data_9WPO # _entry.id 9WPO # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.406 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9WPO pdb_00009wpo 10.2210/pdb9wpo/pdb WWPDB D_1300063555 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2025-10-08 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9WPO _pdbx_database_status.recvd_initial_deposition_date 2025-09-09 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email sungil@kangwon.ac.kr _pdbx_contact_author.name_first Sung-il _pdbx_contact_author.name_last Yoon _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-0777-0457 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Ahn, S.Y.' 1 ? 'Yoon, S.I.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Biochem.Biophys.Res.Commun. _citation.journal_id_ASTM BBRCA9 _citation.journal_id_CSD 0146 _citation.journal_id_ISSN 1090-2104 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 785 _citation.language ? _citation.page_first 152688 _citation.page_last 152688 _citation.title 'Structural analysis of the unique nitrilase superfamily protein CJ1056C from Campylobacter jejuni.' _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.bbrc.2025.152688 _citation.pdbx_database_id_PubMed 41005285 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ahn, S.Y.' 1 ? primary 'Yoon, S.I.' 2 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Carbon-nitrogen hydrolase family protein' 30993.930 4 ? ? ? ? 2 water nat water 18.015 110 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSAKDPMSKIAALQFPTLALSESRLDYYLKASKDNGVNLVVLGEYVINSFFTELLHMPKNMIKEQSEAKKESLIKLAKKY ELEIIAPYVSVEAKSYKKLCLKVTPNGVKSYEQQILMPYEHWNEEKFFSNKTPSELKIFTFNYEKLKCALLFGFETHFDI FWQQIMAKKIDLVIVPSACTFESKQRWEELLKTRAFLNSTSILRVNRIGKTKDEWNFYGDTLFINAFGEIESKLGSEEEM LIIEPKKSDEARKLWGFDKIIKEFKN ; _entity_poly.pdbx_seq_one_letter_code_can ;GSAKDPMSKIAALQFPTLALSESRLDYYLKASKDNGVNLVVLGEYVINSFFTELLHMPKNMIKEQSEAKKESLIKLAKKY ELEIIAPYVSVEAKSYKKLCLKVTPNGVKSYEQQILMPYEHWNEEKFFSNKTPSELKIFTFNYEKLKCALLFGFETHFDI FWQQIMAKKIDLVIVPSACTFESKQRWEELLKTRAFLNSTSILRVNRIGKTKDEWNFYGDTLFINAFGEIESKLGSEEEM LIIEPKKSDEARKLWGFDKIIKEFKN ; _entity_poly.pdbx_strand_id A,B,C,D _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 ALA n 1 4 LYS n 1 5 ASP n 1 6 PRO n 1 7 MET n 1 8 SER n 1 9 LYS n 1 10 ILE n 1 11 ALA n 1 12 ALA n 1 13 LEU n 1 14 GLN n 1 15 PHE n 1 16 PRO n 1 17 THR n 1 18 LEU n 1 19 ALA n 1 20 LEU n 1 21 SER n 1 22 GLU n 1 23 SER n 1 24 ARG n 1 25 LEU n 1 26 ASP n 1 27 TYR n 1 28 TYR n 1 29 LEU n 1 30 LYS n 1 31 ALA n 1 32 SER n 1 33 LYS n 1 34 ASP n 1 35 ASN n 1 36 GLY n 1 37 VAL n 1 38 ASN n 1 39 LEU n 1 40 VAL n 1 41 VAL n 1 42 LEU n 1 43 GLY n 1 44 GLU n 1 45 TYR n 1 46 VAL n 1 47 ILE n 1 48 ASN n 1 49 SER n 1 50 PHE n 1 51 PHE n 1 52 THR n 1 53 GLU n 1 54 LEU n 1 55 LEU n 1 56 HIS n 1 57 MET n 1 58 PRO n 1 59 LYS n 1 60 ASN n 1 61 MET n 1 62 ILE n 1 63 LYS n 1 64 GLU n 1 65 GLN n 1 66 SER n 1 67 GLU n 1 68 ALA n 1 69 LYS n 1 70 LYS n 1 71 GLU n 1 72 SER n 1 73 LEU n 1 74 ILE n 1 75 LYS n 1 76 LEU n 1 77 ALA n 1 78 LYS n 1 79 LYS n 1 80 TYR n 1 81 GLU n 1 82 LEU n 1 83 GLU n 1 84 ILE n 1 85 ILE n 1 86 ALA n 1 87 PRO n 1 88 TYR n 1 89 VAL n 1 90 SER n 1 91 VAL n 1 92 GLU n 1 93 ALA n 1 94 LYS n 1 95 SER n 1 96 TYR n 1 97 LYS n 1 98 LYS n 1 99 LEU n 1 100 CYS n 1 101 LEU n 1 102 LYS n 1 103 VAL n 1 104 THR n 1 105 PRO n 1 106 ASN n 1 107 GLY n 1 108 VAL n 1 109 LYS n 1 110 SER n 1 111 TYR n 1 112 GLU n 1 113 GLN n 1 114 GLN n 1 115 ILE n 1 116 LEU n 1 117 MET n 1 118 PRO n 1 119 TYR n 1 120 GLU n 1 121 HIS n 1 122 TRP n 1 123 ASN n 1 124 GLU n 1 125 GLU n 1 126 LYS n 1 127 PHE n 1 128 PHE n 1 129 SER n 1 130 ASN n 1 131 LYS n 1 132 THR n 1 133 PRO n 1 134 SER n 1 135 GLU n 1 136 LEU n 1 137 LYS n 1 138 ILE n 1 139 PHE n 1 140 THR n 1 141 PHE n 1 142 ASN n 1 143 TYR n 1 144 GLU n 1 145 LYS n 1 146 LEU n 1 147 LYS n 1 148 CYS n 1 149 ALA n 1 150 LEU n 1 151 LEU n 1 152 PHE n 1 153 GLY n 1 154 PHE n 1 155 GLU n 1 156 THR n 1 157 HIS n 1 158 PHE n 1 159 ASP n 1 160 ILE n 1 161 PHE n 1 162 TRP n 1 163 GLN n 1 164 GLN n 1 165 ILE n 1 166 MET n 1 167 ALA n 1 168 LYS n 1 169 LYS n 1 170 ILE n 1 171 ASP n 1 172 LEU n 1 173 VAL n 1 174 ILE n 1 175 VAL n 1 176 PRO n 1 177 SER n 1 178 ALA n 1 179 CYS n 1 180 THR n 1 181 PHE n 1 182 GLU n 1 183 SER n 1 184 LYS n 1 185 GLN n 1 186 ARG n 1 187 TRP n 1 188 GLU n 1 189 GLU n 1 190 LEU n 1 191 LEU n 1 192 LYS n 1 193 THR n 1 194 ARG n 1 195 ALA n 1 196 PHE n 1 197 LEU n 1 198 ASN n 1 199 SER n 1 200 THR n 1 201 SER n 1 202 ILE n 1 203 LEU n 1 204 ARG n 1 205 VAL n 1 206 ASN n 1 207 ARG n 1 208 ILE n 1 209 GLY n 1 210 LYS n 1 211 THR n 1 212 LYS n 1 213 ASP n 1 214 GLU n 1 215 TRP n 1 216 ASN n 1 217 PHE n 1 218 TYR n 1 219 GLY n 1 220 ASP n 1 221 THR n 1 222 LEU n 1 223 PHE n 1 224 ILE n 1 225 ASN n 1 226 ALA n 1 227 PHE n 1 228 GLY n 1 229 GLU n 1 230 ILE n 1 231 GLU n 1 232 SER n 1 233 LYS n 1 234 LEU n 1 235 GLY n 1 236 SER n 1 237 GLU n 1 238 GLU n 1 239 GLU n 1 240 MET n 1 241 LEU n 1 242 ILE n 1 243 ILE n 1 244 GLU n 1 245 PRO n 1 246 LYS n 1 247 LYS n 1 248 SER n 1 249 ASP n 1 250 GLU n 1 251 ALA n 1 252 ARG n 1 253 LYS n 1 254 LEU n 1 255 TRP n 1 256 GLY n 1 257 PHE n 1 258 ASP n 1 259 LYS n 1 260 ILE n 1 261 ILE n 1 262 LYS n 1 263 GLU n 1 264 PHE n 1 265 LYS n 1 266 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 266 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene BGG17_02735 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Campylobacter jejuni' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 197 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -5 ? ? ? A . n A 1 2 SER 2 -4 ? ? ? A . n A 1 3 ALA 3 -3 ? ? ? A . n A 1 4 LYS 4 -2 ? ? ? A . n A 1 5 ASP 5 -1 ? ? ? A . n A 1 6 PRO 6 0 ? ? ? A . n A 1 7 MET 7 1 1 MET MET A . n A 1 8 SER 8 2 2 SER SER A . n A 1 9 LYS 9 3 3 LYS LYS A . n A 1 10 ILE 10 4 4 ILE ILE A . n A 1 11 ALA 11 5 5 ALA ALA A . n A 1 12 ALA 12 6 6 ALA ALA A . n A 1 13 LEU 13 7 7 LEU LEU A . n A 1 14 GLN 14 8 8 GLN GLN A . n A 1 15 PHE 15 9 9 PHE PHE A . n A 1 16 PRO 16 10 10 PRO PRO A . n A 1 17 THR 17 11 11 THR THR A . n A 1 18 LEU 18 12 12 LEU LEU A . n A 1 19 ALA 19 13 13 ALA ALA A . n A 1 20 LEU 20 14 14 LEU LEU A . n A 1 21 SER 21 15 15 SER SER A . n A 1 22 GLU 22 16 16 GLU GLU A . n A 1 23 SER 23 17 17 SER SER A . n A 1 24 ARG 24 18 18 ARG ARG A . n A 1 25 LEU 25 19 19 LEU LEU A . n A 1 26 ASP 26 20 20 ASP ASP A . n A 1 27 TYR 27 21 21 TYR TYR A . n A 1 28 TYR 28 22 22 TYR TYR A . n A 1 29 LEU 29 23 23 LEU LEU A . n A 1 30 LYS 30 24 24 LYS LYS A . n A 1 31 ALA 31 25 25 ALA ALA A . n A 1 32 SER 32 26 26 SER SER A . n A 1 33 LYS 33 27 27 LYS LYS A . n A 1 34 ASP 34 28 28 ASP ASP A . n A 1 35 ASN 35 29 29 ASN ASN A . n A 1 36 GLY 36 30 30 GLY GLY A . n A 1 37 VAL 37 31 31 VAL VAL A . n A 1 38 ASN 38 32 32 ASN ASN A . n A 1 39 LEU 39 33 33 LEU LEU A . n A 1 40 VAL 40 34 34 VAL VAL A . n A 1 41 VAL 41 35 35 VAL VAL A . n A 1 42 LEU 42 36 36 LEU LEU A . n A 1 43 GLY 43 37 37 GLY GLY A . n A 1 44 GLU 44 38 38 GLU GLU A . n A 1 45 TYR 45 39 39 TYR TYR A . n A 1 46 VAL 46 40 40 VAL VAL A . n A 1 47 ILE 47 41 41 ILE ILE A . n A 1 48 ASN 48 42 42 ASN ASN A . n A 1 49 SER 49 43 43 SER SER A . n A 1 50 PHE 50 44 44 PHE PHE A . n A 1 51 PHE 51 45 45 PHE PHE A . n A 1 52 THR 52 46 46 THR THR A . n A 1 53 GLU 53 47 47 GLU GLU A . n A 1 54 LEU 54 48 48 LEU LEU A . n A 1 55 LEU 55 49 49 LEU LEU A . n A 1 56 HIS 56 50 50 HIS HIS A . n A 1 57 MET 57 51 51 MET MET A . n A 1 58 PRO 58 52 52 PRO PRO A . n A 1 59 LYS 59 53 53 LYS LYS A . n A 1 60 ASN 60 54 54 ASN ASN A . n A 1 61 MET 61 55 55 MET MET A . n A 1 62 ILE 62 56 56 ILE ILE A . n A 1 63 LYS 63 57 57 LYS LYS A . n A 1 64 GLU 64 58 58 GLU GLU A . n A 1 65 GLN 65 59 59 GLN GLN A . n A 1 66 SER 66 60 60 SER SER A . n A 1 67 GLU 67 61 61 GLU GLU A . n A 1 68 ALA 68 62 62 ALA ALA A . n A 1 69 LYS 69 63 63 LYS LYS A . n A 1 70 LYS 70 64 64 LYS LYS A . n A 1 71 GLU 71 65 65 GLU GLU A . n A 1 72 SER 72 66 66 SER SER A . n A 1 73 LEU 73 67 67 LEU LEU A . n A 1 74 ILE 74 68 68 ILE ILE A . n A 1 75 LYS 75 69 69 LYS LYS A . n A 1 76 LEU 76 70 70 LEU LEU A . n A 1 77 ALA 77 71 71 ALA ALA A . n A 1 78 LYS 78 72 72 LYS LYS A . n A 1 79 LYS 79 73 73 LYS LYS A . n A 1 80 TYR 80 74 74 TYR TYR A . n A 1 81 GLU 81 75 75 GLU GLU A . n A 1 82 LEU 82 76 76 LEU LEU A . n A 1 83 GLU 83 77 77 GLU GLU A . n A 1 84 ILE 84 78 78 ILE ILE A . n A 1 85 ILE 85 79 79 ILE ILE A . n A 1 86 ALA 86 80 80 ALA ALA A . n A 1 87 PRO 87 81 81 PRO PRO A . n A 1 88 TYR 88 82 82 TYR TYR A . n A 1 89 VAL 89 83 83 VAL VAL A . n A 1 90 SER 90 84 84 SER SER A . n A 1 91 VAL 91 85 85 VAL VAL A . n A 1 92 GLU 92 86 86 GLU GLU A . n A 1 93 ALA 93 87 87 ALA ALA A . n A 1 94 LYS 94 88 88 LYS LYS A . n A 1 95 SER 95 89 89 SER SER A . n A 1 96 TYR 96 90 90 TYR TYR A . n A 1 97 LYS 97 91 91 LYS LYS A . n A 1 98 LYS 98 92 92 LYS LYS A . n A 1 99 LEU 99 93 93 LEU LEU A . n A 1 100 CYS 100 94 94 CYS CYS A . n A 1 101 LEU 101 95 95 LEU LEU A . n A 1 102 LYS 102 96 96 LYS LYS A . n A 1 103 VAL 103 97 97 VAL VAL A . n A 1 104 THR 104 98 98 THR THR A . n A 1 105 PRO 105 99 99 PRO PRO A . n A 1 106 ASN 106 100 100 ASN ASN A . n A 1 107 GLY 107 101 101 GLY GLY A . n A 1 108 VAL 108 102 102 VAL VAL A . n A 1 109 LYS 109 103 103 LYS LYS A . n A 1 110 SER 110 104 104 SER SER A . n A 1 111 TYR 111 105 105 TYR TYR A . n A 1 112 GLU 112 106 106 GLU GLU A . n A 1 113 GLN 113 107 107 GLN GLN A . n A 1 114 GLN 114 108 108 GLN GLN A . n A 1 115 ILE 115 109 109 ILE ILE A . n A 1 116 LEU 116 110 110 LEU LEU A . n A 1 117 MET 117 111 111 MET MET A . n A 1 118 PRO 118 112 112 PRO PRO A . n A 1 119 TYR 119 113 113 TYR TYR A . n A 1 120 GLU 120 114 114 GLU GLU A . n A 1 121 HIS 121 115 115 HIS HIS A . n A 1 122 TRP 122 116 116 TRP TRP A . n A 1 123 ASN 123 117 117 ASN ASN A . n A 1 124 GLU 124 118 118 GLU GLU A . n A 1 125 GLU 125 119 119 GLU GLU A . n A 1 126 LYS 126 120 120 LYS LYS A . n A 1 127 PHE 127 121 121 PHE PHE A . n A 1 128 PHE 128 122 122 PHE PHE A . n A 1 129 SER 129 123 123 SER SER A . n A 1 130 ASN 130 124 124 ASN ASN A . n A 1 131 LYS 131 125 125 LYS LYS A . n A 1 132 THR 132 126 126 THR THR A . n A 1 133 PRO 133 127 127 PRO PRO A . n A 1 134 SER 134 128 128 SER SER A . n A 1 135 GLU 135 129 129 GLU GLU A . n A 1 136 LEU 136 130 130 LEU LEU A . n A 1 137 LYS 137 131 131 LYS LYS A . n A 1 138 ILE 138 132 132 ILE ILE A . n A 1 139 PHE 139 133 133 PHE PHE A . n A 1 140 THR 140 134 134 THR THR A . n A 1 141 PHE 141 135 135 PHE PHE A . n A 1 142 ASN 142 136 136 ASN ASN A . n A 1 143 TYR 143 137 137 TYR TYR A . n A 1 144 GLU 144 138 138 GLU GLU A . n A 1 145 LYS 145 139 139 LYS LYS A . n A 1 146 LEU 146 140 140 LEU LEU A . n A 1 147 LYS 147 141 141 LYS LYS A . n A 1 148 CYS 148 142 142 CYS CYS A . n A 1 149 ALA 149 143 143 ALA ALA A . n A 1 150 LEU 150 144 144 LEU LEU A . n A 1 151 LEU 151 145 145 LEU LEU A . n A 1 152 PHE 152 146 146 PHE PHE A . n A 1 153 GLY 153 147 147 GLY GLY A . n A 1 154 PHE 154 148 148 PHE PHE A . n A 1 155 GLU 155 149 149 GLU GLU A . n A 1 156 THR 156 150 150 THR THR A . n A 1 157 HIS 157 151 151 HIS HIS A . n A 1 158 PHE 158 152 152 PHE PHE A . n A 1 159 ASP 159 153 153 ASP ASP A . n A 1 160 ILE 160 154 154 ILE ILE A . n A 1 161 PHE 161 155 155 PHE PHE A . n A 1 162 TRP 162 156 156 TRP TRP A . n A 1 163 GLN 163 157 157 GLN GLN A . n A 1 164 GLN 164 158 158 GLN GLN A . n A 1 165 ILE 165 159 159 ILE ILE A . n A 1 