 69 SER n 1 70 LYS n 1 71 LYS n 1 72 PRO n 1 73 GLY n 1 74 VAL n 1 75 TYR n 1 76 GLU n 1 77 ARG n 1 78 ARG n 1 79 LEU n 1 80 SER n 1 81 TYR n 1 82 LYS n 1 83 TYR n 1 84 ASN n 1 85 HIS n 1 86 TYR n 1 87 VAL n 1 88 SER n 1 89 VAL n 1 90 PHE n 1 91 GLY n 1 92 GLY n 1 93 GLY n 1 94 VAL n 1 95 THR n 1 96 CYS n 1 97 ALA n 1 98 GLN n 1 99 GLN n 1 100 LYS n 1 101 SER n 1 102 PRO n 1 103 ALA n 1 104 PRO n 1 105 ASN n 1 106 ASP n 1 107 GLU n 1 108 GLY n 1 109 TRP n 1 110 ILE n 1 111 LEU n 1 112 ASN n 1 113 GLU n 1 114 ILE n 1 115 VAL n 1 116 ALA n 1 117 LEU n 1 118 HIS n 1 119 ASP n 1 120 VAL n 1 121 PRO n 1 122 PHE n 1 123 GLY n 1 124 ASP n 1 125 HIS n 1 126 PHE n 1 127 ARG n 1 128 VAL n 1 129 HIS n 1 130 ILE n 1 131 ARG n 1 132 TYR n 1 133 GLU n 1 134 VAL n 1 135 LYS n 1 136 LYS n 1 137 ALA n 1 138 GLY n 1 139 VAL n 1 140 ASP n 1 141 CYS n 1 142 LYS n 1 143 THR n 1 144 SER n 1 145 LYS n 1 146 CYS n 1 147 GLU n 1 148 VAL n 1 149 TYR n 1 150 LEU n 1 151 LYS n 1 152 ILE n 1 153 ARG n 1 154 TRP n 1 155 LEU n 1 156 LYS n 1 157 THR n 1 158 ILE n 1 159 LYS n 1 160 PHE n 1 161 GLU n 1 162 GLN n 1 163 ARG n 1 164 ILE n 1 165 SER n 1 166 LYS n 1 167 SER n 1 168 ILE n 1 169 MET n 1 170 GLU n 1 171 LYS n 1 172 PHE n 1 173 ARG n 1 174 ASN n 1 175 ARG n 1 176 PHE n 1 177 LYS n 1 178 VAL n 1 179 ILE n 1 180 PHE n 1 181 ASP n 1 182 LEU n 1 183 PHE n 1 184 GLN n 1 185 LYS n 1 186 GLU n 1 187 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 187 _entity_src_gen.gene_src_common_name 'thale cress' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'At5g50170, K6A12_3' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Arabidopsis thaliana' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 3702 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 832 ? ? ? A . n A 1 2 GLY 2 833 ? ? ? A . n A 1 3 SER 3 834 ? ? ? A . n A 1 4 SER 4 835 ? ? ? A . n A 1 5 HIS 5 836 ? ? ? A . n A 1 6 HIS 6 837 ? ? ? A . n A 1 7 HIS 7 838 838 HIS HIS A . n A 1 8 HIS 8 839 839 HIS HIS A . n A 1 9 HIS 9 840 840 HIS HIS A . n A 1 10 HIS 10 841 841 HIS HIS A . n A 1 11 SER 11 842 842 SER SER A . n A 1 12 GLN 12 843 843 GLN GLN A . n A 1 13 ASP 13 844 844 ASP ASP A . n A 1 14 LEU 14 845 845 LEU LEU A . n A 1 15 GLU 15 846 846 GLU GLU A . n A 1 16 VAL 16 847 847 VAL VAL A . n A 1 17 LEU 17 848 848 LEU LEU A . n A 1 18 PHE 18 849 849 PHE PHE A . n A 1 19 GLN 19 850 850 GLN GLN A . n A 1 20 GLY 20 851 851 GLY GLY A . n A 1 21 PRO 21 852 852 PRO PRO A . n A 1 22 HIS 22 853 853 HIS HIS A . n A 1 23 MET 23 854 854 MET MET A . n A 1 24 MET 24 855 855 MET MET A . n A 1 25 MET 25 856 856 MET MET A . n A 1 26 SER 26 857 857 SER SER A . n A 1 27 LYS 27 858 858 LYS LYS A . n A 1 28 VAL 28 859 859 VAL VAL A . n A 1 29 TYR 29 860 860 TYR TYR A . n A 1 30 THR 30 861 861 THR THR A . n A 1 31 CYS 31 862 862 CYS CYS A . n A 1 32 ASP 32 863 863 ASP ASP A . n A 1 33 LEU 33 864 864 LEU LEU A . n A 1 34 PRO 34 865 865 PRO PRO A . n A 1 35 CYS 35 866 866 CYS CYS A . n A 1 36 ASP 36 867 867 ASP ASP A . n A 1 37 VAL 37 868 868 VAL VAL A . n A 1 38 GLU 38 869 869 GLU GLU A . n A 1 39 LEU 39 870 870 LEU LEU A . n A 1 40 VAL 40 871 871 VAL VAL A . n A 1 41 MET 41 872 872 MET MET A . n A 1 42 LYS 42 873 873 LYS LYS A . n A 1 43 ILE 43 874 874 ILE ILE A . n A 1 44 PHE 44 875 875 PHE PHE A . n A 1 45 GLY 45 876 876 GLY GLY A . n A 1 46 GLY 46 877 877 GLY GLY A . n A 1 47 GLY 47 878 878 GLY GLY A . n A 1 48 GLU 48 879 879 GLU GLU A . n A 1 49 LEU 