data_9W29 # _entry.id 9W29 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.414 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9W29 pdb_00009w29 10.2210/pdb9w29/pdb WWPDB D_1300062016 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-06-03 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9W29 _pdbx_database_status.recvd_initial_deposition_date 2025-07-27 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBC _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _pdbx_contact_author.id _pdbx_contact_author.email _pdbx_contact_author.name_first _pdbx_contact_author.name_last _pdbx_contact_author.name_mi _pdbx_contact_author.role _pdbx_contact_author.identifier_ORCID 2 yvliu@nankai.edu.cn LIU YIJIN ? 'principal investigator/group leader' 0000-0002-3643-8683 3 huangxinglu@nankai.edu.cn XINGLU HUANG ? 'principal investigator/group leader' 0000-0002-9378-7425 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Liu, Y.' 1 ? 'Zhao, M.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Computationally Guided Protein-Gold Nanosheet Nanostructures for Targeted Recognition and Clearance of Amyloid-beta Plaques' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Liu, Y.' 1 ? primary 'Zhao, M.' 2 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Ferritin heavy chain' 21255.656 1 1.16.3.1 ? ? ? 2 non-polymer syn 'GOLD ION' 196.967 4 ? ? ? ? 3 non-polymer syn 'MAGNESIUM ION' 24.305 1 ? ? ? ? 4 water nat water 18.015 95 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Ferritin H subunit,Cell proliferation-inducing gene 15 protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MTTASTSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGR IFLQDIKKPDCDDWESGLNAMECALHLEKNVNQSLLELHKLATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTNLRKMG APESGLAEYLFDKHTLGDSDNES ; _entity_poly.pdbx_seq_one_letter_code_can ;MTTASTSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGR IFLQDIKKPDCDDWESGLNAMECALHLEKNVNQSLLELHKLATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTNLRKMG APESGLAEYLFDKHTLGDSDNES ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'GOLD ION' AU 3 'MAGNESIUM ION' MG 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 THR n 1 3 THR n 1 4 ALA n 1 5 SER n 1 6 THR n 1 7 SER n 1 8 GLN n 1 9 VAL n 1 10 ARG n 1 11 GLN n 1 12 ASN n 1 13 TYR n 1 14 HIS n 1 15 GLN n 1 16 ASP n 1 17 SER n 1 18 GLU n 1 19 ALA n 1 20 ALA n 1 21 ILE n 1 22 ASN n 1 23 ARG n 1 24 GLN n 1 25 ILE n 1 26 ASN n 1 27 LEU n 1 28 GLU n 1 29 LEU n 1 30 TYR n 1 31 ALA n 1 32 SER n 1 33 TYR n 1 34 VAL n 1 35 TYR n 1 36 LEU n 1 37 SER n 1 38 MET n 1 39 SER n 1 40 TYR n 1 41 TYR n 1 42 PHE n 1 43 ASP n 1 44 ARG n 1 45 ASP n 1 46 ASP n 1 47 VAL n 1 48 ALA n 1 49 LEU n 1 50 LYS n 1 51 ASN n 1 52 PHE n 1 53 ALA n 1 54 LYS n 1 55 TYR n 1 56 PHE n 1 57 LEU n 1 58 HIS n 1 59 GLN n 1 60 SER n 1 61 HIS n 1 62 GLU n 1 63 GLU n 1 64 ARG n 1 65 GLU n 1 66 HIS n 1 67 ALA n 1 68 GLU n 1 69 LYS n 1 70 LEU n 1 71 MET n 1 72 LYS n 1 73 LEU n 1 74 GLN n 1 75 ASN n 1 76 GLN n 1 77 ARG n 1 78 GLY n 1 79 GLY n 1 80 ARG n 1 81 ILE n 1 82 PHE n 1 83 LEU n 1 84 GLN n 1 85 ASP n 1 86 ILE n 1 87 LYS n 1 88 LYS n 1 89 PRO n 1 90 ASP n 1 91 CYS n 1 92 ASP n 1 93 ASP n 1 94 TRP n 1 95 GLU n 1 96 SER n 1 97 GLY n 1 98 LEU n 1 99 ASN n 1 100 ALA n 1 101 MET n 1 102 GLU n 1 103 CYS n 1 104 ALA n 1 105 LEU n 1 106 HIS n 1 107 LEU n 1 108 GLU n 1 109 LYS n 1 110 ASN n 1 111 VAL n 1 112 ASN n 1 113 GLN n 1 114 SER n 1 115 LEU n 1 116 LEU n 1 117 GLU n 1 118 LEU n 1 119 HIS n 1 120 LYS n 1 121 LEU n 1 122 ALA n 1 123 THR n 1 124 ASP n 1 125 LYS n 1 126 ASN n 1 127 ASP n 1 128 PRO n 1 129 HIS n 1 130 LEU n 1 131 CYS n 1 132 ASP n 1 133 PHE n 1 134 ILE n 1 135 GLU n 1 136 THR n 1 137 HIS n 1 138 TYR n 1 139 LEU n 1 140 ASN n 1 141 GLU n 1 142 GLN n 1 143 VAL n 1 144 LYS n 1 145 ALA n 1 146 ILE n 1 147 LYS n 1 148 GLU n 1 149 LEU n 1 150 GLY n 1 151 ASP n 1 152 HIS n 1 153 VAL n 1 154 THR n 1 155 ASN n 1 156 LEU n 1 157 ARG n 1 158 LYS n 1 159 MET n 