166 MET 166 160 160 MET MET A . n A 1 167 ALA 167 161 161 ALA ALA A . n A 1 168 LYS 168 162 162 LYS LYS A . n A 1 169 LYS 169 163 163 LYS LYS A . n A 1 170 ILE 170 164 164 ILE ILE A . n A 1 171 ASP 171 165 165 ASP ASP A . n A 1 172 LEU 172 166 166 LEU LEU A . n A 1 173 VAL 173 167 167 VAL VAL A . n A 1 174 ILE 174 168 168 ILE ILE A . n A 1 175 VAL 175 169 169 VAL VAL A . n A 1 176 PRO 176 170 170 PRO PRO A . n A 1 177 SER 177 171 171 SER SER A . n A 1 178 ALA 178 172 172 ALA ALA A . n A 1 179 CYS 179 173 173 CYS CYS A . n A 1 180 THR 180 174 174 THR THR A . n A 1 181 PHE 181 175 175 PHE PHE A . n A 1 182 GLU 182 176 176 GLU GLU A . n A 1 183 SER 183 177 177 SER SER A . n A 1 184 LYS 184 178 178 LYS LYS A . n A 1 185 GLN 185 179 179 GLN GLN A . n A 1 186 ARG 186 180 180 ARG ARG A . n A 1 187 TRP 187 181 181 TRP TRP A . n A 1 188 GLU 188 182 182 GLU GLU A . n A 1 189 GLU 189 183 183 GLU GLU A . n A 1 190 LEU 190 184 184 LEU LEU A . n A 1 191 LEU 191 185 185 LEU LEU A . n A 1 192 LYS 192 186 186 LYS LYS A . n A 1 193 THR 193 187 187 THR THR A . n A 1 194 ARG 194 188 188 ARG ARG A . n A 1 195 ALA 195 189 189 ALA ALA A . n A 1 196 PHE 196 190 190 PHE PHE A . n A 1 197 LEU 197 191 191 LEU LEU A . n A 1 198 ASN 198 192 192 ASN ASN A . n A 1 199 SER 199 193 193 SER SER A . n A 1 200 THR 200 194 194 THR THR A . n A 1 201 SER 201 195 195 SER SER A . n A 1 202 ILE 202 196 196 ILE ILE A . n A 1 203 LEU 203 197 197 LEU LEU A . n A 1 204 ARG 204 198 198 ARG ARG A . n A 1 205 VAL 205 199 199 VAL VAL A . n A 1 206 ASN 206 200 200 ASN ASN A . n A 1 207 ARG 207 201 201 ARG ARG A . n A 1 208 ILE 208 202 202 ILE ILE A . n A 1 209 GLY 209 203 203 GLY GLY A . n A 1 210 LYS 210 204 204 LYS LYS A . n A 1 211 THR 211 205 205 THR THR A . n A 1 212 LYS 212 206 206 LYS LYS A . n A 1 213 ASP 213 207 207 ASP ASP A . n A 1 214 GLU 214 208 208 GLU GLU A . n A 1 215 TRP 215 209 209 TRP TRP A . n A 1 216 ASN 216 210 210 ASN ASN A . n A 1 217 PHE 217 211 211 PHE PHE A . n A 1 218 TYR 218 212 212 TYR TYR A . n A 1 219 GLY 219 213 213 GLY GLY A . n A 1 220 ASP 220 214 214 ASP ASP A . n A 1 221 THR 221 215 215 THR THR A . n A 1 222 LEU 222 216 216 LEU LEU A . n A 1 223 PHE 223 217 217 PHE PHE A . n A 1 224 ILE 224 218 218 ILE ILE A . n A 1 225 ASN 225 219 219 ASN ASN A . n A 1 226 ALA 226 220 220 ALA ALA A . n A 1 227 PHE 227 221 221 PHE PHE A . n A 1 228 GLY 228 222 222 GLY GLY A . n A 1 229 GLU 229 223 223 GLU GLU A . n A 1 230 ILE 230 224 224 ILE ILE A . n A 1 231 GLU 231 225 225 GLU GLU A . n A 1 232 SER 232 226 226 SER SER A . n A 1 233 LYS 233 227 227 LYS LYS A . n A 1 234 LEU 234 228 228 LEU LEU A . n A 1 235 GLY 235 229 229 GLY GLY A . n A 1 236 SER 236 230 230 SER SER A . n A 1 237 GLU 237 231 231 GLU GLU A . n A 1 238 GLU 238 232 232 GLU GLU A . n A 1 239 GLU 239 233 233 GLU GLU A . n A 1 240 MET 240 234 234 MET MET A . n A 1 241 LEU 241 235 235 LEU LEU A . n A 1 242 ILE 242 236 236 ILE ILE A . n A 1 243 ILE 243 237 237 ILE ILE A . n A 1 244 GLU 244 238 238 GLU GLU A . n A 1 245 PRO 245 239 239 PRO PRO A . n A 1 246 LYS 246 240 240 LYS LYS A . n A 1 247 LYS 247 241 241 LYS LYS A . n A 1 248 SER 248 242 242 SER SER A . n A 1 249 ASP 249 243 243 ASP ASP A . n A 1 250 GLU 250 244 244 GLU GLU A . n A 1 251 ALA 251 245 245 ALA ALA A . n A 1 252 ARG 252 246 246 ARG ARG A . n A 1 253 LYS 253 247 247 LYS LYS A . n A 1 254 LEU 254 248 248 LEU LEU A . n A 1 255 TRP 255 249 249 TRP TRP A . n A 1 256 GLY 256 250 250 GLY GLY A . n A 1 257 PHE 257 251 251 PHE PHE A . n A 1 258 ASP 258 252 252 ASP ASP A . n A 1 259 LYS 259 253 253 LYS LYS A . n A 1 260 ILE 260 254 254 ILE ILE A . n A 1 261 ILE 261 255 255 ILE ILE A . n A 1 262 LYS 262 256 256 LYS LYS A . n A 1 263 GLU 263 257 257 GLU GLU A . n A 1 264 PHE 264 258 258 PHE PHE A . n A 1 265 LYS 265 259 ? ? ? A . n A 1 266 ASN 266 260 ? ? ? A . n B 1 1 GLY 1 -5 ? ? ? B . n B 1 2 SER 2 -4 ? ? ? B . n B 1 3 ALA 3 -3 ? ? ? B . n B 1 4 LYS 4 -2 ? ? ? B . n B 1 5 ASP 5 -1 ? ? ? B . n B 1 6 PRO 6 0 ? ? ? B . n B 1 7 MET 7 1 1 MET MET B . n B 1 8 SER 8 2 2 SER SER B . n B 1 9 LYS 9 3 3 LYS LYS B . n B 1 10 ILE 10 4 4 ILE ILE B . n B 1 11 ALA 11 5 5 ALA ALA B . n B 1 12 ALA 12 6 6 ALA ALA B . n B 1 13 LEU 13 7 7 LEU LEU B . n B 1 14 GLN 14 8 8 GLN GLN B . n B 1 15 PHE 15 9 9 PHE PHE B . n B 1 16 PRO 16 10 10 PRO PRO B . n B 1 17 THR 17 11 11 THR THR B . n B 1 18 LEU 18 12 12 LEU LEU B . n B 1 19 ALA 19 13 13 ALA ALA B . n B 1 20 LEU 20 14 14 LEU LEU B . n B 1 21 SER 21 15 15 SER SER B . n B 1 22 GLU 22 16 16 GLU GLU B . n B 1 23 SER 23 17 17 SER SER B . n B 1 24 ARG 24 18 18 ARG ARG B . n B 1 25 LEU 25 19 19 LEU LEU B . n B 1 26 ASP 26 20 20 ASP ASP B . n B 1 27 TYR 27 21 21 TYR TYR B . n B 1 28 TYR 28 22 22 TYR TYR B . n B 1 29 LEU 29 23 23 LEU LEU B . n B 1 30 LYS 30 24 24 LYS LYS B . n B 1 31 ALA 31 25 25 ALA ALA B . n B 1 32 SER 32 26 26 SER SER B . n B 1 33 LYS 33 27 27 LYS LYS B . n B 1 34 ASP 34 28 28 ASP ASP B . n B 1 35 ASN 35 29 29 ASN ASN B . n B 1 36 GLY 36 30 30 GLY GLY B . n B 1 37 VAL 37 31 31 VAL VAL B . n B 1 38 ASN 38 32 32 ASN ASN B . n B 1 39 LEU 39 33 33 LEU LEU B . n B 1 40 VAL 40 34 34 VAL VAL B . n B 1 41 VAL 41 35 35 VAL VAL B . n B 1 42 LEU 42 36 36 LEU LEU B . n B 1 43 GLY 43 37 37 GLY GLY B . n B 1 44 GLU 44 38 38 GLU GLU B . n B 1 45 TYR 45 39 39 TYR TYR B . n B 1 46 VAL 46 40 40 VAL VAL B . n B 1 47 ILE 47 41 41 ILE ILE B . n B 1 48 ASN 48 42 42 ASN ASN B . n B 1 49 SER 49 43 43 SER SER B . n B 1 50 PHE 50 44 44 PHE PHE B . n B 1 51 PHE 51 45 45 PHE PHE B . n B 1 52 THR 52 46 46 THR THR B . n B 1 53 GLU 53 47 47 GLU GLU B . n B 1 54 LEU 54 48 48 LEU LEU B . n B 1 55 LEU 55 49 49 LEU LEU B . n B 1 56 HIS 56 50 50 HIS HIS B . n B 1 57 MET 57 51 