49 880 880 LEU LEU A . n A 1 50 GLU 50 881 881 GLU GLU A . n A 1 51 ARG 51 882 882 ARG ARG A . n A 1 52 LYS 52 883 883 LYS LYS A . n A 1 53 ILE 53 884 884 ILE ILE A . n A 1 54 MET 54 885 885 MET MET A . n A 1 55 GLU 55 886 886 GLU GLU A . n A 1 56 LYS 56 887 887 LYS LYS A . n A 1 57 SER 57 888 888 SER SER A . n A 1 58 GLY 58 889 889 GLY GLY A . n A 1 59 CYS 59 890 890 CYS CYS A . n A 1 60 LEU 60 891 891 LEU LEU A . n A 1 61 SER 61 892 892 SER SER A . n A 1 62 TYR 62 893 893 TYR TYR A . n A 1 63 ALA 63 894 894 ALA ALA A . n A 1 64 SER 64 895 895 SER SER A . n A 1 65 THR 65 896 896 THR THR A . n A 1 66 THR 66 897 897 THR THR A . n A 1 67 TRP 67 898 898 TRP TRP A . n A 1 68 GLU 68 899 899 GLU GLU A . n A 1 69 SER 69 900 900 SER SER A . n A 1 70 LYS 70 901 901 LYS LYS A . n A 1 71 LYS 71 902 902 LYS LYS A . n A 1 72 PRO 72 903 903 PRO PRO A . n A 1 73 GLY 73 904 904 GLY GLY A . n A 1 74 VAL 74 905 905 VAL VAL A . n A 1 75 TYR 75 906 906 TYR TYR A . n A 1 76 GLU 76 907 907 GLU GLU A . n A 1 77 ARG 77 908 908 ARG ARG A . n A 1 78 ARG 78 909 909 ARG ARG A . n A 1 79 LEU 79 910 910 LEU LEU A . n A 1 80 SER 80 911 911 SER SER A . n A 1 81 TYR 81 912 912 TYR TYR A . n A 1 82 LYS 82 913 913 LYS LYS A . n A 1 83 TYR 83 914 914 TYR TYR A . n A 1 84 ASN 84 915 915 ASN ASN A . n A 1 85 HIS 85 916 916 HIS HIS A . n A 1 86 TYR 86 917 917 TYR TYR A . n A 1 87 VAL 87 918 918 VAL VAL A . n A 1 88 SER 88 919 919 SER SER A . n A 1 89 VAL 89 920 920 VAL VAL A . n A 1 90 PHE 90 921 921 PHE PHE A . n A 1 91 GLY 91 922 922 GLY GLY A . n A 1 92 GLY 92 923 923 GLY GLY A . n A 1 93 GLY 93 924 924 GLY GLY A . n A 1 94 VAL 94 925 925 VAL VAL A . n A 1 95 THR 95 926 926 THR THR A . n A 1 96 CYS 96 927 927 CYS CYS A . n A 1 97 ALA 97 928 928 ALA ALA A . n A 1 98 GLN 98 929 929 GLN GLN A . n A 1 99 GLN 99 930 930 GLN GLN A . n A 1 100 LYS 100 931 931 LYS LYS A . n A 1 101 SER 101 932 932 SER SER A . n A 1 102 PRO 102 933 933 PRO PRO A . n A 1 103 ALA 103 934 934 ALA ALA A . n A 1 104 PRO 104 935 935 PRO PRO A . n A 1 105 ASN 105 936 936 ASN ASN A . n A 1 106 ASP 106 937 937 ASP ASP A . n A 1 107 GLU 107 938 938 GLU GLU A . n A 1 108 GLY 108 939 939 GLY GLY A . n A 1 109 TRP 109 940 940 TRP TRP A . n A 1 110 ILE 110 941 941 ILE ILE A . n A 1 111 LEU 111 942 942 LEU LEU A . n A 1 112 ASN 112 943 943 ASN ASN A . n A 1 113 GLU 113 944 944 GLU GLU A . n A 1 114 ILE 114 945 945 ILE ILE A . n A 1 115 VAL 115 946 946 VAL VAL A . n A 1 116 ALA 116 947 947 ALA ALA A . n A 1 117 LEU 117 948 948 LEU LEU A . n A 1 118 HIS 118 949 949 HIS HIS A . n A 1 119 ASP 119 950 950 ASP ASP A . n A 1 120 VAL 120 951 951 VAL VAL A . n A 1 121 PRO 121 952 952 PRO PRO A . n A 1 122 PHE 122 953 953 PHE PHE A . n A 1 123 GLY 123 954 954 GLY GLY A . n A 1 124 ASP 124 955 955 ASP ASP A . n A 1 125 HIS 125 956 956 HIS HIS A . n A 1 126 PHE 126 957 957 PHE PHE A . n A 1 127 ARG 127 958 958 ARG ARG A . n A 1 128 VAL 128 959 959 VAL VAL A . n A 1 129 HIS 129 960 960 HIS HIS A . n A 1 130 ILE 130 961 961 ILE ILE A . n A 1 131 ARG 131 962 962 ARG ARG A . n A 1 132 TYR 132 963 963 TYR TYR A . n A 1 133 GLU 133 964 964 GLU GLU A . n A 1 134 VAL 134 965 965 VAL VAL A . n A 1 135 LYS 135 966 966 LYS LYS A . n A 1 136 LYS 136 967 967 LYS LYS A . n A 1 137 ALA 137 968 968 ALA ALA A . n A 1 138 GLY 138 969 969 GLY GLY A . n A 1 139 VAL 139 970 970 VAL VAL A . n A 1 140 ASP 140 971 971 ASP ASP A . n A 1 141 CYS 141 972 972 CYS CYS A . n A 1 142 