1 160 GLY n 1 161 ALA n 1 162 PRO n 1 163 GLU n 1 164 SER n 1 165 GLY n 1 166 LEU n 1 167 ALA n 1 168 GLU n 1 169 TYR n 1 170 LEU n 1 171 PHE n 1 172 ASP n 1 173 LYS n 1 174 HIS n 1 175 THR n 1 176 LEU n 1 177 GLY n 1 178 ASP n 1 179 SER n 1 180 ASP n 1 181 ASN n 1 182 GLU n 1 183 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 183 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'FTH1, FTH, FTHL6, OK/SW-cl.84, PIG15' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia phage EcSzw-2' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 2419741 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 AU non-polymer . 'GOLD ION' ? 'Au 1' 196.967 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 0 ? ? ? A . n A 1 2 THR 2 1 ? ? ? A . n A 1 3 THR 3 2 ? ? ? A . n A 1 4 ALA 4 3 ? ? ? A . n A 1 5 SER 5 4 ? ? ? A . n A 1 6 THR 6 5 5 THR THR A . n A 1 7 SER 7 6 6 SER SER A . n A 1 8 GLN 8 7 7 GLN GLN A . n A 1 9 VAL 9 8 8 VAL VAL A . n A 1 10 ARG 10 9 9 ARG ARG A . n A 1 11 GLN 11 10 10 GLN GLN A . n A 1 12 ASN 12 11 11 ASN ASN A . n A 1 13 TYR 13 12 12 TYR TYR A . n A 1 14 HIS 14 13 13 HIS HIS A . n A 1 15 GLN 15 14 14 GLN GLN A . n A 1 16 ASP 16 15 15 ASP ASP A . n A 1 17 SER 17 16 16 SER SER A . n A 1 18 GLU 18 17 17 GLU GLU A . n A 1 19 ALA 19 18 18 ALA ALA A . n A 1 20 ALA 20 19 19 ALA ALA A . n A 1 21 ILE 21 20 20 ILE ILE A . n A 1 22 ASN 22 21 21 ASN ASN A . n A 1 23 ARG 23 22 22 ARG ARG A . n A 1 24 GLN 24 23 23 GLN GLN A . n A 1 25 ILE 25 24 24 ILE ILE A . n A 1 26 ASN 26 25 25 ASN ASN A . n A 1 27 LEU 27 26 26 LEU LEU A . n A 1 28 GLU 28 27 27 GLU GLU A . n A 1 29 LEU 29 28 28 LEU LEU A . n A 1 30 TYR 30 29 29 TYR TYR A . n A 1 31 ALA 31 30 30 ALA ALA A . n A 1 32 SER 32 31 31 SER SER A . n A 1 33 TYR 33 32 32 TYR TYR A . n A 1 34 VAL 34 33 33 VAL VAL A . n A 1 35 TYR 35 34 34 TYR TYR A . n A 1 36 LEU 36 35 35 LEU LEU A . n A 1 37 SER 37 36 36 SER SER A . n A 1 38 MET 38 37 37 MET MET A . n A 1 39 SER 39 38 38 SER SER A . n A 1 40 TYR 40 39 39 TYR TYR A . n A 1 41 TYR 41 40 40 TYR TYR A . n A 1 42 PHE 42 41 41 PHE PHE A . n A 1 43 ASP 43 42 42 ASP ASP A . n A 1 44 ARG 44 43 43 ARG ARG A . n A 1 45 ASP 45 44 44 ASP ASP A . n A 1 46 ASP 46 45 45 ASP ASP A . n A 1 47 VAL 47 46 46 VAL VAL A . n A 1 48 ALA 48 47 47 ALA ALA A . n A 1 49 LEU 49 48 48 LEU LEU A . n A 1 50 LYS 50 49 49 LYS LYS A . n A 1 51 ASN 51 50 50 ASN ASN A . n A 1 52 PHE 52 51 51 PHE PHE A . n A 1 53 ALA 53 52 52 ALA ALA A . n A 1 54 LYS 54 53 53 LYS LYS A . n A 1 55 TYR 55 54 54 TYR TYR A . n A 1 56 PHE 56 55 55 PHE PHE A . n A 1 57 LEU 57 56 56 LEU LEU A . n A 1 58 HIS 58 57 57 HIS HIS A . n A 1 59 GLN 59 58 58 GLN GLN A . n A 1 60 SER 60 59 59 SER SER A . n A 1 61 HIS 61 60 60 HIS HIS A . n A 1 62 GLU 62 61 61 GLU GLU A . n A 1 63 GLU 63 62 62 GLU GLU A . n A 1 64 ARG 64 63 63 ARG ARG A . n A 1 65 GLU 65 64 64 GLU GLU A . n A 1 66 HIS 66 65 65 HIS HIS A . n A 1 67 ALA 67 66 66 ALA ALA A . n A 1 68 GLU 68 67 67 GLU GLU A . n A 1 69 LYS 69 68 68 LYS LYS A . n A 1 70 LEU 70 69 69 LEU LEU A . n A 1 71 MET 71 70 70 MET MET A . n A 1 72 LYS 72 71 71 LYS LYS A . n A 1 73 LEU 73 72 72 LEU LEU A . n A 1 74 GLN 74 73 73 GLN GLN A . n A 1 75 ASN 75 74 74 ASN ASN A . n A 1 76 GLN 76 75 75 GLN GLN A . n A 1 77 ARG 77 76 76 ARG ARG A . n A 1 78 GLY 78 77 77 GLY GLY A . n A 1 79 GLY 79 78 78 GLY GLY A . n A 1 80 ARG 80 79 79 ARG ARG A . n A 1 81 ILE 81 80 80 ILE ILE A . n A 1 82 PHE 82 81 81 PHE PHE A . n A 1 83 LEU 83 82 82 LEU LEU A . n A 1 84 GLN 84 83 83 GLN GLN A . n A 1 85 ASP 85 84 84 ASP ASP A . n A 1 86 ILE 86 85 85 ILE ILE A . n A 1 87 LYS 87 86 86 LYS LYS A . n A 1 88 LYS 88 87 87 LYS LYS A . n A 1 89 PRO 89 88 88 PRO PRO A . n A 1 90 ASP 90 89 89 ASP ASP A . n A 1 91 CYS 91 90 90 CYS CYS A . n A 1 92 ASP 92 91 91 ASP ASP A . n A 1 93 ASP 93 92 92 ASP ASP A . n A 1 94 TRP 94 93 93 TRP TRP A . n A 1 95 GLU 95 94 94 GLU GLU A . n A 1 96 SER 96 95 95 SER SER A . n A 1 97 GLY 97 96 96 GLY GLY A . n A 1 98 LEU 98 97 97 LEU LEU A . n A 1 99 ASN 99 98 98 ASN ASN A . n A 1 100 ALA 100 99 99 ALA ALA A . n A 1 101 MET 101 100 100 MET MET A . n A 1 102 GLU 102 101 101 GLU GLU A . n A 1 103 CYS 103 102 102 CYS CYS A . n A 1 104 ALA 104 103 103 ALA ALA A . n A 1 105 LEU 105 104 104 LEU LEU A . n A 1 106 HIS 106 105 105 HIS HIS A . n A 1 107 LEU 107 106 106 LEU LEU A . n A 1 108 GLU 108 107 107 GLU GLU A . n A 1 109 LYS 109 108 108 LYS LYS A . n A 1 110 ASN 110 109 109 ASN ASN A . n A 1 111 VAL 111 110 110 VAL VAL A . n A 1 112 ASN 112 111 111 ASN ASN A . n A 1 113 GLN 113 112 112 GLN GLN A . n A 1 114 SER 114 113 113 SER SER A . n A 1 115 LEU 115 114 114 LEU LEU A . n A 1 116 LEU 116 115 115 LEU LEU A . n A 1 117 GLU 117 116 116 GLU GLU A . n A 1 118 LEU 118 117 117 LEU LEU A . n A 1 119 HIS 119 118 118 HIS HIS A . n A 1 120 LYS 120 119 119 LYS LYS A . n A 1 121 LEU 121 120 120 LEU LEU A . n A 1 122 ALA 122 121 121 ALA ALA A . n A 1 123 THR 123 122 122 THR THR A . n A 1 124 ASP 124 123 123 ASP ASP A . n A 1 125 LYS 125 124 124 LYS LYS A . n A 1 126 ASN 126 125 125 ASN ASN A . n A 1 127 ASP 127 126 126 ASP ASP A . n A 1 128 PRO 128 127 127 PRO PRO A . n A 1 129 HIS 129 128 128 HIS HIS A . n A 1 130 LEU 130 129 129 LEU LEU A . n A 1 131 CYS 131 130 130 CYS CYS A . n A 1 132 ASP 132 131 131 ASP ASP A . n A 1 133 PHE 133 132 132 PHE PHE A . n A 1 134 ILE 134 133 133 ILE ILE A . n A 1 135 GLU 135 134 134 GLU GLU A . n A 1 136 THR 136 135 135 THR THR A . n A 1 137 HIS 137 136 136 HIS HIS A . n A 1 138 TYR 138 137 137 TYR TYR A . n A 1 139 LEU 139 138 138 LEU LEU A . n A 1 140 ASN 140 139 139 ASN ASN A . n A 1 141 GLU 141 140 140 GLU GLU A . n A 1 142 GLN 142 141 141 GLN GLN A . n A 1 143 VAL 143 142 142 VAL VAL A . n A 1 144 LYS 144 143 143 LYS LYS A . n A 1 145 ALA 145 144 144 ALA ALA A . n A 1 146 ILE 146 145 145 ILE ILE A . n A 1 147 LYS 147 146 146 LYS LYS A . n A 1 148 GLU 148 147 147 GLU GLU A . n A 1 149 LEU 149 148 148 LEU LEU A . n A 1 150 GLY 150 149 149 GLY GLY A . n A 1 151 ASP 151 150 150 ASP ASP A . n A 1 152 HIS 152 151 151 HIS HIS A . n A 1 153 VAL 153 152 152 VAL VAL A . n A 1 154 THR 154 153 153 THR THR A . n A 1 155 ASN 155 154 154 ASN ASN A . n A 1 156 LEU 156 155 155 LEU LEU A . n A 1 157 ARG 157 156 156 ARG ARG A . n A 1 158 LYS 158 157 157 LYS LYS A . n A 1 159 MET 159 158 158 MET MET A . n A 1 160 GLY 160 159 159 GLY GLY A . n A 1 161 ALA 161 160 160 ALA ALA A . n A 1 162 PRO 162 161 161 PRO PRO A . n A 1 163 GLU 163 162 162 GLU GLU A . n A 1 164 SER 164 163 163 SER SER A . n A 1 165 GLY 165 164 164 GLY GLY A . n A 1 166 LEU 166 165 165 LEU LEU A . n A 1 167 ALA 167 166 166 ALA ALA A . n A 1 168 GLU 168 167 167 GLU GLU A . n A 1 169 TYR 169 168 168 TYR TYR A . n A 1 170 LEU 170 169 169 LEU LEU A . n A 1 171 PHE 171 170 170 PHE PHE A . n A 1 172 ASP 172 171 171 ASP ASP A . n A 1 173 LYS 173 172 172 LYS LYS A . n A 1 174 HIS 174 173 173 HIS HIS A . n A 1 175 THR 175 174 174 THR THR A . n A 1 176 LEU 176 175 175 LEU LEU A . n A 1 177 GLY 177 176 176 GLY GLY A . n A 1 178 ASP 178 177 ? ? ? A . n A 1 179 SER 179 178 ? ? ? A . n A 1 180 ASP 180 179 ? ? ? A . n A 1 181 ASN 181 180 ? ? ? A . n A 1 182 GLU 182 181 ? ? ? A . n A 1 183 SER 183 182 ? ? ? A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id AU _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id AU _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 AU 1 201 201 AU AU A . C 2 AU 1 202 202 AU AU A . D 2 AU 1 203 203 AU AU A . E 2 AU 1 204 204 AU AU A . F 3 MG 1 205 3 MG MG A . G 4 HOH 1 301 23 HOH HOH A . G 4 HOH 2 302 68 HOH HOH A . G 4 HOH 3 303 1 HOH HOH A . G 4 HOH 4 304 4 HOH HOH A . G 4 HOH 5 305 62 HOH HOH A . G 4 HOH 6 306 119 HOH HOH A . G 4 HOH 7 307 8 HOH HOH A . G 4 HOH 8 308 53 HOH HOH A . G 4 HOH 9 309 15 HOH HOH A . G 4 HOH 10 310 32 HOH HOH A . G 4 HOH 11 311 63 HOH HOH A . G 4 HOH 12 312 9 HOH HOH A . G 4 HOH 13 313 51 HOH HOH A . G 4 HOH 14 314 82 HOH HOH A . G 4 HOH 15 315 27 HOH HOH A . G 4 HOH 16 316 31 HOH HOH A . G 4 HOH 17 317 