data_9VYY # _entry.id 9VYY # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.407 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9VYY pdb_00009vyy 10.2210/pdb9vyy/pdb WWPDB D_1300061844 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2025-11-26 ? 2 'Structure model' 1 1 2025-12-03 ? 3 'Structure model' 1 2 2025-12-10 ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' citation # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.pdbx_database_id_PubMed' 2 2 'Structure model' '_citation.title' 3 3 'Structure model' '_citation.journal_volume' 4 3 'Structure model' '_citation.page_first' 5 3 'Structure model' '_citation.page_last' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9VYY _pdbx_database_status.recvd_initial_deposition_date 2025-07-21 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name PDB _pdbx_database_related.details . _pdbx_database_related.db_id 9unt _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email ravimakde@rrcat.gov.in _pdbx_contact_author.name_first R.D. _pdbx_contact_author.name_last Makde _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-7020-0065 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Yadav, B.' 1 0009-0000-7789-790X 'Gaikwad, S.S.' 2 0000-0001-5211-573X 'Shubhangi, S.' 3 ? 'Kumar, A.' 4 ? 'Chandravanshi, K.' 5 ? 'Makde, R.D.' 6 0000-0001-7020-0065 # loop_ _citation.abstract _citation.abstract_id_CAS _citation.book_id_ISBN _citation.book_publisher _citation.book_publisher_city _citation.book_title _citation.coordinate_linkage _citation.country _citation.database_id_Medline _citation.details _citation.id _citation.journal_abbrev _citation.journal_id_ASTM _citation.journal_id_CSD _citation.journal_id_ISSN _citation.journal_full _citation.journal_issue _citation.journal_volume _citation.language _citation.page_first _citation.page_last _citation.title _citation.year _citation.database_id_CSD _citation.pdbx_database_id_DOI _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_patent _citation.unpublished_flag ? ? ? ? ? ? ? US ? ? primary 'Acta Crystallogr.,Sect.F' ACSFEN ? 2053-230X ? ? 81 ? 505 516 ;Crystal structures of PF1765 from Pyrococcus furiosus from several different crystallization conditions with varied pH, salt and precipitant. ; 2025 ? 10.1107/S2053230X25009318 41243831 ? ? ? ? ? ? ? ? ? ? ? ? 1 'Acta Crystallogr D Struct Biol' ? 0353 ? ? ? ? ? ? ? 'Macromolecular structure determination using X-rays, neutrons and electrons: recent developments in Phenix' 2019 ? 10.1107/S2059798319011471 31588918 ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Gaikwad, S.S.' 1 ? primary 'Yadav, B.' 2 ? primary 'Sharma, S.' 3 ? primary 'Kumar, A.' 4 ? primary 'Kumar, A.' 5 ? primary 'Makde, R.D.' 6 ? 1 'Liebschner, D.' 7 0000-0003-3921-3209 1 'Afonine, P.V.' 8 0000-0002-5052-991X 1 'Baker, M.L.' 9 ? 1 'Bunkoczi, G.' 10 ? 1 'Chen, V.B.' 11 0000-0003-2492-979X 1 'Croll, T.I.' 12 ? 1 'Hintze, B.' 13 0000-0002-4871-2096 1 'Hung, L.W.' 14 0000-0001-6690-8458 1 'Jain, S.' 15 ? 1 'McCoy, A.J.' 16 ? 1 'Moriarty, N.W.' 17 0000-0001-8857-9464 1 'Oeffner, R.D.' 18 0000-0003-3107-2202 1 'Poon, B.K.' 19 0000-0001-9633-6067 1 'Prisant, M.G.' 20 ? 1 'Read, R.J.' 21 0000-0001-8273-0047 1 'Richardson, J.S.' 22 0000-0002-3311-2944 1 'Richardson, D.C.' 23 ? 1 'Sammito, M.D.' 24 0000-0002-8346-9247 1 'Sobolev, O.V.' 25 0000-0002-0623-3214 1 'Stockwell, D.H.' 26 ? 1 'Terwilliger, T.C.' 27 0000-0001-6384-0320 1 'Urzhumtsev, A.G.' 28 ? 1 'Videau, L.L.' 29 ? 1 'Williams, C.J.' 30 ? 1 'Adams, P.D.' 31 0000-0001-9333-8219 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'UPF0235 protein PF1765' 13952.041 1 ? ? ? ;Contains 38 amino acid long Streptavidin Histidine Tev tag at the N-terminal of the protein PF1765 in the construct. Contains 1 polypeptides in the asymmetric unit and exists as a monomer in the solution. ; 2 non-polymer syn 'SODIUM ION' 22.990 1 ? ? ? ? 3 water nat water 18.015 109 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MASWSHPQFEKGSSHHHHHHSSGSGGGGGENLYFQGSLRETSEGVILSVIVAPNARETKIVGIDGTRGRVKVNVAAPPVK GKANKELMKFFKKLFGAEVVIVRGETSREKDLLIKGITKKEVIEKLEL ; _entity_poly.pdbx_seq_one_letter_code_can ;MASWSHPQFEKGSSHHHHHHSSGSGGGGGENLYFQGSLRETSEGVILSVIVAPNARETKIVGIDGTRGRVKVNVAAPPVK GKANKELMKFFKKLFGAEVVIVRGETSREKDLLIKGITKKEVIEKLEL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SODIUM ION' NA 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 SER n 1 4 TRP n 1 5 SER n 1 6 HIS n 1 7 PRO n 1 8 GLN n 1 9 PHE n 1 10 GLU n 1 11 LYS n 1 12 GLY n 1 13 SER n 1 14 SER n 1 15 HIS n 1 16 HIS n 1 17 HIS n 1 18 HIS n 1 19 HIS n 1 20 HIS