51 MET MET B . n B 1 58 PRO 58 52 52 PRO PRO B . n B 1 59 LYS 59 53 53 LYS LYS B . n B 1 60 ASN 60 54 54 ASN ASN B . n B 1 61 MET 61 55 55 MET MET B . n B 1 62 ILE 62 56 56 ILE ILE B . n B 1 63 LYS 63 57 57 LYS LYS B . n B 1 64 GLU 64 58 58 GLU GLU B . n B 1 65 GLN 65 59 59 GLN GLN B . n B 1 66 SER 66 60 60 SER SER B . n B 1 67 GLU 67 61 61 GLU GLU B . n B 1 68 ALA 68 62 62 ALA ALA B . n B 1 69 LYS 69 63 63 LYS LYS B . n B 1 70 LYS 70 64 64 LYS LYS B . n B 1 71 GLU 71 65 65 GLU GLU B . n B 1 72 SER 72 66 66 SER SER B . n B 1 73 LEU 73 67 67 LEU LEU B . n B 1 74 ILE 74 68 68 ILE ILE B . n B 1 75 LYS 75 69 69 LYS LYS B . n B 1 76 LEU 76 70 70 LEU LEU B . n B 1 77 ALA 77 71 71 ALA ALA B . n B 1 78 LYS 78 72 72 LYS LYS B . n B 1 79 LYS 79 73 73 LYS LYS B . n B 1 80 TYR 80 74 74 TYR TYR B . n B 1 81 GLU 81 75 75 GLU GLU B . n B 1 82 LEU 82 76 76 LEU LEU B . n B 1 83 GLU 83 77 77 GLU GLU B . n B 1 84 ILE 84 78 78 ILE ILE B . n B 1 85 ILE 85 79 79 ILE ILE B . n B 1 86 ALA 86 80 80 ALA ALA B . n B 1 87 PRO 87 81 81 PRO PRO B . n B 1 88 TYR 88 82 82 TYR TYR B . n B 1 89 VAL 89 83 83 VAL VAL B . n B 1 90 SER 90 84 84 SER SER B . n B 1 91 VAL 91 85 85 VAL VAL B . n B 1 92 GLU 92 86 86 GLU GLU B . n B 1 93 ALA 93 87 87 ALA ALA B . n B 1 94 LYS 94 88 88 LYS LYS B . n B 1 95 SER 95 89 89 SER SER B . n B 1 96 TYR 96 90 90 TYR TYR B . n B 1 97 LYS 97 91 91 LYS LYS B . n B 1 98 LYS 98 92 92 LYS LYS B . n B 1 99 LEU 99 93 93 LEU LEU B . n B 1 100 CYS 100 94 94 CYS CYS B . n B 1 101 LEU 101 95 95 LEU LEU B . n B 1 102 LYS 102 96 96 LYS LYS B . n B 1 103 VAL 103 97 97 VAL VAL B . n B 1 104 THR 104 98 98 THR THR B . n B 1 105 PRO 105 99 99 PRO PRO B . n B 1 106 ASN 106 100 100 ASN ASN B . n B 1 107 GLY 107 101 101 GLY GLY B . n B 1 108 VAL 108 102 102 VAL VAL B . n B 1 109 LYS 109 103 103 LYS LYS B . n B 1 110 SER 110 104 104 SER SER B . n B 1 111 TYR 111 105 105 TYR TYR B . n B 1 112 GLU 112 106 106 GLU GLU B . n B 1 113 GLN 113 107 107 GLN GLN B . n B 1 114 GLN 114 108 108 GLN GLN B . n B 1 115 ILE 115 109 109 ILE ILE B . n B 1 116 LEU 116 110 110 LEU LEU B . n B 1 117 MET 117 111 111 MET MET B . n B 1 118 PRO 118 112 112 PRO PRO B . n B 1 119 TYR 119 113 113 TYR TYR B . n B 1 120 GLU 120 114 114 GLU GLU B . n B 1 121 HIS 121 115 115 HIS HIS B . n B 1 122 TRP 122 116 116 TRP TRP B . n B 1 123 ASN 123 117 117 ASN ASN B . n B 1 124 GLU 124 118 118 GLU GLU B . n B 1 125 GLU 125 119 119 GLU GLU B . n B 1 126 LYS 126 120 120 LYS LYS B . n B 1 127 PHE 127 121 121 PHE PHE B . n B 1 128 PHE 128 122 122 PHE PHE B . n B 1 129 SER 129 123 123 SER SER B . n B 1 130 ASN 130 124 124 ASN ASN B . n B 1 131 LYS 131 125 125 LYS LYS B . n B 1 132 THR 132 126 126 THR THR B . n B 1 133 PRO 133 127 127 PRO PRO B . n B 1 134 SER 134 128 128 SER SER B . n B 1 135 GLU 135 129 129 GLU GLU B . n B 1 136 LEU 136 130 130 LEU LEU B . n B 1 137 LYS 137 131 131 LYS LYS B . n B 1 138 ILE 138 132 132 ILE ILE B . n B 1 139 PHE 139 133 133 PHE PHE B . n B 1 140 THR 140 134 134 THR THR B . n B 1 141 PHE 141 135 135 PHE PHE B . n B 1 142 ASN 142 136 136 ASN ASN B . n B 1 143 TYR 143 137 137 TYR TYR B . n B 1 144 GLU 144 138 138 GLU GLU B . n B 1 145 LYS 145 139 139 LYS LYS B . n B 1 146 LEU 146 140 140 LEU LEU B . n B 1 147 LYS 147 141 141 LYS LYS B . n B 1 148 CYS 148 142 142 CYS CYS B . n B 1 149 ALA 149 143 143 ALA ALA B . n B 1 150 LEU 150 144 144 LEU LEU B . n B 1 151 LEU 151 145 145 LEU LEU B . n B 1 152 PHE 152 146 146 PHE PHE B . n B 1 153 GLY 153 147 147 GLY GLY B . n B 1 154 PHE 154 148 148 PHE PHE B . n B 1 155 GLU 155 149 149 GLU GLU B . n B 1 156 THR 156 150 150 THR THR B . n B 1 157 HIS 157 151 151 HIS HIS B . n B 1 158 PHE 158 152 152 PHE PHE B . n B 1 159 ASP 159 153 153 ASP ASP B . n B 1 160 ILE 160 154 154 ILE ILE B . n B 1 161 PHE 161 155 155 PHE PHE B . n B 1 162 TRP 162 156 156 TRP TRP B . n B 1 163 GLN 163 157 157 GLN GLN B . n B 1 164 GLN 164 158 158 GLN GLN B . n B 1 165 ILE 165 159 159 ILE ILE B . n B 1 166 MET 166 160 160 MET MET B . n B 1 167 ALA 167 161 161 ALA ALA B . n B 1 168 LYS 168 162 162 LYS LYS B . n B 1 169 LYS 169 163 163 LYS LYS B . n B 1 170 ILE 170 164 164 ILE ILE B . n B 1 171 ASP 171 165 165 ASP ASP B . n B 1 172 LEU 172 166 166 LEU LEU B . n B 1 173 VAL 173 167 167 VAL VAL B . n B 1 174 ILE 174 168 168 ILE ILE B . n B 1 175 VAL 175 169 169 VAL VAL B . n B 1 176 PRO 176 170 170 PRO PRO B . n B 1 177 SER 177 171 171 SER SER B . n B 1 178 ALA 178 172 172 ALA ALA B . n B 1 179 CYS 179 173 173 CYS CYS B . n B 1 180 THR 180 174 174 THR THR B . n B 1 181 PHE 181 175 175 PHE PHE B . n B 1 182 GLU 182 176 176 GLU GLU B . n B 1 183 SER 183 177 177 SER SER B . n B 1 184 LYS 184 178 178 LYS LYS B . n B 1 185 GLN 185 179 179 GLN GLN B . n B 1 186 ARG 186 180 180 ARG ARG B . n B 1 187 TRP 187 181 181 TRP TRP B . n B 1 188 GLU 188 182 182 GLU GLU B . n B 1 189 GLU 189 183 183 GLU GLU B . n B 1 190 LEU 190 184 184 LEU LEU B . n B 1 191 LEU 191 185 185 LEU LEU B . n B 1 192 LYS 192 186 186 LYS LYS B . n B 1 193 THR 193 187 187 THR THR B . n B 1 194 ARG 194 188 188 ARG ARG B . n B 1 195 ALA 195 189 189 ALA ALA B . n B 1 196 PHE 196 190 190 PHE PHE B . n B 1 197 LEU 197 191 191 LEU LEU B . n B 1 198 ASN 198 192 192 ASN ASN B . n B 1 199 SER 199 193 193 SER SER B . n B 1 200 THR 200 194 194 THR THR B . n B 1 201 SER 201 195 195 SER SER B . n B 1 202 ILE 202 196 196 ILE ILE B . n B 1 203 LEU 203 197 197 LEU LEU B . n B 1 204 ARG 204 198 198 ARG ARG B . n B 1 205 VAL 205 199 199 VAL VAL B . n B 1 206 ASN 206 200 200 ASN ASN B . n B 1 207 ARG 207 201 201 ARG ARG B . n B 1 208 ILE 208 202 202 ILE ILE B . n B 1 209 GLY 209 203 203 GLY GLY B . n B 1 210 LYS 210 204 204 LYS LYS B . n B 1 211 THR 211 205 