28 HOH HOH A . G 4 HOH 18 318 37 HOH HOH A . G 4 HOH 19 319 93 HOH HOH A . G 4 HOH 20 320 79 HOH HOH A . G 4 HOH 21 321 50 HOH HOH A . G 4 HOH 22 322 5 HOH HOH A . G 4 HOH 23 323 47 HOH HOH A . G 4 HOH 24 324 17 HOH HOH A . G 4 HOH 25 325 88 HOH HOH A . G 4 HOH 26 326 3 HOH HOH A . G 4 HOH 27 327 106 HOH HOH A . G 4 HOH 28 328 52 HOH HOH A . G 4 HOH 29 329 11 HOH HOH A . G 4 HOH 30 330 102 HOH HOH A . G 4 HOH 31 331 20 HOH HOH A . G 4 HOH 32 332 54 HOH HOH A . G 4 HOH 33 333 29 HOH HOH A . G 4 HOH 34 334 30 HOH HOH A . G 4 HOH 35 335 96 HOH HOH A . G 4 HOH 36 336 34 HOH HOH A . G 4 HOH 37 337 2 HOH HOH A . G 4 HOH 38 338 39 HOH HOH A . G 4 HOH 39 339 13 HOH HOH A . G 4 HOH 40 340 19 HOH HOH A . G 4 HOH 41 341 48 HOH HOH A . G 4 HOH 42 342 80 HOH HOH A . G 4 HOH 43 343 65 HOH HOH A . G 4 HOH 44 344 49 HOH HOH A . G 4 HOH 45 345 21 HOH HOH A . G 4 HOH 46 346 101 HOH HOH A . G 4 HOH 47 347 58 HOH HOH A . G 4 HOH 48 348 36 HOH HOH A . G 4 HOH 49 349 40 HOH HOH A . G 4 HOH 50 350 10 HOH HOH A . G 4 HOH 51 351 22 HOH HOH A . G 4 HOH 52 352 117 HOH HOH A . G 4 HOH 53 353 61 HOH HOH A . G 4 HOH 54 354 75 HOH HOH A . G 4 HOH 55 355 94 HOH HOH A . G 4 HOH 56 356 57 HOH HOH A . G 4 HOH 57 357 73 HOH HOH A . G 4 HOH 58 358 6 HOH HOH A . G 4 HOH 59 359 7 HOH HOH A . G 4 HOH 60 360 107 HOH HOH A . G 4 HOH 61 361 26 HOH HOH A . G 4 HOH 62 362 41 HOH HOH A . G 4 HOH 63 363 78 HOH HOH A . G 4 HOH 64 364 16 HOH HOH A . G 4 HOH 65 365 45 HOH HOH A . G 4 HOH 66 366 55 HOH HOH A . G 4 HOH 67 367 104 HOH HOH A . G 4 HOH 68 368 81 HOH HOH A . G 4 HOH 69 369 42 HOH HOH A . G 4 HOH 70 370 14 HOH HOH A . G 4 HOH 71 371 71 HOH HOH A . G 4 HOH 72 372 44 HOH HOH A . G 4 HOH 73 373 43 HOH HOH A . G 4 HOH 74 374 76 HOH HOH A . G 4 HOH 75 375 89 HOH HOH A . G 4 HOH 76 376 118 HOH HOH A . G 4 HOH 77 377 64 HOH HOH A . G 4 HOH 78 378 69 HOH HOH A . G 4 HOH 79 379 60 HOH HOH A . G 4 HOH 80 380 95 HOH HOH A . G 4 HOH 81 381 56 HOH HOH A . G 4 HOH 82 382 12 HOH HOH A . G 4 HOH 83 383 38 HOH HOH A . G 4 HOH 84 384 90 HOH HOH A . G 4 HOH 85 385 92 HOH HOH A . G 4 HOH 86 386 74 HOH HOH A . G 4 HOH 87 387 25 HOH HOH A . G 4 HOH 88 388 120 HOH HOH A . G 4 HOH 89 389 99 HOH HOH A . G 4 HOH 90 390 46 HOH HOH A . G 4 HOH 91 391 113 HOH HOH A . G 4 HOH 92 392 72 HOH HOH A . G 4 HOH 93 393 67 HOH HOH A . G 4 HOH 94 394 91 HOH HOH A . G 4 HOH 95 395 33 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.20.1_4487: ???)' ? 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? iMOSFLM ? ? ? . ? 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? . ? 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . ? 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 9W29 _cell.details ? _cell.formula_units_Z ? _cell.length_a 183.770 _cell.length_a_esd ? _cell.length_b 183.770 _cell.length_b_esd ? _cell.length_c 183.770 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 96 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9W29 _symmetry.cell_setting ? _symmetry.Int_Tables_number 209 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'F 4 3 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9W29 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.04 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 59.56 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '2 M MgCl2, 0.1 M Bicine, pH 9.0' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 283 # _diffrn.ambient_environment ? _diffrn.ambient_temp 93 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER2 S 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2023-07-02 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.979183 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL02U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.979183 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL02U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 9W29 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.99 _reflns.d_resolution_low 42.16 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 