n 1 21 SER n 1 22 SER n 1 23 GLY n 1 24 SER n 1 25 GLY n 1 26 GLY n 1 27 GLY n 1 28 GLY n 1 29 GLY n 1 30 GLU n 1 31 ASN n 1 32 LEU n 1 33 TYR n 1 34 PHE n 1 35 GLN n 1 36 GLY n 1 37 SER n 1 38 LEU n 1 39 ARG n 1 40 GLU n 1 41 THR n 1 42 SER n 1 43 GLU n 1 44 GLY n 1 45 VAL n 1 46 ILE n 1 47 LEU n 1 48 SER n 1 49 VAL n 1 50 ILE n 1 51 VAL n 1 52 ALA n 1 53 PRO n 1 54 ASN n 1 55 ALA n 1 56 ARG n 1 57 GLU n 1 58 THR n 1 59 LYS n 1 60 ILE n 1 61 VAL n 1 62 GLY n 1 63 ILE n 1 64 ASP n 1 65 GLY n 1 66 THR n 1 67 ARG n 1 68 GLY n 1 69 ARG n 1 70 VAL n 1 71 LYS n 1 72 VAL n 1 73 ASN n 1 74 VAL n 1 75 ALA n 1 76 ALA n 1 77 PRO n 1 78 PRO n 1 79 VAL n 1 80 LYS n 1 81 GLY n 1 82 LYS n 1 83 ALA n 1 84 ASN n 1 85 LYS n 1 86 GLU n 1 87 LEU n 1 88 MET n 1 89 LYS n 1 90 PHE n 1 91 PHE n 1 92 LYS n 1 93 LYS n 1 94 LEU n 1 95 PHE n 1 96 GLY n 1 97 ALA n 1 98 GLU n 1 99 VAL n 1 100 VAL n 1 101 ILE n 1 102 VAL n 1 103 ARG n 1 104 GLY n 1 105 GLU n 1 106 THR n 1 107 SER n 1 108 ARG n 1 109 GLU n 1 110 LYS n 1 111 ASP n 1 112 LEU n 1 113 LEU n 1 114 ILE n 1 115 LYS n 1 116 GLY n 1 117 ILE n 1 118 THR n 1 119 LYS n 1 120 LYS n 1 121 GLU n 1 122 VAL n 1 123 ILE n 1 124 GLU n 1 125 LYS n 1 126 LEU n 1 127 GLU n 1 128 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 128 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene PF1765 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'Strain- ATCC 43587 / DSM 3638' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pyrococcus furiosus DSM 3638' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 186497 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant pLysS _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type 'pET3a based' _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details 'Tan Lab USA' _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pST50Trc2STRHISN _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NA non-polymer . 'SODIUM ION' ? 'Na 1' 22.990 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -35 ? ? ? A . n A 1 2 ALA 2 -34 ? ? ? A . n A 1 3 SER 3 -33 ? ? ? A . n A 1 4 TRP 4 -32 ? ? ? A . n A 1 5 SER 5 -31 ? ? ? A . n A 1 6 HIS 6 -30 ? ? ? A . n A 1 7 PRO 7 -29 ? ? ? A . n A 1 8 GLN 8 -28 ? ? ? A . n A 1 9 PHE 9 -27 ? ? ? A . n A 1 10 GLU 10 -26 ? ? ? A . n A 1 11 LYS 11 -25 ? ? ? A . n A 1 12 GLY 12 -24 ? ? ? A . n A 1 13 SER 13 -23 ? ? ? A . n A 1 14 SER 14 -22 ? ? ? A . n A 1 15 HIS 15 -21 ? ? ? A . n A 1 16 HIS 16 -20 ? ? ? A . n A 1 17 HIS 17 -19 ? ? ? A . n A 1 18 HIS 18 -18 ? ? ? A . n A 1 19 HIS 19 -17 ? ? ? A . n A 1 20 HIS 20 -16 ? ? ? A . n A 1 21 SER 21 -15 ? ? ? A . n A 1 22 SER 22 -14 ? ? ? A . n A 1 23 GLY 23 -13 ? ? ? A . n A 1 24 SER 24 -12 ? ? ? A . n A 1 25 GLY 25 -11 ? ? ? A . n A 1 26 GLY 26 -10 ? ? ? A . n A 1 27 GLY 27 -9 ? ? ? A . n A 1 28 GLY 28 -8 ? ? ? A . n A 1 29 GLY 29 -7 ? ? ? A . n A 1 30 GLU 30 -6 ? ? ? A . n A 1 31 ASN 31 -5 -5 ASN ASN A . n A 1 32 LEU 32 -4 -4 LEU LEU A . n A 1 33 TYR 33 -3 -3 TYR TYR A . n A 1 34 PHE 34 -2 -2 PHE PHE A . n A 1 35 GLN 35 -1 -1 GLN GLN A . n A 1 36 GLY 36 0 0 GLY GLY A . n A 1 37 SER 37 1 1 SER SER A . n A 1 38 LEU 38 2 2 LEU LEU A . n A 1 39 ARG 39 3 3 ARG ARG A . n A 1 40 GLU 40 4 4 GLU GLU A . n A 1 41 THR 41 5 5 THR THR A . n A 1 42 SER 42 6 6 SER SER A . n A 1 43 GLU 43 7 7 GLU GLU A . n A 1 44 GLY 44 8 8 GLY GLY A . n A 1 45 VAL 45 9 9 VAL VAL A . n A 1 46 ILE 46 10 10 ILE ILE A . n A 1 47 LEU 47 11 11 LEU LEU A . n A 1 48 SER 48 12 12 SER SER A . n A 1 49 VAL 49 13 13 VAL VAL A . n A 1 50 ILE 50 14 14 ILE ILE A . n A 1 51 VAL 51 15 15 VAL VAL A . n A 1 52 ALA 52 16 16 ALA ALA A . n A 1 53 PRO 53 17 17 PRO PRO A . n A 1 54 ASN 54 18 18 ASN ASN A . n A 1 55 ALA 55 19 19 ALA ALA A . n A 1 56 ARG 56 20 20 ARG ARG A . n A 1 57 GLU 57 21 21 GLU GLU A . n A 1 58 THR 58 22 22 THR THR A . n A 1 59 LYS 59 23 23 LYS LYS A . n A 1 60 ILE 60 24 24 ILE ILE A . n A 1 61 VAL 61 25 25 VAL VAL A . n A 1 62 GLY 62 26 26 GLY GLY A . n A 1 63 ILE 63 27 27 ILE ILE A . n A 1 64 ASP 64 28 28 ASP ASP A . n A 1 65 GLY 65 29 29 GLY GLY A . n A 1 66 THR 66 30 30 THR THR A . n A 1 67 ARG 67 31 31 ARG ARG A . n A 1 68 GLY 68 32 32 GLY GLY A . n A 1 69 ARG 69 33 33 ARG ARG A . n A 1 70 VAL 70 34 34 VAL VAL A . n A 1 71 LYS 71 35 35 LYS LYS A . n A 1 72 VAL 72 36 36 VAL VAL A . n A 1 73 ASN 73 37 37 ASN ASN A . n A 1 74 VAL 74 38 38 VAL VAL A . n A 1 75 ALA 75 39 39 ALA ALA A . n A 1 76 ALA 76 40 40 ALA ALA A . n A 1 77 PRO 77 41 41 PRO PRO A . n A 1 78 PRO 78 42 42 PRO PRO A . n A 1 79 VAL 79 43 43 VAL VAL A . n A 1 80 LYS 80 44 44 LYS LYS A . n A 1 81 GLY 81 45 45 GLY GLY A . n