205 THR THR B . n B 1 212 LYS 212 206 206 LYS LYS B . n B 1 213 ASP 213 207 207 ASP ASP B . n B 1 214 GLU 214 208 208 GLU GLU B . n B 1 215 TRP 215 209 209 TRP TRP B . n B 1 216 ASN 216 210 210 ASN ASN B . n B 1 217 PHE 217 211 211 PHE PHE B . n B 1 218 TYR 218 212 212 TYR TYR B . n B 1 219 GLY 219 213 213 GLY GLY B . n B 1 220 ASP 220 214 214 ASP ASP B . n B 1 221 THR 221 215 215 THR THR B . n B 1 222 LEU 222 216 216 LEU LEU B . n B 1 223 PHE 223 217 217 PHE PHE B . n B 1 224 ILE 224 218 218 ILE ILE B . n B 1 225 ASN 225 219 219 ASN ASN B . n B 1 226 ALA 226 220 220 ALA ALA B . n B 1 227 PHE 227 221 221 PHE PHE B . n B 1 228 GLY 228 222 222 GLY GLY B . n B 1 229 GLU 229 223 223 GLU GLU B . n B 1 230 ILE 230 224 224 ILE ILE B . n B 1 231 GLU 231 225 225 GLU GLU B . n B 1 232 SER 232 226 226 SER SER B . n B 1 233 LYS 233 227 227 LYS LYS B . n B 1 234 LEU 234 228 228 LEU LEU B . n B 1 235 GLY 235 229 229 GLY GLY B . n B 1 236 SER 236 230 230 SER SER B . n B 1 237 GLU 237 231 231 GLU GLU B . n B 1 238 GLU 238 232 232 GLU GLU B . n B 1 239 GLU 239 233 233 GLU GLU B . n B 1 240 MET 240 234 234 MET MET B . n B 1 241 LEU 241 235 235 LEU LEU B . n B 1 242 ILE 242 236 236 ILE ILE B . n B 1 243 ILE 243 237 237 ILE ILE B . n B 1 244 GLU 244 238 238 GLU GLU B . n B 1 245 PRO 245 239 239 PRO PRO B . n B 1 246 LYS 246 240 240 LYS LYS B . n B 1 247 LYS 247 241 241 LYS LYS B . n B 1 248 SER 248 242 242 SER SER B . n B 1 249 ASP 249 243 243 ASP ASP B . n B 1 250 GLU 250 244 244 GLU GLU B . n B 1 251 ALA 251 245 245 ALA ALA B . n B 1 252 ARG 252 246 246 ARG ARG B . n B 1 253 LYS 253 247 247 LYS LYS B . n B 1 254 LEU 254 248 248 LEU LEU B . n B 1 255 TRP 255 249 249 TRP TRP B . n B 1 256 GLY 256 250 250 GLY GLY B . n B 1 257 PHE 257 251 251 PHE PHE B . n B 1 258 ASP 258 252 252 ASP ASP B . n B 1 259 LYS 259 253 253 LYS LYS B . n B 1 260 ILE 260 254 254 ILE ILE B . n B 1 261 ILE 261 255 255 ILE ILE B . n B 1 262 LYS 262 256 256 LYS LYS B . n B 1 263 GLU 263 257 257 GLU GLU B . n B 1 264 PHE 264 258 258 PHE PHE B . n B 1 265 LYS 265 259 ? ? ? B . n B 1 266 ASN 266 260 ? ? ? B . n C 1 1 GLY 1 -5 ? ? ? C . n C 1 2 SER 2 -4 ? ? ? C . n C 1 3 ALA 3 -3 ? ? ? C . n C 1 4 LYS 4 -2 ? ? ? C . n C 1 5 ASP 5 -1 ? ? ? C . n C 1 6 PRO 6 0 0 PRO PRO C . n C 1 7 MET 7 1 1 MET MET C . n C 1 8 SER 8 2 2 SER SER C . n C 1 9 LYS 9 3 3 LYS LYS C . n C 1 10 ILE 10 4 4 ILE ILE C . n C 1 11 ALA 11 5 5 ALA ALA C . n C 1 12 ALA 12 6 6 ALA ALA C . n C 1 13 LEU 13 7 7 LEU LEU C . n C 1 14 GLN 14 8 8 GLN GLN C . n C 1 15 PHE 15 9 9 PHE PHE C . n C 1 16 PRO 16 10 10 PRO PRO C . n C 1 17 THR 17 11 11 THR THR C . n C 1 18 LEU 18 12 12 LEU LEU C . n C 1 19 ALA 19 13 13 ALA ALA C . n C 1 20 LEU 20 14 14 LEU LEU C . n C 1 21 SER 21 15 15 SER SER C . n C 1 22 GLU 22 16 16 GLU GLU C . n C 1 23 SER 23 17 17 SER SER C . n C 1 24 ARG 24 18 18 ARG ARG C . n C 1 25 LEU 25 19 19 LEU LEU C . n C 1 26 ASP 26 20 20 ASP ASP C . n C 1 27 TYR 27 21 21 TYR TYR C . n C 1 28 TYR 28 22 22 TYR TYR C . n C 1 29 LEU 29 23 23 LEU LEU C . n C 1 30 LYS 30 24 24 LYS LYS C . n C 1 31 ALA 31 25 25 ALA ALA C . n C 1 32 SER 32 26 26 SER SER C . n C 1 33 LYS 33 27 27 LYS LYS C . n C 1 34 ASP 34 28 28 ASP ASP C . n C 1 35 ASN 35 29 29 ASN ASN C . n C 1 36 GLY 36 30 30 GLY GLY C . n C 1 37 VAL 37 31 31 VAL VAL C . n C 1 38 ASN 38 32 32 ASN ASN C . n C 1 39 LEU 39 33 33 LEU LEU C . n C 1 40 VAL 40 34 34 VAL VAL C . n C 1 41 VAL 41 35 35 VAL VAL C . n C 1 42 LEU 42 36 36 LEU LEU C . n C 1 43 GLY 43 37 37 GLY GLY C . n C 1 44 GLU 44 38 38 GLU GLU C . n C 1 45 TYR 45 39 39 TYR TYR C . n C 1 46 VAL 46 40 40 VAL VAL C . n C 1 47 ILE 47 41 41 ILE ILE C . n C 1 48 ASN 48 42 42 ASN ASN C . n C 1 49 SER 49 43 43 SER SER C . n C 1 50 PHE 50 44 44 PHE PHE C . n C 1 51 PHE 51 45 45 PHE PHE C . n C 1 52 THR 52 46 46 THR THR C . n C 1 53 GLU 53 47 47 GLU GLU C . n C 1 54 LEU 54 48 48 LEU LEU C . n C 1 55 LEU 55 49 49 LEU LEU C . n C 1 56 HIS 56 50 50 HIS HIS C . n C 1 57 MET 57 51 51 MET MET C . n C 1 58 PRO 58 52 52 PRO PRO C . n C 1 59 LYS 59 53 53 LYS LYS C . n C 1 60 ASN 60 54 54 ASN ASN C . n C 1 61 MET 61 55 55 MET MET C . n C 1 62 ILE 62 56 56 ILE ILE C . n C 1 63 LYS 63 57 57 LYS LYS C . n C 1 64 GLU 64 58 58 GLU GLU C . n C 1 65 GLN 65 59 59 GLN GLN C . n C 1 66 SER 66 60 60 SER SER C . n C 1 67 GLU 67 61 61 GLU GLU C . n C 1 68 ALA 68 62 62 ALA ALA C . n C 1 69 LYS 69 63 63 LYS LYS C . n C 1 70 LYS 70 64 64 LYS LYS C . n C 1 71 GLU 71 65 65 GLU GLU C . n C 1 72 SER 72 66 66 SER SER C . n C 1 73 LEU 73 67 67 LEU LEU C . n C 1 74 ILE 74 68 68 ILE ILE C . n C 1 75 LYS 75 69 69 LYS LYS C . n C 1 76 LEU 76 70 70 LEU LEU C . n C 1 77 ALA 77 71 71 ALA ALA C . n C 1 78 LYS 78 72 72 LYS LYS C . n C 1 79 LYS 79 73 73 LYS LYS C . n C 1 80 TYR 80 74 74 TYR TYR C . n C 1 81 GLU 81 75 75 GLU GLU C . n C 1 82 LEU 82 76 76 LEU LEU C . n C 1 83 GLU 83 77 77 GLU GLU C . n C 1 84 ILE 84 78 78 ILE ILE C . n C 1 85 ILE 85 79 79 ILE ILE C . n C 1 86 ALA 86 80 80 ALA ALA C . n C 1 87 PRO 87 81 81 PRO PRO C . n C 1 88 TYR 88 82 82 TYR TYR C . n C 1 89 VAL 89 83 83 VAL VAL C . n C 1 90 SER 90 84 84 SER SER C . n C 1 91 VAL 91 85 85 VAL VAL C . n C 1 92 GLU 92 86 86 GLU GLU C . n C 1 93 ALA 93 87 87 ALA ALA C . n C 1 94 LYS 94 88 88 LYS LYS C . n C 1 95 SER 95 89 89 SER SER C . n C 1 96 TYR 96 90 90 TYR TYR C . n C 1 97 LYS 97 91 91 LYS LYS C . n C 1 98 LYS 98 92 92 LYS LYS C . n C 1 99 LEU 99 93 93 LEU LEU C . n C 1 100 CYS 100 94 94 CYS CYS C . n C 1 101 LEU 101 95 95 LEU LEU C . n C 1 102 LYS 102 96 96 LYS LYS C . n C 1 103 VAL 103 97 97 VAL VAL C . n C 1 104 THR 104 98 98 THR THR C . n C 1 105 PRO 105 99 99 PRO PRO C . n C 1 106 ASN 106 100 100 ASN ASN C . n C 1 107 GLY 107 101 