17840 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 93.70 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 74.6 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 13.23 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.4109 _reflns.pdbx_Rpim_I_all 0.04736 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.4081 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.99 _reflns_shell.d_res_low 2.062 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1588 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.903 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 4.424 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9W29 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.99 _refine.ls_d_res_low 42.16 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 17633 _refine.ls_number_reflns_R_free 913 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 92.61 _refine.ls_percent_reflns_R_free 5.15 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2196 _refine.ls_R_factor_R_free 0.2465 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2181 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.33 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details 1201 _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.10 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 37.30 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.50 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.99 _refine_hist.d_res_low 42.16 _refine_hist.number_atoms_solvent 95 _refine_hist.number_atoms_total 1513 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1413 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 5 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.007 ? 1448 ? f_bond_d ? ? ? 'X-RAY DIFFRACTION' ? 0.808 ? 1952 ? f_angle_d ? ? ? 'X-RAY DIFFRACTION' ? 14.834 ? 546 ? f_dihedral_angle_d ? ? ? 'X-RAY DIFFRACTION' ? 0.044 ? 206 ? f_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.007 ? 257 ? f_plane_restr ? ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.99 2.05 . . 128 1912 72.00 . . . . 0.5869 . . . . . . . . . . . . . . . 0.6263 'X-RAY DIFFRACTION' 2.05 2.11 . . 120 2463 91.00 . . . . 0.3866 . . . . . . . . . . . . . . . 0.4226 'X-RAY DIFFRACTION' 2.12 2.19 . . 127 2753 100.00 . . . . 0.2801 . . . . . . . . . . . . . . . 0.3005 'X-RAY DIFFRACTION' 2.19 2.28 . . 127 2748 100.00 . . . . 0.2602 . . . . . . . . . . . . . . . 0.2538 'X-RAY DIFFRACTION' 2.28 2.38 . . 69 1353 50.00 . . . . 0.4244 . . . . . . . . . . . . . . . 0.5382 'X-RAY DIFFRACTION' 2.38 2.51 . . 168 2697 100.00 . . . . 0.2388 . . . . . . . . . . . . . . . 0.2994 'X-RAY DIFFRACTION' 2.51 2.66 . . 132 2736 100.00 . . . . 0.2108 . . . . . . . . . . . . . . . 0.3103 'X-RAY DIFFRACTION' 2.67 2.87 . . 147 2727 100.00 . . . . 0.2137 . . . . . . . . . . . . . . . 0.2332 'X-RAY DIFFRACTION' 2.87 3.16 . . 176 2684 100.00 . . . . 0.1866 . . . . . . . . . . . . . . . 0.2059 'X-RAY DIFFRACTION' 3.16 3.62 . . 127 2731 100.00 . . . . 0.1662 . . . . . . . . . . . . . . . 0.2016 'X-RAY DIFFRACTION' 3.62 4.55 . . 169 2689 100.00 . . . . 0.1437 . . . . . . . . . . . . . . . 0.1454 'X-RAY DIFFRACTION' 4.56 42.16 . . 152 2744 100.00 . . . . 0.1880 . . . . . . . . . . . . . . . 0.2198 # _struct.entry_id 9W29 _struct.title 'Structure of Au bound to human heavy chain ferritin nanocage.' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9W29 _struct_keywords.text 'ferritin, gold ion, METAL BINDING PROTEIN' _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 2 ? F N N 3 ? G N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FRIH_HUMAN _struct_ref.pdbx_db_accession P02794 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MTTASTSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGR IFLQDIKKPDCDDWESGLNAMECALHLEKNVNQSLLELHKLATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTNLRKMG APESGLAEYLFDKHTLGDSDNES ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9W29 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 183 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P02794 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 183 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 0 _struct_ref_seq.pdbx_auth_seq_align_end 182 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details 24-meric _pdbx_struct_assembly.oligomeric_count 24 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 114340 ? 