A 1 82 LYS 82 46 46 LYS LYS A . n A 1 83 ALA 83 47 47 ALA ALA A . n A 1 84 ASN 84 48 48 ASN ASN A . n A 1 85 LYS 85 49 49 LYS LYS A . n A 1 86 GLU 86 50 50 GLU GLU A . n A 1 87 LEU 87 51 51 LEU LEU A . n A 1 88 MET 88 52 52 MET MET A . n A 1 89 LYS 89 53 53 LYS LYS A . n A 1 90 PHE 90 54 54 PHE PHE A . n A 1 91 PHE 91 55 55 PHE PHE A . n A 1 92 LYS 92 56 56 LYS LYS A . n A 1 93 LYS 93 57 57 LYS LYS A . n A 1 94 LEU 94 58 58 LEU LEU A . n A 1 95 PHE 95 59 59 PHE PHE A . n A 1 96 GLY 96 60 60 GLY GLY A . n A 1 97 ALA 97 61 61 ALA ALA A . n A 1 98 GLU 98 62 62 GLU GLU A . n A 1 99 VAL 99 63 63 VAL VAL A . n A 1 100 VAL 100 64 64 VAL VAL A . n A 1 101 ILE 101 65 65 ILE ILE A . n A 1 102 VAL 102 66 66 VAL VAL A . n A 1 103 ARG 103 67 67 ARG ARG A . n A 1 104 GLY 104 68 68 GLY GLY A . n A 1 105 GLU 105 69 69 GLU GLU A . n A 1 106 THR 106 70 70 THR THR A . n A 1 107 SER 107 71 71 SER SER A . n A 1 108 ARG 108 72 72 ARG ARG A . n A 1 109 GLU 109 73 73 GLU GLU A . n A 1 110 LYS 110 74 74 LYS LYS A . n A 1 111 ASP 111 75 75 ASP ASP A . n A 1 112 LEU 112 76 76 LEU LEU A . n A 1 113 LEU 113 77 77 LEU LEU A . n A 1 114 ILE 114 78 78 ILE ILE A . n A 1 115 LYS 115 79 79 LYS LYS A . n A 1 116 GLY 116 80 80 GLY GLY A . n A 1 117 ILE 117 81 81 ILE ILE A . n A 1 118 THR 118 82 82 THR THR A . n A 1 119 LYS 119 83 83 LYS LYS A . n A 1 120 LYS 120 84 84 LYS LYS A . n A 1 121 GLU 121 85 85 GLU GLU A . n A 1 122 VAL 122 86 86 VAL VAL A . n A 1 123 ILE 123 87 87 ILE ILE A . n A 1 124 GLU 124 88 88 GLU GLU A . n A 1 125 LYS 125 89 89 LYS LYS A . n A 1 126 LEU 126 90 90 LEU LEU A . n A 1 127 GLU 127 91 91 GLU GLU A . n A 1 128 LEU 128 92 92 LEU LEU A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id NA _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id NA _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 NA 1 101 1 NA NA A . C 3 HOH 1 201 92 HOH HOH A . C 3 HOH 2 202 61 HOH HOH A . C 3 HOH 3 203 51 HOH HOH A . C 3 HOH 4 204 10 HOH HOH A . C 3 HOH 5 205 69 HOH HOH A . C 3 HOH 6 206 36 HOH HOH A . C 3 HOH 7 207 11 HOH HOH A . C 3 HOH 8 208 43 HOH HOH A . C 3 HOH 9 209 23 HOH HOH A . C 3 HOH 10 210 48 HOH HOH A . C 3 HOH 11 211 31 HOH HOH A . C 3 HOH 12 212 81 HOH HOH A . C 3 HOH 13 213 2 HOH HOH A . C 3 HOH 14 214 7 HOH HOH A . C 3 HOH 15 215 27 HOH HOH A . C 3 HOH 16 216 21 HOH HOH A . C 3 HOH 17 217 63 HOH HOH A . C 3 HOH 18 218 35 HOH HOH A . C 3 HOH 19 219 3 HOH HOH A . C 3 HOH 20 220 56 HOH HOH A . C 3 HOH 21 221 9 HOH HOH A . C 3 HOH 22 222 77 HOH HOH A . C 3 HOH 23 223 12 HOH HOH A . C 3 HOH 24 224 17 HOH HOH A . C 3 HOH 25 225 73 HOH HOH A . C 3 HOH 26 226 100 HOH HOH A . C 3 HOH 27 227 89 HOH HOH A . C 3 HOH 28 228 106 HOH HOH A . C 3 HOH 29 229 16 HOH HOH A . C 3 HOH 30 230 14 HOH HOH A . C 3 HOH 31 231 19 HOH HOH A . C 3 HOH 32 232 70 HOH HOH A . C 3 HOH 33 233 20 HOH HOH A . C 3 HOH 34 234 87 HOH HOH A . C 3 HOH 35 235 90 HOH HOH A . C 3 HOH 36 236 44 HOH HOH A . C 3 HOH 37 237 108 HOH HOH A . C 3 HOH 38 238 102 HOH HOH A . C 3 HOH 39 239 85 HOH HOH A . C 3 HOH 40 240 5 HOH HOH A . C 3 HOH 41 241 26 HOH HOH A . C 3 HOH 42 242 4 HOH HOH A . C 3 HOH 43 243 29 HOH HOH A . C 3 HOH 44 244 18 HOH HOH A . C 3 HOH 45 245 13 HOH HOH A . C 3 HOH 46 246 96 HOH HOH A . C 3 HOH 47 247 74 HOH HOH A . C 3 HOH 48 248 71 HOH HOH A . C 3 HOH 49 249 1 HOH HOH A . C 3 HOH 50 250 101 HOH HOH A . C 3 HOH 51 251 60 HOH HOH A . C 3 HOH 52 252 33 HOH HOH A . C 3 HOH 53 253 66 HOH HOH A . C 3 HOH 54 254 93 HOH HOH A . C 3 HOH 55 255 49 HOH HOH A . C 3 HOH 56 256 38 HOH HOH A . C 3 HOH 57 257 79 HOH HOH A . C 3 HOH 58 258 8 HOH HOH A . C 3 HOH 59 259 22 HOH HOH A . C 3 HOH 60 260 28 HOH HOH A . C 3 HOH 61 261 65 HOH HOH A . C 3 HOH 62 262 46 HOH HOH A . C 3 HOH 63 263 30 HOH HOH A . C 3 HOH 64 264 91 HOH HOH A . C 3 HOH 65 265 6 HOH HOH A . C 3 HOH 66 266 83 HOH HOH A . C 3 HOH 67 267 98 HOH HOH A . C 3 HOH 68 268 103 HOH HOH A . C 3 HOH 69 269 109 HOH HOH A . C 3 HOH 70 270 47 HOH HOH A . C 3 HOH 71 271 94 HOH HOH A . C 3 HOH 72 272 78 HOH HOH A . C 3 HOH 73 273 105 HOH HOH A . C 3 HOH 74 274 86 HOH HOH A . C 3 HOH 75 275 39 HOH HOH A . C 3 HOH 76 276 25 HOH HOH A . C 3 HOH 77 277 104 HOH HOH A . C 3 HOH 78 278 75 HOH HOH A . C 3 HOH 79 279 34 HOH HOH A . C 3 HOH 80 280 82 HOH HOH A . C 3 HOH 81 281 42 HOH HOH A . C 3 HOH 82 282 32 HOH HOH A . C 3 HOH 83 283 40 HOH HOH A . C 3 HOH 84 284 59 HOH HOH A . C 3 HOH 85 285 80 HOH HOH A . C 3 HOH 86 286 68 HOH HOH A . C 3 HOH 87 287 67 HOH HOH A . C 3 HOH 88 288 55 HOH HOH A . C 3 HOH 89 289 37 HOH HOH A . C 3 HOH 90 290 95 HOH HOH A . C 3 HOH 91 291 24 HOH HOH A . C 3 HOH 92 292 88 HOH HOH A . C 3 HOH 93 293 52 HOH HOH A . C 3 HOH 94 294 58 HOH HOH A . C 3 HOH 95 295 50 HOH HOH A . C 3 HOH 96 296 97 HOH HOH A . C 3 HOH 97 297 76 HOH HOH A . C 3 HOH 98 298 45 HOH HOH A . C 3 HOH 99 299 15 HOH HOH A . C 3 HOH 100 300 53 HOH HOH A . C 3 HOH 101 301 57 HOH HOH A . C 3 HOH 102 302 84 HOH HOH A . C 3 HOH 103 303 62 HOH HOH A . C 3 HOH 104 304 72 HOH HOH A . C 3 HOH 105 305 99 HOH HOH A . C 3 HOH 106 306 64 HOH HOH A . C 3 HOH 107 307 41 HOH HOH A . C 3 HOH 108 308 107 HOH HOH A . C 3 HOH 109 309 54 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . ? 