LYS 142 973 973 LYS LYS A . n A 1 143 THR 143 974 974 THR THR A . n A 1 144 SER 144 975 975 SER SER A . n A 1 145 LYS 145 976 976 LYS LYS A . n A 1 146 CYS 146 977 977 CYS CYS A . n A 1 147 GLU 147 978 978 GLU GLU A . n A 1 148 VAL 148 979 979 VAL VAL A . n A 1 149 TYR 149 980 980 TYR TYR A . n A 1 150 LEU 150 981 981 LEU LEU A . n A 1 151 LYS 151 982 982 LYS LYS A . n A 1 152 ILE 152 983 983 ILE ILE A . n A 1 153 ARG 153 984 984 ARG ARG A . n A 1 154 TRP 154 985 985 TRP TRP A . n A 1 155 LEU 155 986 986 LEU LEU A . n A 1 156 LYS 156 987 987 LYS LYS A . n A 1 157 THR 157 988 988 THR THR A . n A 1 158 ILE 158 989 989 ILE ILE A . n A 1 159 LYS 159 990 990 LYS LYS A . n A 1 160 PHE 160 991 991 PHE PHE A . n A 1 161 GLU 161 992 992 GLU GLU A . n A 1 162 GLN 162 993 993 GLN GLN A . n A 1 163 ARG 163 994 994 ARG ARG A . n A 1 164 ILE 164 995 995 ILE ILE A . n A 1 165 SER 165 996 996 SER SER A . n A 1 166 LYS 166 997 997 LYS LYS A . n A 1 167 SER 167 998 998 SER SER A . n A 1 168 ILE 168 999 999 ILE ILE A . n A 1 169 MET 169 1000 1000 MET MET A . n A 1 170 GLU 170 1001 1001 GLU GLU A . n A 1 171 LYS 171 1002 1002 LYS LYS A . n A 1 172 PHE 172 1003 1003 PHE PHE A . n A 1 173 ARG 173 1004 1004 ARG ARG A . n A 1 174 ASN 174 1005 1005 ASN ASN A . n A 1 175 ARG 175 1006 1006 ARG ARG A . n A 1 176 PHE 176 1007 1007 PHE PHE A . n A 1 177 LYS 177 1008 1008 LYS LYS A . n A 1 178 VAL 178 1009 1009 VAL VAL A . n A 1 179 ILE 179 1010 1010 ILE ILE A . n A 1 180 PHE 180 1011 1011 PHE PHE A . n A 1 181 ASP 181 1012 1012 ASP ASP A . n A 1 182 LEU 182 1013 1013 LEU LEU A . n A 1 183 PHE 183 1014 1014 PHE PHE A . n A 1 184 GLN 184 1015 1015 GLN GLN A . n A 1 185 LYS 185 1016 1016 LYS LYS A . n A 1 186 GLU 186 1017 1017 GLU GLU A . n A 1 187 SER 187 1018 1018 SER SER A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 1101 20 HOH HOH A . B 2 HOH 2 1102 66 HOH HOH A . B 2 HOH 3 1103 54 HOH HOH A . B 2 HOH 4 1104 6 HOH HOH A . B 2 HOH 5 1105 53 HOH HOH A . B 2 HOH 6 1106 52 HOH HOH A . B 2 HOH 7 1107 15 HOH HOH A . B 2 HOH 8 1108 30 HOH HOH A . B 2 HOH 9 1109 67 HOH HOH A . B 2 HOH 10 1110 40 HOH HOH A . B 2 HOH 11 1111 26 HOH HOH A . B 2 HOH 12 1112 68 HOH HOH A . B 2 HOH 13 1113 36 HOH HOH A . B 2 HOH 14 1114 32 HOH HOH A . B 2 HOH 15 1115 88 HOH HOH A . B 2 HOH 16 1116 71 HOH HOH A . B 2 HOH 17 1117 44 HOH HOH A . B 2 HOH 18 1118 57 HOH HOH A . B 2 HOH 19 1119 22 HOH HOH A . B 2 HOH 20 1120 42 HOH HOH A . B 2 HOH 21 1121 8 HOH HOH A . B 2 HOH 22 1122 51 HOH HOH A . B 2 HOH 23 1123 39 HOH HOH A . B 2 HOH 24 1124 59 HOH HOH A . B 2 HOH 25 1125 56 HOH HOH A . B 2 HOH 26 1126 19 HOH HOH A . B 2 HOH 27 1127 1 HOH HOH A . B 2 HOH 28 1128 38 HOH HOH A . B 2 HOH 29 1129 82 HOH HOH A . B 2 HOH 30 1130 64 HOH HOH A . B 2 HOH 31 1131 75 HOH HOH A . B 2 HOH 32 1132 43 HOH HOH A . B 2 HOH 33 1133 12 HOH HOH A . B 2 HOH 34 1134 3 HOH HOH A . B 2 HOH 35 1135 13 HOH HOH A . B 2 HOH 36 1136 7 HOH HOH A . B 2 HOH 37 1137 4 HOH HOH A . B 2 HOH 38 1138 41 HOH HOH A . B 2 HOH 39 1139 16 HOH HOH A . B 2 HOH 40 1140 2 HOH HOH A . B 2 HOH 41 1141 50 HOH HOH A . B 2 HOH 42 1142 23 HOH HOH A . B 2 HOH 43 1143 9 HOH HOH A . B 2 HOH 44 1144 45 HOH HOH A . B 2 HOH 45 1145 29 HOH HOH A . B 2 HOH 46 1146 21 HOH HOH A . B 2 HOH 47 1147 28 HOH HOH A . B 2 HOH 48 1148 33 HOH HOH A . B 2 HOH 49 1149 37 HOH HOH A . B 2 HOH 50 1150 62 HOH HOH A . B 2 HOH 51 1151 72 HOH HOH A . B 2 HOH 52 1152 77 HOH HOH A . B 2 HOH 53 1153 14 