1 MORE -1392 ? 1 'SSA (A^2)' 133230 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'electron microscopy' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_555 -x,-y,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_554 -x,y,-z-1 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -183.7700000000 4 'crystal symmetry operation' 4_554 x,-y,-z-1 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -183.7700000000 5 'crystal symmetry operation' 13_554 y,x,-z-1 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -183.7700000000 6 'crystal symmetry operation' 14_554 -y,-x,-z-1 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -183.7700000000 7 'crystal symmetry operation' 15_555 y,-x,z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 8 'crystal symmetry operation' 16_555 -y,x,z 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 9 'crystal symmetry operation' 33_554 y,z+1/2,x-1/2 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 91.8850000000 1.0000000000 0.0000000000 0.0000000000 -91.8850000000 10 'crystal symmetry operation' 34_554 -y,z+1/2,-x-1/2 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 91.8850000000 -1.0000000000 0.0000000000 0.0000000000 -91.8850000000 11 'crystal symmetry operation' 35_544 y,-z-1/2,-x-1/2 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -91.8850000000 -1.0000000000 0.0000000000 0.0000000000 -91.8850000000 12 'crystal symmetry operation' 36_544 -y,-z-1/2,x-1/2 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -91.8850000000 1.0000000000 0.0000000000 0.0000000000 -91.8850000000 13 'crystal symmetry operation' 41_554 x,z+1/2,-y-1/2 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 91.8850000000 0.0000000000 -1.0000000000 0.0000000000 -91.8850000000 14 'crystal symmetry operation' 42_554 -x,z+1/2,y-1/2 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 91.8850000000 0.0000000000 1.0000000000 0.0000000000 -91.8850000000 15 'crystal symmetry operation' 43_544 -x,-z-1/2,-y-1/2 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -91.8850000000 0.0000000000 -1.0000000000 0.0000000000 -91.8850000000 16 'crystal symmetry operation' 44_544 x,-z-1/2,y-1/2 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -91.8850000000 0.0000000000 1.0000000000 0.0000000000 -91.8850000000 17 'crystal symmetry operation' 53_554 z+1/2,x,y-1/2 0.0000000000 0.0000000000 1.0000000000 91.8850000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 -91.8850000000 18 'crystal symmetry operation' 54_554 z+1/2,-x,-y-1/2 0.0000000000 0.0000000000 1.0000000000 91.8850000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 -91.8850000000 19 'crystal symmetry operation' 55_454 -z-1/2,-x,y-1/2 0.0000000000 0.0000000000 -1.0000000000 -91.8850000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 -91.8850000000 20 'crystal symmetry operation' 56_454 -z-1/2,x,-y-1/2 0.0000000000 0.0000000000 -1.0000000000 -91.8850000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 -91.8850000000 21 'crystal symmetry operation' 69_554 z+1/2,y,-x-1/2 0.0000000000 0.0000000000 1.0000000000 91.8850000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -91.8850000000 22 'crystal symmetry operation' 70_554 z+1/2,-y,x-1/2 0.0000000000 0.0000000000 1.0000000000 91.8850000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -91.8850000000 23 'crystal symmetry operation' 71_454 -z-1/2,y,x-1/2 0.0000000000 0.0000000000 -1.0000000000 -91.8850000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -91.8850000000 24 'crystal symmetry operation' 72_454 -z-1/2,-y,-x-1/2 0.0000000000 0.0000000000 -1.0000000000 -91.8850000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -91.8850000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 HIS A 14 ? ASP A 43 ? HIS A 13 ASP A 42 1 ? 