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . ? 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . ? 3 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.21.2_5419 ? 4 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? . ? 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 9VYY _cell.details ? _cell.formula_units_Z ? _cell.length_a 59.438 _cell.length_a_esd ? _cell.length_b 59.438 _cell.length_b_esd ? _cell.length_c 59.819 _cell.length_c_esd ? _cell.volume 211333.100 _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9VYY _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 _symmetry.space_group_name_Hall 'P 4abw 2nw' _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9VYY _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.89 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 35.04 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'BATCH MODE' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details constant _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M Calcium chloride, 0.1 M Hepes pH 7, 20% PEG 6000' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 294 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details constant _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details Mirror _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'MARMOSAIC 225 mm CCD' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2025-04-23 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Si(111)' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.978930 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'RRCAT INDUS-2 BEAMLINE PX-BL21' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.978930 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline PX-BL21 _diffrn_source.pdbx_synchrotron_site 'RRCAT INDUS-2' # _reflns.B_iso_Wilson_estimate 20.409 _reflns.entry_id 9VYY _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.45 _reflns.d_resolution_low 42.16 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 19633 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.0 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 21.8 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 24.1 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.064 _reflns.pdbx_Rpim_I_all 0.014 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.063 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.45 _reflns_shell.d_res_low 1.48 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.1 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 975 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 18.1 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 1.448 _reflns_shell.pdbx_Rpim_I_all 0.336 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.771 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 100.0 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.407 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 32.13 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9VYY _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.45 _refine.ls_d_res_low 42.16 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 19527 _refine.ls_number_reflns_R_free 882 _refine.ls_number_reflns_R_work 18645 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.70 _refine.ls_percent_reflns_R_free 4.52 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1959 _refine.ls_R_factor_R_free 0.2172 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1949 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 9UNT _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 26.6668 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1859 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.45 _refine_hist.d_res_low 42.16 _refine_hist.number_atoms_solvent 109 _refine_hist.number_atoms_total 871 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 761 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0119 ? 775 ? f_bond_d ? ? ? 'X-RAY DIFFRACTION' ? 1.3295 ? 1039 ? f_angle_d ? ? ? 'X-RAY DIFFRACTION' ? 