HOH HOH A . B 2 HOH 54 1154 80 HOH HOH A . B 2 HOH 55 1155 35 HOH HOH A . B 2 HOH 56 1156 11 HOH HOH A . B 2 HOH 57 1157 27 HOH HOH A . B 2 HOH 58 1158 10 HOH HOH A . B 2 HOH 59 1159 31 HOH HOH A . B 2 HOH 60 1160 69 HOH HOH A . B 2 HOH 61 1161 89 HOH HOH A . B 2 HOH 62 1162 5 HOH HOH A . B 2 HOH 63 1163 48 HOH HOH A . B 2 HOH 64 1164 46 HOH HOH A . B 2 HOH 65 1165 55 HOH HOH A . B 2 HOH 66 1166 49 HOH HOH A . B 2 HOH 67 1167 17 HOH HOH A . B 2 HOH 68 1168 24 HOH HOH A . B 2 HOH 69 1169 70 HOH HOH A . B 2 HOH 70 1170 18 HOH HOH A . B 2 HOH 71 1171 58 HOH HOH A . B 2 HOH 72 1172 79 HOH HOH A . B 2 HOH 73 1173 25 HOH HOH A . B 2 HOH 74 1174 34 HOH HOH A . B 2 HOH 75 1175 65 HOH HOH A . B 2 HOH 76 1176 90 HOH HOH A . B 2 HOH 77 1177 84 HOH HOH A . B 2 HOH 78 1178 63 HOH HOH A . B 2 HOH 79 1179 81 HOH HOH A . B 2 HOH 80 1180 91 HOH HOH A . B 2 HOH 81 1181 87 HOH HOH A . B 2 HOH 82 1182 86 HOH HOH A . B 2 HOH 83 1183 60 HOH HOH A . B 2 HOH 84 1184 85 HOH HOH A . B 2 HOH 85 1185 73 HOH HOH A . B 2 HOH 86 1186 47 HOH HOH A . B 2 HOH 87 1187 74 HOH HOH A . B 2 HOH 88 1188 76 HOH HOH A . B 2 HOH 89 1189 78 HOH HOH A . B 2 HOH 90 1190 83 HOH HOH A . B 2 HOH 91 1191 61 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A TYR 917 ? CG ? A TYR 86 CG 2 1 Y 1 A TYR 917 ? CD1 ? A TYR 86 CD1 3 1 Y 1 A TYR 917 ? CD2 ? A TYR 86 CD2 4 1 Y 1 A TYR 917 ? CE1 ? A TYR 86 CE1 5 1 Y 1 A TYR 917 ? CE2 ? A TYR 86 CE2 6 1 Y 1 A TYR 917 ? CZ ? A TYR 86 CZ 7 1 Y 1 A TYR 917 ? OH ? A TYR 86 OH 8 1 Y 1 A SER 919 ? OG ? A SER 88 OG 9 1 Y 1 A VAL 920 ? CG1 ? A VAL 89 CG1 10 1 Y 1 A VAL 920 ? CG2 ? A VAL 89 CG2 11 1 Y 1 A PHE 921 ? CG ? A PHE 90 CG 12 1 Y 1 A PHE 921 ? CD1 ? A PHE 90 CD1 13 1 Y 1 A PHE 921 ? CD2 ? A PHE 90 CD2 14 1 Y 1 A PHE 921 ? CE1 ? A PHE 90 CE1 15 1 Y 1 A PHE 921 ? CE2 ? A PHE 90 CE2 16 1 Y 1 A PHE 921 ? CZ ? A PHE 90 CZ 17 1 Y 1 A VAL 970 ? CG1 ? A VAL 139 CG1 18 1 Y 1 A VAL 970 ? CG2 ? A VAL 139 CG2 19 1 Y 1 A ASP 971 ? CG ? A ASP 140 CG 20 1 Y 1 A ASP 971 ? OD1 ? A ASP 140 OD1 21 1 Y 1 A ASP 971 ? OD2 ? A ASP 140 OD2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0425 ? 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . ? 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . ? 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . ? 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 9VV8 _cell.details ? _cell.formula_units_Z ? _cell.length_a 67.234 _cell.length_a_esd ? _cell.length_b 69.797 _cell.length_b_esd ? _cell.length_c 77.364 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9VV8 _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9VV8 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.08 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 40.91 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M Bicine & Tris (pH 8.5), 12.5% MPD, 12.5% PEG1000, and 12% PEG3350.' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 291 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-09-22 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.987 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL18U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.987 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL18U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 9VV8 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.7 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 19927 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.3 