101 GLY GLY C . n C 1 108 VAL 108 102 102 VAL VAL C . n C 1 109 LYS 109 103 103 LYS LYS C . n C 1 110 SER 110 104 104 SER SER C . n C 1 111 TYR 111 105 105 TYR TYR C . n C 1 112 GLU 112 106 106 GLU GLU C . n C 1 113 GLN 113 107 107 GLN GLN C . n C 1 114 GLN 114 108 108 GLN GLN C . n C 1 115 ILE 115 109 109 ILE ILE C . n C 1 116 LEU 116 110 110 LEU LEU C . n C 1 117 MET 117 111 111 MET MET C . n C 1 118 PRO 118 112 112 PRO PRO C . n C 1 119 TYR 119 113 113 TYR TYR C . n C 1 120 GLU 120 114 114 GLU GLU C . n C 1 121 HIS 121 115 115 HIS HIS C . n C 1 122 TRP 122 116 116 TRP TRP C . n C 1 123 ASN 123 117 117 ASN ASN C . n C 1 124 GLU 124 118 118 GLU GLU C . n C 1 125 GLU 125 119 119 GLU GLU C . n C 1 126 LYS 126 120 120 LYS LYS C . n C 1 127 PHE 127 121 121 PHE PHE C . n C 1 128 PHE 128 122 122 PHE PHE C . n C 1 129 SER 129 123 123 SER SER C . n C 1 130 ASN 130 124 124 ASN ASN C . n C 1 131 LYS 131 125 125 LYS LYS C . n C 1 132 THR 132 126 126 THR THR C . n C 1 133 PRO 133 127 127 PRO PRO C . n C 1 134 SER 134 128 128 SER SER C . n C 1 135 GLU 135 129 129 GLU GLU C . n C 1 136 LEU 136 130 130 LEU LEU C . n C 1 137 LYS 137 131 131 LYS LYS C . n C 1 138 ILE 138 132 132 ILE ILE C . n C 1 139 PHE 139 133 133 PHE PHE C . n C 1 140 THR 140 134 134 THR THR C . n C 1 141 PHE 141 135 135 PHE PHE C . n C 1 142 ASN 142 136 136 ASN ASN C . n C 1 143 TYR 143 137 137 TYR TYR C . n C 1 144 GLU 144 138 138 GLU GLU C . n C 1 145 LYS 145 139 139 LYS LYS C . n C 1 146 LEU 146 140 140 LEU LEU C . n C 1 147 LYS 147 141 141 LYS LYS C . n C 1 148 CYS 148 142 142 CYS CYS C . n C 1 149 ALA 149 143 143 ALA ALA C . n C 1 150 LEU 150 144 144 LEU LEU C . n C 1 151 LEU 151 145 145 LEU LEU C . n C 1 152 PHE 152 146 146 PHE PHE C . n C 1 153 GLY 153 147 147 GLY GLY C . n C 1 154 PHE 154 148 148 PHE PHE C . n C 1 155 GLU 155 149 149 GLU GLU C . n C 1 156 THR 156 150 150 THR THR C . n C 1 157 HIS 157 151 151 HIS HIS C . n C 1 158 PHE 158 152 152 PHE PHE C . n C 1 159 ASP 159 153 153 ASP ASP C . n C 1 160 ILE 160 154 154 ILE ILE C . n C 1 161 PHE 161 155 155 PHE PHE C . n C 1 162 TRP 162 156 156 TRP TRP C . n C 1 163 GLN 163 157 157 GLN GLN C . n C 1 164 GLN 164 158 158 GLN GLN C . n C 1 165 ILE 165 159 159 ILE ILE C . n C 1 166 MET 166 160 160 MET MET C . n C 1 167 ALA 167 161 161 ALA ALA C . n C 1 168 LYS 168 162 162 LYS LYS C . n C 1 169 LYS 169 163 163 LYS LYS C . n C 1 170 ILE 170 164 164 ILE ILE C . n C 1 171 ASP 171 165 165 ASP ASP C . n C 1 172 LEU 172 166 166 LEU LEU C . n C 1 173 VAL 173 167 167 VAL VAL C . n C 1 174 ILE 174 168 168 ILE ILE C . n C 1 175 VAL 175 169 169 VAL VAL C . n C 1 176 PRO 176 170 170 PRO PRO C . n C 1 177 SER 177 171 171 SER SER C . n C 1 178 ALA 178 172 172 ALA ALA C . n C 1 179 CYS 179 173 173 CYS CYS C . n C 1 180 THR 180 174 174 THR THR C . n C 1 181 PHE 181 175 175 PHE PHE C . n C 1 182 GLU 182 176 176 GLU GLU C . n C 1 183 SER 183 177 177 SER SER C . n C 1 184 LYS 184 178 178 LYS LYS C . n C 1 185 GLN 185 179 179 GLN GLN C . n C 1 186 ARG 186 180 180 ARG ARG C . n C 1 187 TRP 187 181 181 TRP TRP C . n C 1 188 GLU 188 182 182 GLU GLU C . n C 1 189 GLU 189 183 183 GLU GLU C . n C 1 190 LEU 190 184 184 LEU LEU C . n C 1 191 LEU 191 185 185 LEU LEU C . n C 1 192 LYS 192 186 186 LYS LYS C . n C 1 193 THR 193 187 187 THR THR C . n C 1 194 ARG 194 188 188 ARG ARG C . n C 1 195 ALA 195 189 189 ALA ALA C . n C 1 196 PHE 196 190 190 PHE PHE C . n C 1 197 LEU 197 191 191 LEU LEU C . n C 1 198 ASN 198 192 192 ASN ASN C . n C 1 199 SER 199 193 193 SER SER C . n C 1 200 THR 200 194 194 THR THR C . n C 1 201 SER 201 195 195 SER SER C . n C 1 202 ILE 202 196 196 ILE ILE C . n C 1 203 LEU 203 197 197 LEU LEU C . n C 1 204 ARG 204 198 198 ARG ARG C . n C 1 205 VAL 205 199 199 VAL VAL C . n C 1 206 ASN 206 200 200 ASN ASN C . n C 1 207 ARG 207 201 201 ARG ARG C . n C 1 208 ILE 208 202 202 ILE ILE C . n C 1 209 GLY 209 203 203 GLY GLY C . n C 1 210 LYS 210 204 204 LYS LYS C . n C 1 211 THR 211 205 205 THR THR C . n C 1 212 LYS 212 206 206 LYS LYS C . n C 1 213 ASP 213 207 207 ASP ASP C . n C 1 214 GLU 214 208 208 GLU GLU C . n C 1 215 TRP 215 209 209 TRP TRP C . n C 1 216 ASN 216 210 210 ASN ASN C . n C 1 217 PHE 217 211 211 PHE PHE C . n C 1 218 TYR 218 212 212 TYR TYR C . n C 1 219 GLY 219 213 213 GLY GLY C . n C 1 220 ASP 220 214 214 ASP ASP C . n C 1 221 THR 221 215 215 THR THR C . n C 1 222 LEU 222 216 216 LEU LEU C . n C 1 223 PHE 223 217 217 PHE PHE C . n C 1 224 ILE 224 218 218 ILE ILE C . n C 1 225 ASN 225 219 219 ASN ASN C . n C 1 226 ALA 226 220 220 ALA ALA C . n C 1 227 PHE 227 221 221 PHE PHE C . n C 1 228 GLY 228 222 222 GLY GLY C . n C 1 229 GLU 229 223 223 GLU GLU C . n C 1 230 ILE 230 224 224 ILE ILE C . n C 1 231 GLU 231 225 225 GLU GLU C . n C 1 232 SER 232 226 226 SER SER C . n C 1 233 LYS 233 227 227 LYS LYS C . n C 1 234 LEU 234 228 228 LEU LEU C . n C 1 235 GLY 235 229 229 GLY GLY C . n C 1 236 SER 236 230 230 SER SER C . n C 1 237 GLU 237 231 231 GLU GLU C . n C 1 238 GLU 238 232 232 GLU GLU C . n C 1 239 GLU 239 233 233 GLU GLU C . n C 1 240 MET 240 234 234 MET MET C . n C 1 241 LEU 241 235 235 LEU LEU C . n C 1 242 ILE 242 236 236 ILE ILE C . n C 1 243 ILE 243 237 237 ILE ILE C . n C 1 244 GLU 244 238 238 GLU GLU C . n C 1 245 PRO 245 239 239 PRO PRO C . n C 1 246 LYS 246 240 240 LYS LYS C . n C 1 247 LYS 247 241 241 LYS LYS C . n C 1 248 SER 248 242 242 SER SER C . n C 1 249 ASP 249 243 243 ASP ASP C . n C 1 250 GLU 250 244 244 GLU GLU C . n C 1 251 ALA 251 245 245 ALA ALA C . n C 1 252 ARG 252 246 246 ARG ARG C . n C 1 253 LYS 253 247 247 LYS LYS C . n C 1 254 LEU 254 248 248 LEU LEU C . n C 1 255 TRP 255 249 249 TRP TRP C . n C 1 256 GLY 256 250 250 GLY GLY