0.1065 ? 124 ? f_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.0204 ? 131 ? f_plane_restr ? ? ? 'X-RAY DIFFRACTION' ? 13.3052 ? 308 ? f_dihedral_angle_d ? ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.45 1.54 . . 147 3033 99.97 . . . . 0.2750 . . . . . . . . . . . . . . . 0.3018 'X-RAY DIFFRACTION' 1.54 1.66 . . 148 3062 99.94 . . . . 0.2752 . . . . . . . . . . . . . . . 0.3221 'X-RAY DIFFRACTION' 1.66 1.83 . . 140 3070 99.84 . . . . 0.2452 . . . . . . . . . . . . . . . 0.2775 'X-RAY DIFFRACTION' 1.83 2.09 . . 171 3044 99.44 . . . . 0.2145 . . . . . . . . . . . . . . . 0.2370 'X-RAY DIFFRACTION' 2.09 2.63 . . 115 3147 99.39 . . . . 0.1978 . . . . . . . . . . . . . . . 0.2394 'X-RAY DIFFRACTION' 2.63 42.16 . . 161 3289 99.68 . . . . 0.1720 . . . . . . . . . . . . . . . 0.1868 # _struct.entry_id 9VYY _struct.title 'Crystal structure of UPF0235 protein PF1765 from Pyrococcus furiosus crystallized with CaCl2 at pH 7' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9VYY _struct_keywords.text 'PF02594, evolutionary conserved, UNKNOWN FUNCTION' _struct_keywords.pdbx_keywords 'UNKNOWN FUNCTION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Y1765_PYRFU _struct_ref.pdbx_db_accession Q8U052 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;LRETSEGVILSVIVAPNARETKIVGIDGTRGRVKVNVAAPPVKGKANKELMKFFKKLFGAEVVIVRGETSREKDLLIKGI TKKEVIEKLEL ; _struct_ref.pdbx_align_begin 2 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9VYY _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 38 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 128 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8U052 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 92 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 92 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9VYY MET A 1 ? UNP Q8U052 ? ? 'initiating methionine' -35 1 1 9VYY ALA A 2 ? UNP Q8U052 ? ? 'expression tag' -34 2 1 9VYY SER A 3 ? UNP Q8U052 ? ? 'expression tag' -33 3 1 9VYY TRP A 4 ? UNP Q8U052 ? ? 'expression tag' -32 4 1 9VYY SER A 5 ? UNP Q8U052 ? ? 'expression tag' -31 5 1 9VYY HIS A 6 ? UNP Q8U052 ? ? 'expression tag' -30 6 1 9VYY PRO A 7 ? UNP Q8U052 ? ? 'expression tag' -29 7 1 9VYY GLN A 8 ? UNP Q8U052 ? ? 'expression tag' -28 8 1 9VYY PHE A 9 ? UNP Q8U052 ? ? 'expression tag' -27 9 1 9VYY GLU A 10 ? UNP Q8U052 ? ? 'expression tag' -26 10 1 9VYY LYS A 11 ? UNP Q8U052 ? ? 'expression tag' -25 11 1 9VYY GLY A 12 ? UNP Q8U052 ? ? 'expression tag' -24 12 1 9VYY SER A 13 ? UNP Q8U052 ? ? 'expression tag' -23 13 1 9VYY SER A 14 ? UNP Q8U052 ? ? 'expression tag' -22 14 1 9VYY HIS A 15 ? UNP Q8U052 ? ? 'expression tag' -21 15 1 9VYY HIS A 16 ? UNP Q8U052 ? ? 'expression tag' -20 16 1 9VYY HIS A 17 ? UNP Q8U052 ? ? 'expression tag' -19 17 1 9VYY HIS A 18 ? UNP Q8U052 ? ? 'expression tag' -18 18 1 9VYY HIS A 19 ? UNP Q8U052 ? ? 'expression tag' -17 19 1 9VYY HIS A 20 ? UNP Q8U052 ? ? 'expression tag' -16 20 1 9VYY SER A 21 ? UNP Q8U052 ? ? 'expression tag' -15 21 1 9VYY SER A 22 ? UNP Q8U052 ? ? 'expression tag' -14 22 1 9VYY GLY A 23 ? UNP Q8U052 ? ? 'expression tag' -13 23 1 9VYY SER A 24 ? UNP Q8U052 ? ? 'expression tag' -12 24 1 9VYY GLY A 25 ? UNP Q8U052 ? ? 'expression tag' -11 25 1 9VYY GLY A 26 ? UNP Q8U052 ? ? 'expression tag' -10 26 1 9VYY GLY A 27 ? UNP Q8U052 ? ? 'expression tag' -9 27 1 9VYY GLY A 28 ? UNP Q8U052 ? ? 'expression tag' -8 28 1 9VYY GLY A 29 ? UNP Q8U052 ? ? 'expression tag' -7 29 1 9VYY GLU A 30 ? UNP Q8U052 ? ? 'expression tag' -6 30 1 9VYY ASN A 31 ? UNP Q8U052 ? ? 'expression tag' -5 31 1 9VYY LEU A 32 ? UNP Q8U052 ? ? 'expression tag' -4 32 1 9VYY TYR A 33 ? UNP Q8U052 ? ? 'expression tag' -3 33 1 9VYY PHE A 34 ? UNP Q8U052 ? ? 'expression tag' -2 34 1 9VYY GLN A 35 ? UNP Q8U052 ? ? 'expression tag' -1 35 1 9VYY GLY A 36 ? UNP Q8U052 ? ? 'expression tag' 0 36 1 9VYY SER A 37 ? UNP Q8U052 ? ? 'expression tag' 1 37 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details Monomer # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PHE A 34 ? GLY A 36 ? PHE A -2 GLY A 0 5 ? 3 HELX_P HELX_P2 AA2 GLY A 81 ? GLY A 96 ? GLY A 45 GLY A 60 1 ? 