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 8.2 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 28.53 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.996 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.065 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.7 _reflns_shell.d_res_low 1.76 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1774 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.896 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] 0.521 _refine.aniso_B[1][2] 0.000 _refine.aniso_B[1][3] -0.000 _refine.aniso_B[2][2] 1.338 _refine.aniso_B[2][3] 0.000 _refine.aniso_B[3][3] -1.859 _refine.B_iso_max ? _refine.B_iso_mean 32.035 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.958 _refine.correlation_coeff_Fo_to_Fc_free 0.950 _refine.details 'Hydrogens have been added in their riding positions' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9VV8 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.704 _refine.ls_d_res_low 31.812 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 19907 _refine.ls_number_reflns_R_free 910 _refine.ls_number_reflns_R_work 18997 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.248 _refine.ls_percent_reflns_R_free 4.571 _refine.ls_R_factor_all 0.198 _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.2325 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1964 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'MASK BULK SOLVENT' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.120 _refine.pdbx_overall_ESU_R_Free 0.116 _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 2.478 _refine.overall_SU_ML 0.081 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1463 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 91 _refine_hist.number_atoms_total 1554 _refine_hist.d_res_high 1.704 _refine_hist.d_res_low 31.812 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.010 0.012 1506 ? r_bond_refined_d ? ? ? 'X-RAY DIFFRACTION' ? 0.002 0.016 1415 ? r_bond_other_d ? ? ? 'X-RAY DIFFRACTION' ? 0.001 0.100 22985 ? r_ext_dist_refined_b ? ? ? 'X-RAY DIFFRACTION' ? 1.590 1.853 2023 ? r_angle_refined_deg ? ? ? 'X-RAY DIFFRACTION' ? 0.570 1.791 3275 ? r_angle_other_deg ? ? ? 'X-RAY DIFFRACTION' ? 6.706 5.000 182 ? r_dihedral_angle_1_deg ? ? ? 'X-RAY DIFFRACTION' ? 5.987 5.000 9 ? r_dihedral_angle_2_deg ? ? ? 'X-RAY DIFFRACTION' ? 13.081 10.000 282 ? r_dihedral_angle_3_deg ? ? ? 'X-RAY DIFFRACTION' ? 15.557 10.000 68 ? r_dihedral_angle_6_deg ? ? ? 'X-RAY DIFFRACTION' ? 0.082 0.200 211 ? r_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.008 0.020 1744 ? r_gen_planes_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 350 ? r_gen_planes_other ? ? ? 'X-RAY DIFFRACTION' ? 0.178 0.200 234 ? r_nbd_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.204 0.200 1226 ? r_symmetry_nbd_other ? ? ? 'X-RAY DIFFRACTION' ? 0.183 0.200 703 ? r_nbtor_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.084 0.200 810 ? r_symmetry_nbtor_other ? ? ? 'X-RAY DIFFRACTION' ? 0.133 0.200 46 ? r_xyhbond_nbd_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.096 0.200 15 ? r_symmetry_nbd_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.193 0.200 106 ? r_nbd_other ? ? ? 'X-RAY DIFFRACTION' ? 0.080 0.200 10 ? r_symmetry_xyhbond_nbd_refined ? ? ? 'X-RAY DIFFRACTION' ? 3.818 3.051 728 ? r_mcbond_it ? ? ? 'X-RAY DIFFRACTION' ? 3.818 3.051 728 ? r_mcbond_other ? ? ? 'X-RAY DIFFRACTION' ? 