C . n C 1 257 PHE 257 251 251 PHE PHE C . n C 1 258 ASP 258 252 252 ASP ASP C . n C 1 259 LYS 259 253 253 LYS LYS C . n C 1 260 ILE 260 254 254 ILE ILE C . n C 1 261 ILE 261 255 255 ILE ILE C . n C 1 262 LYS 262 256 256 LYS LYS C . n C 1 263 GLU 263 257 257 GLU GLU C . n C 1 264 PHE 264 258 258 PHE PHE C . n C 1 265 LYS 265 259 ? ? ? C . n C 1 266 ASN 266 260 ? ? ? C . n D 1 1 GLY 1 -5 ? ? ? D . n D 1 2 SER 2 -4 ? ? ? D . n D 1 3 ALA 3 -3 ? ? ? D . n D 1 4 LYS 4 -2 ? ? ? D . n D 1 5 ASP 5 -1 ? ? ? D . n D 1 6 PRO 6 0 ? ? ? D . n D 1 7 MET 7 1 ? ? ? D . n D 1 8 SER 8 2 2 SER SER D . n D 1 9 LYS 9 3 3 LYS LYS D . n D 1 10 ILE 10 4 4 ILE ILE D . n D 1 11 ALA 11 5 5 ALA ALA D . n D 1 12 ALA 12 6 6 ALA ALA D . n D 1 13 LEU 13 7 7 LEU LEU D . n D 1 14 GLN 14 8 8 GLN GLN D . n D 1 15 PHE 15 9 9 PHE PHE D . n D 1 16 PRO 16 10 10 PRO PRO D . n D 1 17 THR 17 11 11 THR THR D . n D 1 18 LEU 18 12 12 LEU LEU D . n D 1 19 ALA 19 13 13 ALA ALA D . n D 1 20 LEU 20 14 14 LEU LEU D . n D 1 21 SER 21 15 15 SER SER D . n D 1 22 GLU 22 16 16 GLU GLU D . n D 1 23 SER 23 17 17 SER SER D . n D 1 24 ARG 24 18 18 ARG ARG D . n D 1 25 LEU 25 19 19 LEU LEU D . n D 1 26 ASP 26 20 20 ASP ASP D . n D 1 27 TYR 27 21 21 TYR TYR D . n D 1 28 TYR 28 22 22 TYR TYR D . n D 1 29 LEU 29 23 23 LEU LEU D . n D 1 30 LYS 30 24 24 LYS LYS D . n D 1 31 ALA 31 25 25 ALA ALA D . n D 1 32 SER 32 26 26 SER SER D . n D 1 33 LYS 33 27 27 LYS LYS D . n D 1 34 ASP 34 28 28 ASP ASP D . n D 1 35 ASN 35 29 29 ASN ASN D . n D 1 36 GLY 36 30 30 GLY GLY D . n D 1 37 VAL 37 31 31 VAL VAL D . n D 1 38 ASN 38 32 32 ASN ASN D . n D 1 39 LEU 39 33 33 LEU LEU D . n D 1 40 VAL 40 34 34 VAL VAL D . n D 1 41 VAL 41 35 35 VAL VAL D . n D 1 42 LEU 42 36 36 LEU LEU D . n D 1 43 GLY 43 37 37 GLY GLY D . n D 1 44 GLU 44 38 38 GLU GLU D . n D 1 45 TYR 45 39 39 TYR TYR D . n D 1 46 VAL 46 40 40 VAL VAL D . n D 1 47 ILE 47 41 41 ILE ILE D . n D 1 48 ASN 48 42 42 ASN ASN D . n D 1 49 SER 49 43 43 SER SER D . n D 1 50 PHE 50 44 44 PHE PHE D . n D 1 51 PHE 51 45 45 PHE PHE D . n D 1 52 THR 52 46 46 THR THR D . n D 1 53 GLU 53 47 47 GLU GLU D . n D 1 54 LEU 54 48 48 LEU LEU D . n D 1 55 LEU 55 49 49 LEU LEU D . n D 1 56 HIS 56 50 50 HIS HIS D . n D 1 57 MET 57 51 51 MET MET D . n D 1 58 PRO 58 52 52 PRO PRO D . n D 1 59 LYS 59 53 53 LYS LYS D . n D 1 60 ASN 60 54 54 ASN ASN D . n D 1 61 MET 61 55 55 MET MET D . n D 1 62 ILE 62 56 56 ILE ILE D . n D 1 63 LYS 63 57 57 LYS LYS D . n D 1 64 GLU 64 58 58 GLU GLU D . n D 1 65 GLN 65 59 59 GLN GLN D . n D 1 66 SER 66 60 60 SER SER D . n D 1 67 GLU 67 61 61 GLU GLU D . n D 1 68 ALA 68 62 62 ALA ALA D . n D 1 69 LYS 69 63 63 LYS LYS D . n D 1 70 LYS 70 64 64 LYS LYS D . n D 1 71 GLU 71 65 65 GLU GLU D . n D 1 72 SER 72 66 66 SER SER D . n D 1 73 LEU 73 67 67 LEU LEU D . n D 1 74 ILE 74 68 68 ILE ILE D . n D 1 75 LYS 75 69 69 LYS LYS D . n D 1 76 LEU 76 70 70 LEU LEU D . n D 1 77 ALA 77 71 71 ALA ALA D . n D 1 78 LYS 78 72 72 LYS LYS D . n D 1 79 LYS 79 73 73 LYS LYS D . n D 1 80 TYR 80 74 74 TYR TYR D . n D 1 81 GLU 81 75 75 GLU GLU D . n D 1 82 LEU 82 76 76 LEU LEU D . n D 1 83 GLU 83 77 77 GLU GLU D . n D 1 84 ILE 84 78 78 ILE ILE D . n D 1 85 ILE 85 79 79 ILE ILE D . n D 1 86 ALA 86 80 80 ALA ALA D . n D 1 87 PRO 87 81 81 PRO PRO D . n D 1 88 TYR 88 82 82 TYR TYR D . n D 1 89 VAL 89 83 83 VAL VAL D . n D 1 90 SER 90 84 84 SER SER D . n D 1 91 VAL 91 85 85 VAL VAL D . n D 1 92 GLU 92 86 86 GLU GLU D . n D 1 93 ALA 93 87 87 ALA ALA D . n D 1 94 LYS 94 88 88 LYS LYS D . n D 1 95 SER 95 89 89 SER SER D . n D 1 96 TYR 96 90 90 TYR TYR D . n D 1 97 LYS 97 91 91 LYS LYS D . n D 1 98 LYS 98 92 92 LYS LYS D . n D 1 99 LEU 99 93 93 LEU LEU D . n D 1 100 CYS 100 94 94 CYS CYS D . n D 1 101 LEU 101 95 95 LEU LEU D . n D 1 102 LYS 102 96 96 LYS LYS D . n D 1 103 VAL 103 97 97 VAL VAL D . n D 1 104 THR 104 98 98 THR THR D . n D 1 105 PRO 105 99 99 PRO PRO D . n D 1 106 ASN 106 100 100 ASN ASN D . n D 1 107 GLY 107 101 101 GLY GLY D . n D 1 108 VAL 108 102 102 VAL VAL D . n D 1 109 LYS 109 103 103 LYS LYS D . n D 1 110 SER 110 104 104 SER SER D . n D 1 111 TYR 111 105 105 TYR TYR D . n D 1 112 GLU 112 106 106 GLU GLU D . n D 1 113 GLN 113 107 107 GLN GLN D . n D 1 114 GLN 114 108 108 GLN GLN D . n D 1 115 ILE 115 109 109 ILE ILE D . n D 1 116 LEU 116 110 110 LEU LEU D . n D 1 117 MET 117 111 111 MET MET D . n D 1 118 PRO 118 112 112 PRO PRO D . n D 1 119 TYR 119 113 113 TYR TYR D . n D 1 120 GLU 120 114 114 GLU GLU D . n D 1 121 HIS 121 115 115 HIS HIS D . n D 1 122 TRP 122 116 116 TRP TRP D . n D 1 123 ASN 123 117 117 ASN ASN D . n D 1 124 GLU 124 118 118 GLU GLU D . n D 1 125 GLU 125 119 119 GLU GLU D . n D 1 126 LYS 126 120 120 LYS LYS D . n D 1 127 PHE 127 121 121 PHE PHE D . n D 1 128 PHE 128 122 122 PHE PHE D . n D 1 129 SER 129 123 123 SER SER D . n D 1 130 ASN 130 124 124 ASN ASN D . n D 1 131 LYS 131 125 125 LYS LYS D . n D 1 132 THR 132 126 126 THR THR D . n D 1 133 PRO 133 127 127 PRO PRO D . n D 1 134 SER 134 128 128 SER SER D . n D 1 135 GLU 135 129 129 GLU GLU D . n D 1 136 LEU 136 130 130 LEU LEU D . n D 1 137 LYS 137 131 131 LYS LYS D . n D 1 138 ILE 138 132 132 ILE ILE D . n D 1 139 PHE 139 133 133 PHE PHE D . n D 1 140 THR 140 134 134 THR THR D . n D 1 141 PHE 141 135 135 PHE PHE D . n D 1 142 ASN 142 136 136 ASN ASN D . n D 1 143 TYR 143 137 137 TYR TYR D . n D 1 144 GLU 144 138 138 GLU GLU D . n D 1 145 LYS 145 139 139 LYS LYS D . n D 1 146 LEU 146 140 140 LEU LEU D . n D 1 147 LYS 147 141 141 LYS LYS D . n D 1 148 CYS 148 142 142 CYS CYS D . n D 1 149 ALA 149 143 143 ALA ALA D . n D 1 150 LEU 150 144 144 LEU LEU D . n D 1 151 LEU 151 145 145 LEU LEU D . n D 1 152 PHE 152 146 146 PHE PHE D . n D 