16 HELX_P HELX_P3 AA3 THR A 118 ? GLU A 127 ? THR A 82 GLU A 91 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id metalc1 _struct_conn.conn_type_id metalc _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id B _struct_conn.ptnr1_label_comp_id NA _struct_conn.ptnr1_label_seq_id . _struct_conn.ptnr1_label_atom_id NA _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id C _struct_conn.ptnr2_label_comp_id HOH _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id O _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id NA _struct_conn.ptnr1_auth_seq_id 101 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id HOH _struct_conn.ptnr2_auth_seq_id 242 _struct_conn.ptnr2_symmetry 4_444 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 3.190 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 38 ? GLU A 40 ? LEU A 2 GLU A 4 AA1 2 GLY A 44 ? ALA A 52 ? GLY A 8 ALA A 16 AA1 3 ARG A 69 ? ASN A 73 ? ARG A 33 ASN A 37 AA1 4 LYS A 59 ? ASP A 64 ? LYS A 23 ASP A 28 AA2 1 LEU A 38 ? GLU A 40 ? LEU A 2 GLU A 4 AA2 2 GLY A 44 ? ALA A 52 ? GLY A 8 ALA A 16 AA2 3 GLU A 109 ? LYS A 115 ? GLU A 73 LYS A 79 AA2 4 VAL A 99 ? ARG A 103 ? VAL A 63 ARG A 67 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ARG A 39 ? N ARG A 3 O ILE A 46 ? O ILE A 10 AA1 2 3 N ILE A 50 ? N ILE A 14 O VAL A 70 ? O VAL A 34 AA1 3 4 O ARG A 69 ? O ARG A 33 N ASP A 64 ? N ASP A 28 AA2 1 2 N ARG A 39 ? N ARG A 3 O ILE A 46 ? O ILE A 10 AA2 2 3 N LEU A 47 ? N LEU A 11 O LEU A 112 ? O LEU A 76 AA2 3 4 O LEU A 113 ? O LEU A 77 N VAL A 100 ? N VAL A 64 # _pdbx_entry_details.entry_id 9VYY _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A LEU 2 ? ? CA A LEU 2 ? ? C A LEU 2 ? ? 98.57 110.20 -11.63 1.90 N 2 1 CB A LEU 2 ? ? CG A LEU 2 ? ? CD2 A LEU 2 ? ? 99.45 111.00 -11.55 1.70 N # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id PRO _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 42 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -82.99 _pdbx_validate_torsion.psi 33.55 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 33 ? ? 0.081 'SIDE CHAIN' 2 1 ARG A 72 ? ? 0.091 'SIDE CHAIN' # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 225 ? C HOH . 2 1 A HOH 238 ? C HOH . 3 1 A HOH 250 ? C HOH . 4 1 A HOH 297 ? C HOH . # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y+1/2,x+1/2,z+1/4 3 y+1/2,-x+1/2,z+3/4 4 x+1/2,-y+1/2,-z+3/4 5 -x+1/2,y+1/2,-z+1/4 6 -x,-y,z+1/2 7 y,x,-z 8 -y,-x,-z+1/2 # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x -13.2832390519 _pdbx_refine_tls.origin_y 13.1485494664 _pdbx_refine_tls.origin_z -3.36444020436 _pdbx_refine_tls.T[1][1] 0.15159546224 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] 0.0177911436841 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] -0.0426478193677 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.162679603053 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] 0.0220226013565 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.155033073453 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 4.26740259599 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] -0.0967823777328 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] -1.85982812784 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 2.68641031574 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] 1.32650250229 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 3.95269695421 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] 0.0939492703267 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] -0.225111319959 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] 0.134198100928 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] 0.214323034401 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] -0.008127538639 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] -0.0912099473679 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] -0.0791703627491 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] -0.0391637637062 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] -0.0761215956761 _pdbx_refine_tls.S[3][3]_esd ? # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_label_asym_id A _pdbx_refine_tls_group.beg_label_seq_id 1 _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id -5 _pdbx_refine_tls_group.beg_PDB_ins_code ? _pdbx_refine_tls_group.end_label_asym_id C _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id B _pdbx_refine_tls_group.end_auth_seq_id 1 _pdbx_refine_tls_group.end_PDB_ins_code ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details all # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 307 ? 6.14 . 2 1 O ? A HOH 308 ? 6.23 . 3 1 O ? A HOH 309 ? 6.72 . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -35 ? A MET 1 2 1 Y 1 A ALA -34 ? A ALA 2 3 1 Y 1 A SER -33 ? A SER 3 4 1 Y 1 A TRP -32 ? A TRP 4 5 1 Y 1 A SER -31 ? A SER 5 6 1 Y 1 A HIS -30 ? A HIS 6 7 1 Y 1 A PRO -29 ? A PRO 7 8 1 Y 1 A GLN -28 ? A GLN 8 9 1 Y 1 A PHE -27 ? A PHE 9 10 1 Y 1 A GLU -26 ? A GLU 10 11 1 Y 1 A LYS -25 ? A LYS 11 12 1 Y 1 A GLY -24 ? A GLY 12 13 1 Y 1 A SER -23 ? A SER 13 14 1 Y 1 A SER -22 ? A SER 14 15 1 Y 1 A HIS -21 ? A HIS 15 16 1 Y 1 A HIS -20 ? A HIS 16 17 1 Y 1 A HIS -19 ? A HIS 17 18 1 Y 1 A HIS -18 ? A HIS 18 19 1 Y 1 A HIS -17 ? A HIS 19 20 1 Y 1 A HIS -16 ? A HIS 20 21 1 Y 1 A SER -15 ? A SER 21 22 1 Y 1 A SER -14 ? A SER 22 23 1 Y 1 A GLY -13 ? A GLY 23 24 1 Y 1 A SER -12 ? A SER 24 25 1 Y 1 A GLY -11 ? A GLY 25 26 1 Y 1 A GLY -10 ? A GLY 26 27 1 Y 1 A GLY -9 ? A GLY 27 28 1 Y 1 A GLY -8 ? A GLY 28 29 1 Y 1 A GLY -7 ? A GLY 29 30 1 Y 1 A GLU -6 ? A GLU 30 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 HOH O O N N 144 HOH H1 H N N 145 HOH H2 H N N 146 ILE N N N N 147 ILE CA C N S 148 ILE C C N N 149 ILE O O N N 150 ILE CB C N S 151 ILE CG1 C N N 152 ILE CG2 C N N 153 ILE CD1 C N N 154 ILE OXT O N N 155 ILE H H N N 156 ILE H2 H N N 157 ILE HA H N N 158 ILE HB H N N 159 ILE HG12 H N N 160 ILE HG13 H N N 161 ILE HG21 H N N 162 ILE HG22 H N N 163 ILE HG23 H N N 164 ILE HD11 H N N 165 ILE HD12 H N N 166 ILE HD13 H N N 167 ILE HXT H N N 168 LEU N N N N 169 LEU CA C N S 170 LEU C C N N 171 LEU O O N N 172 LEU CB C N N 173 LEU CG C N N 174 LEU CD1 C N N 175 LEU CD2 C N N 176 LEU OXT O N N 177 LEU H H N N 178 LEU H2 H N N 179 LEU HA H N N 180 LEU HB2 H N N 181 LEU HB3 H N N 182 LEU HG H N N 183 LEU HD11 H N N 184 LEU HD12 H N N 185 LEU HD13 H N N 186 LEU HD21 H N N 187 LEU HD22 H N N 188 LEU HD23 H N N 189 LEU HXT H N N 190 LYS N N N N 191 LYS CA C N S 192 LYS C C N N 193 LYS O O N N 194 LYS CB C N N 195 LYS CG C N N 196 LYS CD C N N 197 LYS CE C N N 198 LYS NZ N N N 199 LYS OXT O N N 200 LYS H H N N 201 LYS H2 H N N 202 LYS HA H N N 203 LYS HB2 H N N 204 LYS HB3 H N N 205 LYS HG2 H N N 206 LYS HG3 H N N 207 LYS HD2 H N N 208 LYS HD3 H N N 209 LYS HE2 H N N 210 LYS HE3 H N N 211 LYS HZ1 H N N 212 LYS HZ2 H N N 213 LYS HZ3 H N N 214 LYS HXT H N N 215 MET N N N N 216 MET CA C N S 217 MET C C N N 218 MET O O N N 219 MET CB C N N 220 MET CG C N N 221 MET SD S N N 222 MET CE C N N 223 MET OXT O N N 224 MET H H N N 225 MET H2 H N N 226 MET HA H N N 227 MET HB2 H N N 228 MET HB3 H N N 229 MET HG2 H N N 230 MET HG3 H N N 231 MET HE1 H N N 232 MET HE2 H N N 233 MET HE3 H N N 234 MET HXT H N N 235 NA NA NA N N 236 PHE N N N N 237 PHE CA C N S 238 PHE C C N N 239 PHE O O N N 240 PHE CB C N N 241 PHE CG C Y N 242 PHE CD1 C Y N 243 PHE CD2 C Y N 244 PHE CE1 C Y N 245 PHE CE2 C Y N 246 PHE CZ C Y N 247 PHE OXT O N N 248 PHE H H N N 249 PHE H2 H N N 250 PHE HA H N N 251 PHE HB2 H N N 252 PHE HB3 H N N 253 PHE HD1 H N N 254 PHE HD2 H N N 255 PHE HE1 H N N 256 PHE HE2 H N N 257 PHE HZ H N N 258 PHE HXT H N N 259 PRO N N N N 260 PRO CA C N S 261 PRO C C N N 262 PRO O O N N 263 PRO CB C N N 264 PRO CG C N N 265 PRO CD C N N 266 PRO OXT O N N 267 PRO H H N N 268 PRO HA H N N 269 PRO HB2 H N N 270 PRO HB3 H N N 271 PRO HG2 H N N 272 PRO HG3 H N N 273 PRO HD2 H N N 274 PRO HD3 H N N 275 PRO HXT H N N 276 SER N N N N 277 SER CA C N S 278 SER C C N N 279 SER O O N N 280 SER CB C N N 281 SER OG O N N 282 SER OXT O N N 283 SER H H N N 284 SER H2 H N N 285 SER HA H N N 286 SER HB2 H N N 287 SER HB3 H N N 288 SER HG H N N 289 SER HXT H N N 290 THR N N N N 291 THR CA C N S 292 THR C C N N 293 THR O O N N 294 THR CB C N R 295 THR OG1 O N N 296 THR CG2 C N N 297 THR OXT O N N 298 THR H H N N 299 THR H2 H N N 300 THR HA H N N 301 THR HB H N N 302 THR HG1 H N N 303 THR HG21 H N N 304 THR HG22 H N N 305 THR HG23 H N N 306 THR HXT H N N 307 TRP N N N N 308 TRP CA C N S 309 TRP C C N N 310 TRP O O N N 311 TRP CB C N N 312 TRP CG C Y N 313 TRP CD1 C Y N 314 TRP CD2 C Y N 315 TRP NE1 N Y N 316 TRP CE2 C Y N 317 TRP CE3 C Y N 318 TRP CZ2 C Y N 319 TRP CZ3 C Y N 320 TRP CH2 C Y N 321 TRP OXT O N N 322 TRP H H N N 323 TRP H2 H N N 324 TRP HA H N N 325 TRP HB2 H N N 326 TRP HB3 H N N 327 TRP HD1 H N N 328 TRP HE1 H N N 329 TRP HE3 H N N 330 TRP HZ2 H N N 331 TRP HZ3 H N N 332 TRP HH2 H N N 333 TRP HXT H N N 334 TYR N N N N 335 TYR CA C N S 336 TYR C C N N 337 TYR O O N N 338 TYR CB C N N 339 TYR CG C Y N 340 TYR CD1 C Y N 341 TYR CD2 C Y N 342 TYR CE1 C Y N 343 TYR CE2 C Y N 344 TYR CZ C Y N 345 TYR OH O N N 346 TYR OXT O N N 347 TYR H H N N 348 TYR H2 H N N 349 TYR HA H N N 350 TYR HB2 H N N 351 TYR HB3 H N N 352 TYR HD1 H N N 353 TYR HD2 H N N 354 TYR HE1 H N N 355 TYR HE2 H N N 356 TYR HH H N N 357 TYR HXT H N N 358 VAL N N N N 359 VAL CA C N S 360 VAL C C N N 361 VAL O O N N 362 VAL CB C N N 363 VAL CG1 C N N 364 VAL CG2 C N N 365 VAL OXT O N N 366 VAL H H N N 367 VAL H2 H N N 368 VAL HA H N N 369 VAL HB H N N 370 VAL HG11 H N N 371 VAL HG12 H N N 372 VAL HG13 H N N 373 VAL