5.677 5.463 910 ? r_mcangle_it ? ? ? 'X-RAY DIFFRACTION' ? 5.676 5.466 911 ? r_mcangle_other ? ? ? 'X-RAY DIFFRACTION' ? 5.556 3.689 778 ? r_scbond_it ? ? ? 'X-RAY DIFFRACTION' ? 5.553 3.690 779 ? r_scbond_other ? ? ? 'X-RAY DIFFRACTION' ? 8.556 6.434 1113 ? r_scangle_it ? ? ? 'X-RAY DIFFRACTION' ? 8.552 6.434 1114 ? r_scangle_other ? ? ? 'X-RAY DIFFRACTION' ? 14.272 66.843 23147 ? r_lrange_it ? ? ? 'X-RAY DIFFRACTION' ? 14.281 66.837 23042 ? r_lrange_other ? ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.704 1.748 1468 . 66 1185 85.2180 . 0.288 . . 0.283 . . . . . 0.244 . . . . . 20 . 0.948 0.936 0.365 'X-RAY DIFFRACTION' 1.748 1.795 1462 . 68 1341 96.3748 . 0.262 . . 0.259 . . . . . 0.218 . . . . . 20 . 0.959 0.929 0.325 'X-RAY DIFFRACTION' 1.795 1.847 1378 . 49 1329 100.0000 . 0.232 . . 0.230 . . . . . 0.196 . . . . . 20 . 0.966 0.950 0.283 'X-RAY DIFFRACTION' 1.847 1.904 1352 . 62 1289 99.9260 . 0.215 . . 0.213 . . . . . 0.182 . . . . . 20 . 0.970 0.950 0.262 'X-RAY DIFFRACTION' 1.904 1.966 1326 . 44 1280 99.8492 . 0.196 . . 0.194 . . . . . 0.169 . . . . . 20 . 0.975 0.950 0.264 'X-RAY DIFFRACTION' 1.966 2.035 1277 . 46 1222 99.2952 . 0.181 . . 0.179 . . . . . 0.159 . . . . . 20 . 0.979 0.958 0.260 'X-RAY DIFFRACTION' 2.035 2.111 1235 . 59 1154 98.2186 . 0.203 . . 0.201 . . . . . 0.187 . . . . . 20 . 0.975 0.965 0.237 'X-RAY DIFFRACTION' 2.111 2.197 1183 . 60 1121 99.8309 . 0.199 . . 0.199 . . . . . 0.189 . . . . . 20 . 0.974 0.973 0.199 'X-RAY DIFFRACTION' 2.197 2.294 1140 . 55 1085 100.0000 . 0.189 . . 0.188 . . . . . 0.182 . . . . . 20 . 0.978 0.971 0.217 'X-RAY DIFFRACTION' 2.294 2.406 1109 . 48 1058 99.7295 . 0.200 . . 0.196 . . . . . 0.199 . . . . . 20 . 0.976 0.953 0.282 'X-RAY DIFFRACTION' 2.406 2.535 1041 . 35 984 97.8866 . 0.199 . . 0.198 . . . . . 0.204 . . . . . 20 . 0.975 0.968 0.236 'X-RAY DIFFRACTION' 2.535 2.688 1001 . 48 953 100.0000 . 0.184 . . 0.181 . . . . . 0.195 . . . . . 20 . 0.979 0.971 0.240 'X-RAY DIFFRACTION' 2.688 2.872 914 . 32 882 100.0000 . 0.196 . . 0.194 . . . . . 0.217 . . . . . 20 . 0.977 0.969 0.245 'X-RAY DIFFRACTION' 2.872 3.100 874 . 58 816 100.0000 . 0.203 . . 0.201 . . . . . 0.230 . . . . . 20 . 0.975 0.960 0.234 'X-RAY DIFFRACTION' 3.100 3.393 802 . 39 758 99.3766 . 0.186 . . 0.183 . . . . . 0.209 . . . . . 20 . 0.978 0.967 0.239 'X-RAY DIFFRACTION' 3.393 3.788 746 . 46 698 99.7319 . 0.193 . . 0.189 . . . . . 0.222 . . . . . 20 . 0.979 0.971 0.243 'X-RAY DIFFRACTION' 3.788 4.363 656 . 40 615 99.8476 . 0.173 . . 0.172 . . . . . 0.218 . . . . . 20 . 0.982 0.984 0.173 'X-RAY DIFFRACTION' 4.363 5.319 562 . 22 537 99.4662 . 0.166 . . 0.164 . . . . . 0.226 . . . . . 20 . 0.985 0.985 0.201 'X-RAY DIFFRACTION' 5.319 7.419 448 . 18 428 99.5536 . 0.264 . . 0.265 . . . . . 0.357 . . . . . 20 . 0.969 0.958 0.252 'X-RAY DIFFRACTION' 7.419 31.812 283 . 15 262 97.8799 . 0.220 . . 0.220 . . . . . 0.304 . . . . . 20 . 0.968 0.975 0.215 # _struct.entry_id 9VV8 _struct.title 'Crystal structure of the second StART-like domain from Arabidopsis C2 and GRAM domain-containing (C2GR) protein' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9VV8 _struct_keywords.text 'lipid transport protein, ligand-binding cavity, ligand-free structure, LIPID BINDING PROTEIN' _struct_keywords.pdbx_keywords 'LIPID BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code C2GR2_ARATH _struct_ref.pdbx_db_accession Q9FGS8 