30 HELX_P HELX_P2 AA2 LEU A 49 ? ARG A 77 ? LEU A 48 ARG A 76 1 ? 29 HELX_P HELX_P3 AA3 SER A 96 ? LYS A 125 ? SER A 95 LYS A 124 1 ? 30 HELX_P HELX_P4 AA4 ASP A 127 ? TYR A 138 ? ASP A 126 TYR A 137 1 ? 12 HELX_P HELX_P5 AA5 TYR A 138 ? MET A 159 ? TYR A 137 MET A 158 1 ? 22 HELX_P HELX_P6 AA6 SER A 164 ? THR A 175 ? SER A 163 THR A 174 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A GLU 28 OE1 ? ? ? 1_555 F MG . MG ? ? A GLU 27 A MG 205 1_555 ? ? ? ? ? ? ? 2.243 ? ? metalc2 metalc ? ? A GLU 63 OE1 ? ? ? 1_555 F MG . MG ? ? A GLU 62 A MG 205 1_555 ? ? ? ? ? ? ? 2.252 ? ? metalc3 metalc ? ? A HIS 66 ND1 ? ? ? 1_555 F MG . MG ? ? A HIS 65 A MG 205 1_555 ? ? ? ? ? ? ? 2.100 ? ? metalc4 metalc ? ? A HIS 119 ND1 ? ? ? 1_555 B AU . AU ? ? A HIS 118 A AU 201 1_555 ? ? ? ? ? ? ? 2.193 ? ? metalc5 metalc ? ? A CYS 131 SG ? ? ? 1_555 B AU . AU ? ? A CYS 130 A AU 201 1_555 ? ? ? ? ? ? ? 2.839 ? ? metalc6 metalc ? ? A CYS 131 SG ? ? ? 1_555 C AU . AU ? ? A CYS 130 A AU 202 1_555 ? ? ? ? ? ? ? 2.545 ? ? metalc7 metalc ? ? A CYS 131 SG ? ? ? 1_555 D AU . AU ? ? A CYS 130 A AU 203 1_555 ? ? ? ? ? ? ? 2.995 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE1 ? A GLU 28 ? A GLU 27 ? 1_555 MG ? F MG . ? A MG 205 ? 1_555 OE1 ? A GLU 63 ? A GLU 62 ? 1_555 71.7 ? 2 OE1 ? A GLU 28 ? A GLU 27 ? 1_555 MG ? F MG . ? A MG 205 ? 1_555 ND1 ? A HIS 66 ? A HIS 65 ? 1_555 99.5 ? 3 OE1 ? A GLU 63 ? A GLU 62 ? 1_555 MG ? F MG . ? A MG 205 ? 1_555 ND1 ? A HIS 66 ? A HIS 65 ? 1_555 83.1 ? 4 ND1 ? A HIS 119 ? A HIS 118 ? 1_555 AU ? B AU . ? A AU 201 ? 1_555 SG ? A CYS 131 ? A CYS 130 ? 1_555 139.0 ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ALA _struct_mon_prot_cis.label_seq_id 161 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ALA _struct_mon_prot_cis.auth_seq_id 160 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 162 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 161 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 0.66 # _pdbx_entry_details.entry_id 9W29 _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 46 ? ? -124.92 -58.07 2 1 GLU A 94 ? ? 74.92 -58.04 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 306 ? G HOH . 2 1 A HOH 355 ? G HOH . 3 1 A HOH 395 ? G HOH . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 0 ? A MET 1 2 1 Y 1 A THR 1 ? A THR 2 3 1 Y 1 A THR 2 ? A THR 3 4 1 Y 1 A ALA 3 ? A ALA 4 5 1 Y 1 A SER 4 ? A SER 5 6 1 Y 1 A ASP 177 ? A ASP 178 7 1 Y 1 A SER 178 ? A SER 179 8 1 Y 1 A ASP 179 ? A ASP 180 9 1 Y 1 A ASN 180 ? A ASN 181 10 1 Y 1 A GLU 181 ? A GLU 182 11 1 Y 1 A SER 182 ? A SER 183 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 AU AU AU N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 HIS N N N N 138 HIS CA C N S 139 HIS C C N N 140 HIS O O N N 141 HIS CB C N N 142 HIS CG C Y N 143 HIS ND1 N Y N 144 HIS CD2 C Y N 145 HIS CE1 C Y N 146 HIS NE2 N Y N 147 HIS OXT O N N 148 HIS H H N N 149 HIS H2 H N N 150 HIS HA H N N 151 HIS HB2 H N N 152 HIS HB3 H N N 153 HIS HD1 H N N 154 HIS HD2 H N N 155 HIS HE1 H N N 156 HIS HE2 H N N 157 HIS HXT H N N 158 HOH O O N N 159 HOH H1 H N N 160 HOH H2 H N N 161 ILE N N N N 162 ILE CA C N S 163 ILE C C N N 164 ILE O O N N 165 ILE CB C N S 166 ILE CG1 C N N 167 ILE CG2 C N N 168 ILE CD1 C N N 169 ILE OXT O N N 170 ILE H H N N 171 ILE H2 H N N 172 ILE HA H N N 173 ILE HB H N N 174 ILE HG12 H N N 175 ILE HG13 H N N 176 ILE HG21 H N N 177 ILE HG22 H N N 178 ILE HG23 H N N 179 ILE HD11 H N N 180 ILE HD12 H N N 181 ILE HD13 H N N 182 ILE HXT H N N 183 LEU N N N N 184 LEU CA C N S 185 LEU C C N N 186 LEU O O N N 187 LEU CB C N N 188 LEU CG C N N 189 LEU CD1 C N N 190 LEU CD2 C N N 191 LEU OXT O N N 192 LEU H H N N 193 LEU H2 H N N 194 LEU HA H N N 195 LEU HB2 H N N 196 LEU HB3 H N N 197 LEU HG H N N 198 LEU HD11 H N N 199 LEU