HG21 H N N 374 VAL HG22 H N N 375 VAL HG23 H N N 376 VAL HXT H N N 377 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 MET N CA sing N N 205 MET N H sing N N 206 MET N H2 sing N N 207 MET CA C sing N N 208 MET CA CB sing N N 209 MET CA HA sing N N 210 MET C O doub N N 211 MET C OXT sing N N 212 MET CB CG sing N N 213 MET CB HB2 sing N N 214 MET CB HB3 sing N N 215 MET CG SD sing N N 216 MET CG HG2 sing N N 217 MET CG HG3 sing N N 218 MET SD CE sing N N 219 MET CE HE1 sing N N 220 MET CE HE2 sing N N 221 MET CE HE3 sing N N 222 MET OXT HXT sing N N 223 PHE N CA sing N N 224 PHE N H sing N N 225 PHE N H2 sing N N 226 PHE CA C sing N N 227 PHE CA CB sing N N 228 PHE CA HA sing N N 229 PHE C O doub N N 230 PHE C OXT sing N N 231 PHE CB CG sing N N 232 PHE CB HB2 sing N N 233 PHE CB HB3 sing N N 234 PHE CG CD1 doub Y N 235 PHE CG CD2 sing Y N 236 PHE CD1 CE1 sing Y N 237 PHE CD1 HD1 sing N N 238 PHE CD2 CE2 doub Y N 239 PHE CD2 HD2 sing N N 240 PHE CE1 CZ doub Y N 241 PHE CE1 HE1 sing N N 242 PHE CE2 CZ sing Y N 243 PHE CE2 HE2 sing N N 244 PHE CZ HZ sing N N 245 PHE OXT HXT sing N N 246 PRO N CA sing N N 247 PRO N CD sing N N 248 PRO N H sing N N 249 PRO CA C sing N N 250 PRO CA CB sing N N 251 PRO CA HA sing N N 252 PRO C O doub N N 253 PRO C OXT sing N N 254 PRO CB CG sing N N 255 PRO CB HB2 sing N N 256 PRO CB HB3 sing N N 257 PRO CG CD sing N N 258 PRO CG HG2 sing N N 259 PRO CG HG3 sing N N 260 PRO CD HD2 sing N N 261 PRO CD HD3 sing N N 262 PRO OXT HXT sing N N 263 SER N CA sing N N 264 SER N H sing N N 265 SER N H2 sing N N 266 SER CA C sing N N 267 SER CA CB sing N N 268 SER CA HA sing N N 269 SER C O doub N N 270 SER C OXT sing N N 271 SER CB OG sing N N 272 SER CB HB2 sing N N 273 SER CB HB3 sing N N 274 SER OG HG sing N N 275 SER OXT HXT sing N N 276 THR N CA sing N N 277 THR N H sing N N 278 THR N H2 sing N N 279 THR CA C sing N N 280 THR CA CB sing N N 281 THR CA HA sing N N 282 THR C O doub N N 283 THR C OXT sing N N 284 THR CB OG1 sing N N 285 THR CB CG2 sing N N 286 THR CB HB sing N N 287 THR OG1 HG1 sing N N 288 THR CG2 HG21 sing N N 289 THR CG2 HG22 sing N N 290 THR CG2 HG23 sing N N 291 THR OXT HXT sing N N 292 TRP N CA sing N N 293 TRP N H sing N N 294 TRP N H2 sing N N 295 TRP CA C sing N N 296 TRP CA CB sing N N 297 TRP CA HA sing N N 298 TRP C O doub N N 299 TRP C OXT sing N N 300 TRP CB CG sing N N 301 TRP CB HB2 sing N N 302 TRP CB HB3 sing N N 303 TRP CG CD1 doub Y N 304 TRP CG CD2 sing Y N 305 TRP CD1 NE1 sing Y N 306 TRP CD1 HD1 sing N N 307 TRP CD2 CE2 doub Y N 308 TRP CD2 CE3 sing Y N 309 TRP NE1 CE2 sing Y N 310 TRP NE1 HE1 sing N N 311 TRP CE2 CZ2 sing Y N 312 TRP CE3 CZ3 doub Y N 313 TRP CE3 HE3 sing N N 314 TRP CZ2 CH2 doub Y N 315 TRP CZ2 HZ2 sing N N 316 TRP CZ3 CH2 sing Y N 317 TRP CZ3 HZ3 sing N N 318 TRP CH2 HH2 sing N N 319 TRP OXT HXT sing N N 320 TYR N CA sing N N 321 TYR N H sing N N 322 TYR N H2 sing N N 323 TYR CA C sing N N 324 TYR CA CB sing N N 325 TYR CA HA sing N N 326 TYR C O doub N N 327 TYR C OXT sing N N 328 TYR CB CG sing N N 329 TYR CB HB2 sing N N 330 TYR CB HB3 sing N N 331 TYR CG CD1 doub Y N 332 TYR CG CD2 sing Y N 333 TYR CD1 CE1 sing Y N 334 TYR CD1 HD1 sing N N 335 TYR CD2 CE2 doub Y N 336 TYR CD2 HD2 sing N N 337 TYR CE1 CZ doub Y N 338 TYR CE1 HE1 sing N N 339 TYR CE2 CZ sing Y N 340 TYR CE2 HE2 sing N N 341 TYR CZ OH sing N N 342 TYR OH HH sing N N 343 TYR OXT HXT sing N N 344 VAL N CA sing N N 345 VAL N H sing N N 346 VAL N H2 sing N N 347 VAL CA C sing N N 348 VAL CA CB sing N N 349 VAL CA HA sing N N 350 VAL C O doub N N 351 VAL C OXT sing N N 352 VAL CB CG1 sing N N 353 VAL CB CG2 sing N N 354 VAL CB HB sing N N 355 VAL CG1 HG11 sing N N 356 VAL CG1 HG12 sing N N 357 VAL CG1 HG13 sing N N 358 VAL CG2 HG21 sing N N 359 VAL CG2 HG22 sing N N 360 VAL CG2 HG23 sing N N 361 VAL OXT HXT sing N N 362 # _pdbx_audit_support.funding_organization 'Department of Science & Technology (DST, India)' _pdbx_audit_support.country India _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 9unt _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'P 41 21 2' _space_group.name_Hall 'P 4abw 2nw' _space_group.IT_number 92 _space_group.crystal_system tetragonal _space_group.id 1 # _atom_sites.entry_id 9VYY _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.016824 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016824 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.016717 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? NA ? ? 9.38062 1.54875 ? ? 3.38349 72.32734 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ # loop_ #