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MMSKVYTCDLPCDVELVMKIFGGGELERKIMEKSGCLSYASTTWESKKPGVYERRLSYKYNHYVSVFGGGVTCAQQKSPA PNDEGWILNEIVALHDVPFGDHFRVHIRYEVKKAGVDCKTSKCEVYLKIRWLKTIKFEQRISKSIMEKFRNRFKVIFDLF QKES ; _struct_ref.pdbx_align_begin 855 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9VV8 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 24 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 187 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9FGS8 _struct_ref_seq.db_align_beg 855 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1018 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 855 _struct_ref_seq.pdbx_auth_seq_align_end 1018 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9VV8 MET A 1 ? UNP Q9FGS8 ? ? 'initiating methionine' 832 1 1 9VV8 GLY A 2 ? UNP Q9FGS8 ? ? 'expression tag' 833 2 1 9VV8 SER A 3 ? UNP Q9FGS8 ? ? 'expression tag' 834 3 1 9VV8 SER A 4 ? UNP Q9FGS8 ? ? 'expression tag' 835 4 1 9VV8 HIS A 5 ? UNP Q9FGS8 ? ? 'expression tag' 836 5 1 9VV8 HIS A 6 ? UNP Q9FGS8 ? ? 'expression tag' 837 6 1 9VV8 HIS A 7 ? UNP Q9FGS8 ? ? 'expression tag' 838 7 1 9VV8 HIS A 8 ? UNP Q9FGS8 ? ? 'expression tag' 839 8 1 9VV8 HIS A 9 ? UNP Q9FGS8 ? ? 'expression tag' 840 9 1 9VV8 HIS A 10 ? UNP Q9FGS8 ? ? 'expression tag' 841 10 1 9VV8 SER A 11 ? UNP Q9FGS8 ? ? 'expression tag' 842 11 1 9VV8 GLN A 12 ? UNP Q9FGS8 ? ? 'expression tag' 843 12 1 9VV8 ASP A 13 ? UNP Q9FGS8 ? ? 'expression tag' 844 13 1 9VV8 LEU A 14 ? UNP Q9FGS8 ? ? 'expression tag' 845 14 1 9VV8 GLU A 15 ? UNP Q9FGS8 ? ? 'expression tag' 846 15 1 9VV8 VAL A 16 ? UNP Q9FGS8 ? ? 'expression tag' 847 16 1 9VV8 LEU A 17 ? UNP Q9FGS8 ? ? 'expression tag' 848 17 1 9VV8 PHE A 18 ? UNP Q9FGS8 ? ? 'expression tag' 849 18 1 9VV8 GLN A 19 ? UNP Q9FGS8 ? ? 'expression tag' 850 19 1 9VV8 GLY A 20 ? UNP Q9FGS8 ? ? 'expression tag' 851 20 1 9VV8 PRO A 21 ? UNP Q9FGS8 ? ? 'expression tag' 852 21 1 9VV8 HIS A 22 ? UNP Q9FGS8 ? ? 'expression tag' 853 22 1 9VV8 MET A 23 ? UNP Q9FGS8 ? ? 'expression tag' 854 23 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 36 ? MET A 41 ? ASP A 867 MET A 872 1 ? 6 HELX_P HELX_P2 AA2 LYS A 42 ? GLY A 45 ? LYS A 873 GLY A 876 5 ? 4 HELX_P HELX_P3 AA3 GLY A 47 ? SER A 57 ? GLY A 878 SER A 888 1 ? 11 HELX_P HELX_P4 AA4 PRO A 104 ? ASP A 106 ? PRO A 935 ASP A 937 5 ? 3 HELX_P HELX_P5 AA5 PHE A 122 ? ASP A 124 ? PHE A 953 ASP A 955 5 ? 3 HELX_P HELX_P6 AA6 GLY A 138 ? LYS A 142 ? GLY A 969 LYS A 973 5 ? 5 HELX_P HELX_P7 AA7 PHE A 160 ? SER A 187 ? PHE A 991 SER A 1018 1 ? 28 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 7 ? AA2 ? 7 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel AA2 6 7 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 SER A 26 ? LEU A 33 ? SER A 857 LEU A 864 AA1 2 THR A 143 ? TRP A 154 ? THR A 974 TRP A 985 AA1 3 PHE A 126 ? ALA A 137 ? PHE A 957 ALA A 968 AA1 4 GLY A 108 ? LEU A 117 ? GLY A 939 LEU A 948 AA1 5 GLY A 92 ? PRO A 102 ? GLY A 923 PRO A 933 AA1 6 TYR A 75 ? TYR A 83 ? TYR A 906 TYR A 914 AA1 7 CYS A 59 ? SER A 64 ? CYS A 890 SER A 895 AA2 1 SER A 26 ? LEU A 33 ? SER A 857 LEU A 864 AA2 2 THR A 143 ? TRP A 154 ? THR A 974 TRP A 985 AA2 3 PHE A 126 ? ALA A 137 ? PHE A 957 ALA A 968 AA2 4 GLY A 108 ? LEU A 117 ? GLY A 939 LEU A 948 AA2 5 GLY A 92 ? PRO A 102 ? GLY A 923 PRO A 933 AA2 6 TYR A 75 ? TYR A 83 ? TYR A 906 TYR A 914 AA2 7 GLU A 68 ? SER A 69 ? GLU A 899 SER A 900 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 33 ? N LEU A 864 O SER A 