HD12 H N N 200 LEU HD13 H N N 201 LEU HD21 H N N 202 LEU HD22 H N N 203 LEU HD23 H N N 204 LEU HXT H N N 205 LYS N N N N 206 LYS CA C N S 207 LYS C C N N 208 LYS O O N N 209 LYS CB C N N 210 LYS CG C N N 211 LYS CD C N N 212 LYS CE C N N 213 LYS NZ N N N 214 LYS OXT O N N 215 LYS H H N N 216 LYS H2 H N N 217 LYS HA H N N 218 LYS HB2 H N N 219 LYS HB3 H N N 220 LYS HG2 H N N 221 LYS HG3 H N N 222 LYS HD2 H N N 223 LYS HD3 H N N 224 LYS HE2 H N N 225 LYS HE3 H N N 226 LYS HZ1 H N N 227 LYS HZ2 H N N 228 LYS HZ3 H N N 229 LYS HXT H N N 230 MET N N N N 231 MET CA C N S 232 MET C C N N 233 MET O O N N 234 MET CB C N N 235 MET CG C N N 236 MET SD S N N 237 MET CE C N N 238 MET OXT O N N 239 MET H H N N 240 MET H2 H N N 241 MET HA H N N 242 MET HB2 H N N 243 MET HB3 H N N 244 MET HG2 H N N 245 MET HG3 H N N 246 MET HE1 H N N 247 MET HE2 H N N 248 MET HE3 H N N 249 MET HXT H N N 250 MG MG MG N N 251 PHE N N N N 252 PHE CA C N S 253 PHE C C N N 254 PHE O O N N 255 PHE CB C N N 256 PHE CG C Y N 257 PHE CD1 C Y N 258 PHE CD2 C Y N 259 PHE CE1 C Y N 260 PHE CE2 C Y N 261 PHE CZ C Y N 262 PHE OXT O N N 263 PHE H H N N 264 PHE H2 H N N 265 PHE HA H N N 266 PHE HB2 H N N 267 PHE HB3 H N N 268 PHE HD1 H N N 269 PHE HD2 H N N 270 PHE HE1 H N N 271 PHE HE2 H N N 272 PHE HZ H N N 273 PHE HXT H N N 274 PRO N N N N 275 PRO CA C N S 276 PRO C C N N 277 PRO O O N N 278 PRO CB C N N 279 PRO CG C N N 280 PRO CD C N N 281 PRO OXT O N N 282 PRO H H N N 283 PRO HA H N N 284 PRO HB2 H N N 285 PRO HB3 H N N 286 PRO HG2 H N N 287 PRO HG3 H N N 288 PRO HD2 H N N 289 PRO HD3 H N N 290 PRO HXT H N N 291 SER N N N N 292 SER CA C N S 293 SER C C N N 294 SER O O N N 295 SER CB C N N 296 SER OG O N N 297 SER OXT O N N 298 SER H H N N 299 SER H2 H N N 300 SER HA H N N 301 SER HB2 H N N 302 SER HB3 H N N 303 SER HG H N N 304 SER HXT H N N 305 THR N N N N 306 THR CA C N S 307 THR C C N N 308 THR O O N N 309 THR CB C N R 310 THR OG1 O N N 311 THR CG2 C N N 312 THR OXT O N N 313 THR H H N N 314 THR H2 H N N 315 THR HA H N N 316 THR HB H N N 317 THR HG1 H N N 318 THR HG21 H N N 319 THR HG22 H N N 320 THR HG23 H N N 321 THR HXT H N N 322 TRP N N N N 323 TRP CA C N S 324 TRP C C N N 325 TRP O O N N 326 TRP CB C N N 327 TRP CG C Y N 328 TRP CD1 C Y N 329 TRP CD2 C Y N 330 TRP NE1 N Y N 331 TRP CE2 C Y N 332 TRP CE3 C Y N 333 TRP CZ2 C Y N 334 TRP CZ3 C Y N 335 TRP CH2 C Y N 336 TRP OXT O N N 337 TRP H H N N 338 TRP H2 H N N 339 TRP HA H N N 340 TRP HB2 H N N 341 TRP HB3 H N N 342 TRP HD1 H N N 343 TRP HE1 H N N 344 TRP HE3 H N N 345 TRP HZ2 H N N 346 TRP HZ3 H N N 347 TRP HH2 H N N 348 TRP HXT H N N 349 TYR N N N N 350 TYR CA C N S 351 TYR C C N N 352 TYR O O N N 353 TYR CB C N N 354 TYR CG C Y N 355 TYR CD1 C Y N 356 TYR CD2 C Y N 357 TYR CE1 C Y N 358 TYR CE2 C Y N 359 TYR CZ C Y N 360 TYR OH O N N 361 TYR OXT O N N 362 TYR H H N N 363 TYR H2 H N N 364 TYR HA H N N 365 TYR HB2 H N N 366 TYR HB3 H N N 367 TYR HD1 H N N 368 TYR HD2 H N N 369 TYR HE1 H N N 370 TYR HE2 H N N 371 TYR HH H N N 372 TYR HXT H N N 373 VAL N N N N 374 VAL CA C N S 375 VAL C C N N 376 VAL O O N N 377 VAL CB C N N 378 VAL CG1 C N N 379 VAL CG2 C N N 380 VAL OXT O N N 381 VAL H H N N 382 VAL H2 H N N 383 VAL HA H N N 384 VAL HB H N N 385 VAL HG11 H N N 386 VAL HG12 H N N 387 VAL HG13 H N N 388 VAL HG21 H N N 389 VAL HG22 H N N 390 VAL HG23 H N N 391 VAL HXT H N N 392 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Natural Science Foundation of China (NSFC)' China 32271448 1 'National Natural Science Foundation of China (NSFC)' China 32425032 2 'National Natural Science Foundation of China (NSFC)' China 82472134 3 'National Natural Science Foundation of China (NSFC)' China 32261160571 4 # _atom_sites.entry_id 9W29 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.005442 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.005442 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005442 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol AU C MG N O S # loop_ #