144 ? O SER A 975 AA1 2 3 O LYS A 151 ? O LYS A 982 N HIS A 129 ? N HIS A 960 AA1 3 4 O TYR A 132 ? O TYR A 963 N LEU A 111 ? N LEU A 942 AA1 4 5 O ASN A 112 ? O ASN A 943 N GLN A 99 ? N GLN A 930 AA1 5 6 O CYS A 96 ? O CYS A 927 N LEU A 79 ? N LEU A 910 AA1 6 7 O LYS A 82 ? O LYS A 913 N LEU A 60 ? N LEU A 891 AA2 1 2 N LEU A 33 ? N LEU A 864 O SER A 144 ? O SER A 975 AA2 2 3 O LYS A 151 ? O LYS A 982 N HIS A 129 ? N HIS A 960 AA2 3 4 O TYR A 132 ? O TYR A 963 N LEU A 111 ? N LEU A 942 AA2 4 5 O ASN A 112 ? O ASN A 943 N GLN A 99 ? N GLN A 930 AA2 5 6 O CYS A 96 ? O CYS A 927 N LEU A 79 ? N LEU A 910 AA2 6 7 O GLU A 76 ? O GLU A 907 N GLU A 68 ? N GLU A 899 # _pdbx_entry_details.entry_id 9VV8 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 901 ? ? -110.11 -100.70 2 1 PHE A 921 ? ? -107.69 40.87 3 1 THR A 974 ? ? -108.95 -167.04 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 1145 ? B HOH . 2 1 A HOH 1188 ? B HOH . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 832 ? A MET 1 2 1 Y 1 A GLY 833 ? A GLY 2 3 1 Y 1 A SER 834 ? A SER 3 4 1 Y 1 A SER 835 ? A SER 4 5 1 Y 1 A HIS 836 ? A HIS 5 6 1 Y 1 A HIS 837 ? A HIS 6 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TRP N N N N 321 TRP CA C N S 322 TRP C C N N 323 TRP O O N N 324 TRP CB C N N 325 TRP CG C Y N 326 TRP CD1 C Y N 327 TRP CD2 C Y N 328 TRP NE1 N Y N 329 TRP CE2 C Y N 330 TRP CE3 C Y N 331 TRP CZ2 C Y N 332 TRP CZ3 C Y N 333 TRP CH2 C Y N 334 TRP OXT O N N 335 TRP H H N N 336 TRP H2 H N N 337 TRP HA H N N 338 TRP HB2 H N N 339 TRP HB3 H N N 340 TRP HD1 H N N 341 TRP HE1 H N N 342 TRP HE3 H N N 343 TRP HZ2 H N N 344 TRP HZ3 H N N 345 TRP HH2 H N N 346 TRP HXT H N N 347 TYR N N N N 348 TYR CA C N S 349 TYR C C N N 350 TYR O O N N 351 TYR CB C N N 352 TYR CG C Y N 353 TYR CD1 C Y N 354 TYR CD2 C Y N 355 TYR CE1 C Y N 356 TYR CE2 C Y N 357 TYR CZ C Y N 358 TYR OH O N N 359 TYR OXT O N N 360 TYR H H N N 361 TYR H2 H N N 362 TYR HA H N N 363 TYR HB2 H N N 364 TYR HB3 H N N 365 TYR HD1 H N N 366 TYR HD2 H N N 367 TYR HE1 H N N 368 TYR HE2 H N N 369 TYR HH H N N 370 TYR HXT H N N 371 VAL N N N N 372 VAL CA C N S 373 VAL C C N N 374 VAL O O N N 375 VAL CB C N N 376 VAL CG1 C N N 377 VAL CG2 C N N 378 VAL OXT O N N 379 VAL H H N N 380 VAL H2 H N N 381 VAL HA H N N 382 VAL HB H N N 383 VAL HG11 H N N 384 VAL HG12 H N N 385 VAL HG13 H N N 386 VAL HG21 H N N 387 VAL HG22 H N N 388 VAL HG23 H N N 389 VAL HXT H N N 390 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # _pdbx_audit_support.funding_organization 'National Natural Science Foundation of China (NSFC)' _pdbx_audit_support.country China _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 6gqf _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 9VV8 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.014873 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014327 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012926 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.pdbx_scat_Z _atom_type.pdbx_N_electrons _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c C 6 6 2.3103 20.8439 1.0201 10.2075 1.5888 0.5687 0.8651 51.6512 0.2156 H 1 1 0.4930 10.5109 0.3229 26.1257 0.1402 3.1424 0.0408 57.7997 0.0030 N 7 7 12.2220 0.0057 3.1346 9.8933 2.0141 28.9975 1.1672 0.5826 -11.5379 O 8 8 3.0487 13.2771 2.2870 5.7011 1.5464 0.3239 0.8671 32.9089 0.2508 S 16 16 6.9054 1.4679 5.2035 22.2151 1.4379 0.2536 1.5863 56.1720 0.8669 # loop_ #