1 153 GLY 153 147 147 GLY GLY D . n D 1 154 PHE 154 148 148 PHE PHE D . n D 1 155 GLU 155 149 149 GLU GLU D . n D 1 156 THR 156 150 150 THR THR D . n D 1 157 HIS 157 151 151 HIS HIS D . n D 1 158 PHE 158 152 152 PHE PHE D . n D 1 159 ASP 159 153 153 ASP ASP D . n D 1 160 ILE 160 154 154 ILE ILE D . n D 1 161 PHE 161 155 155 PHE PHE D . n D 1 162 TRP 162 156 156 TRP TRP D . n D 1 163 GLN 163 157 157 GLN GLN D . n D 1 164 GLN 164 158 158 GLN GLN D . n D 1 165 ILE 165 159 159 ILE ILE D . n D 1 166 MET 166 160 160 MET MET D . n D 1 167 ALA 167 161 161 ALA ALA D . n D 1 168 LYS 168 162 162 LYS LYS D . n D 1 169 LYS 169 163 163 LYS LYS D . n D 1 170 ILE 170 164 164 ILE ILE D . n D 1 171 ASP 171 165 165 ASP ASP D . n D 1 172 LEU 172 166 166 LEU LEU D . n D 1 173 VAL 173 167 167 VAL VAL D . n D 1 174 ILE 174 168 168 ILE ILE D . n D 1 175 VAL 175 169 169 VAL VAL D . n D 1 176 PRO 176 170 170 PRO PRO D . n D 1 177 SER 177 171 171 SER SER D . n D 1 178 ALA 178 172 172 ALA ALA D . n D 1 179 CYS 179 173 173 CYS CYS D . n D 1 180 THR 180 174 174 THR THR D . n D 1 181 PHE 181 175 175 PHE PHE D . n D 1 182 GLU 182 176 176 GLU GLU D . n D 1 183 SER 183 177 177 SER SER D . n D 1 184 LYS 184 178 178 LYS LYS D . n D 1 185 GLN 185 179 179 GLN GLN D . n D 1 186 ARG 186 180 180 ARG ARG D . n D 1 187 TRP 187 181 181 TRP TRP D . n D 1 188 GLU 188 182 182 GLU GLU D . n D 1 189 GLU 189 183 183 GLU GLU D . n D 1 190 LEU 190 184 184 LEU LEU D . n D 1 191 LEU 191 185 185 LEU LEU D . n D 1 192 LYS 192 186 186 LYS LYS D . n D 1 193 THR 193 187 187 THR THR D . n D 1 194 ARG 194 188 188 ARG ARG D . n D 1 195 ALA 195 189 189 ALA ALA D . n D 1 196 PHE 196 190 190 PHE PHE D . n D 1 197 LEU 197 191 191 LEU LEU D . n D 1 198 ASN 198 192 192 ASN ASN D . n D 1 199 SER 199 193 193 SER SER D . n D 1 200 THR 200 194 194 THR THR D . n D 1 201 SER 201 195 195 SER SER D . n D 1 202 ILE 202 196 196 ILE ILE D . n D 1 203 LEU 203 197 197 LEU LEU D . n D 1 204 ARG 204 198 198 ARG ARG D . n D 1 205 VAL 205 199 199 VAL VAL D . n D 1 206 ASN 206 200 200 ASN ASN D . n D 1 207 ARG 207 201 201 ARG ARG D . n D 1 208 ILE 208 202 202 ILE ILE D . n D 1 209 GLY 209 203 203 GLY GLY D . n D 1 210 LYS 210 204 204 LYS LYS D . n D 1 211 THR 211 205 205 THR THR D . n D 1 212 LYS 212 206 206 LYS LYS D . n D 1 213 ASP 213 207 207 ASP ASP D . n D 1 214 GLU 214 208 208 GLU GLU D . n D 1 215 TRP 215 209 209 TRP TRP D . n D 1 216 ASN 216 210 210 ASN ASN D . n D 1 217 PHE 217 211 211 PHE PHE D . n D 1 218 TYR 218 212 212 TYR TYR D . n D 1 219 GLY 219 213 213 GLY GLY D . n D 1 220 ASP 220 214 214 ASP ASP D . n D 1 221 THR 221 215 215 THR THR D . n D 1 222 LEU 222 216 216 LEU LEU D . n D 1 223 PHE 223 217 217 PHE PHE D . n D 1 224 ILE 224 218 218 ILE ILE D . n D 1 225 ASN 225 219 219 ASN ASN D . n D 1 226 ALA 226 220 220 ALA ALA D . n D 1 227 PHE 227 221 221 PHE PHE D . n D 1 228 GLY 228 222 222 GLY GLY D . n D 1 229 GLU 229 223 223 GLU GLU D . n D 1 230 ILE 230 224 224 ILE ILE D . n D 1 231 GLU 231 225 225 GLU GLU D . n D 1 232 SER 232 226 226 SER SER D . n D 1 233 LYS 233 227 227 LYS LYS D . n D 1 234 LEU 234 228 228 LEU LEU D . n D 1 235 GLY 235 229 229 GLY GLY D . n D 1 236 SER 236 230 230 SER SER D . n D 1 237 GLU 237 231 231 GLU GLU D . n D 1 238 GLU 238 232 232 GLU GLU D . n D 1 239 GLU 239 233 233 GLU GLU D . n D 1 240 MET 240 234 234 MET MET D . n D 1 241 LEU 241 235 235 LEU LEU D . n D 1 242 ILE 242 236 236 ILE ILE D . n D 1 243 ILE 243 237 237 ILE ILE D . n D 1 244 GLU 244 238 238 GLU GLU D . n D 1 245 PRO 245 239 239 PRO PRO D . n D 1 246 LYS 246 240 240 LYS LYS D . n D 1 247 LYS 247 241 241 LYS LYS D . n D 1 248 SER 248 242 242 SER SER D . n D 1 249 ASP 249 243 243 ASP ASP D . n D 1 250 GLU 250 244 244 GLU GLU D . n D 1 251 ALA 251 245 245 ALA ALA D . n D 1 252 ARG 252 246 246 ARG ARG D . n D 1 253 LYS 253 247 247 LYS LYS D . n D 1 254 LEU 254 248 248 LEU LEU D . n D 1 255 TRP 255 249 249 TRP TRP D . n D 1 256 GLY 256 250 250 GLY GLY D . n D 1 257 PHE 257 251 251 PHE PHE D . n D 1 258 ASP 258 252 252 ASP ASP D . n D 1 259 LYS 259 253 253 LYS LYS D . n D 1 260 ILE 260 254 254 ILE ILE D . n D 1 261 ILE 261 255 255 ILE ILE D . n D 1 262 LYS 262 256 256 LYS LYS D . n D 1 263 GLU 263 257 257 GLU GLU D . n D 1 264 PHE 264 258 258 PHE PHE D . n D 1 265 LYS 265 259 ? ? ? D . n D 1 266 ASN 266 260 ? ? ? D . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code E 2 HOH 1 301 55 HOH HOH A . E 2 HOH 2 302 53 HOH HOH A . E 2 HOH 3 303 39 HOH HOH A . E 2 HOH 4 304 67 HOH HOH A . E 2 HOH 5 305 86 HOH HOH A . E 2 HOH 6 306 85 HOH HOH A . E 2 HOH 7 307 38 HOH HOH A . E 2 HOH 8 308 20 HOH HOH A . E 2 HOH 9 309 2 HOH HOH A . E 2 HOH 10 310 48 HOH HOH A . E 2 HOH 11 311 98 HOH HOH A . E 2 HOH 12 312 60 HOH HOH A . E 2 HOH 13 313 107 HOH HOH A . E 2 HOH 14 314 63 HOH HOH A . E 2 HOH 15 315 116 HOH HOH A . E 2 HOH 16 316 68 HOH HOH A . E 2 HOH 17 317 8 HOH HOH A . E 2 HOH 18 318 73 HOH HOH A . E 2 HOH 19 319 59 HOH HOH A . E 2 HOH 20 320 125 HOH HOH A . E 2 HOH 21 321 101 HOH HOH A . E 2 HOH 22 322 24 HOH HOH A . E 2 HOH 23 323 40 HOH HOH A . E 2 HOH 24 324 126 HOH HOH A . F 2 HOH 1 301 129 HOH HOH B . F 2 HOH 2 302 93 HOH HOH B . F 2 HOH 3 303 130 HOH HOH B . F 2 HOH 4 304 100 HOH HOH B . F 2 HOH 5 305 46 HOH HOH B . F 2 HOH 6 306 103 HOH HOH B . F 2 HOH 7 307 119 HOH HOH B . F 2 HOH 8 308 102 HOH HOH B . F 2 HOH 9 309 57 HOH HOH B . F 2 HOH 10 310 43 HOH HOH B . F 2 HOH 11 311 29 HOH HOH B . F 2 HOH 12 312 23 HOH HOH B . F 2 HOH 13 313 122 HOH HOH B . F 2 HOH 14 314 90 HOH HOH B . F 2 HOH 15 315 26 HOH HOH B . F 2 HOH 16 316 110 HOH HOH B . F 2 HOH 17 317 72 HOH HOH B . F 2 HOH 18 318 91 HOH HOH B . F 2 HOH 19 319 6 HOH HOH B . F 2 HOH 20 320 47 HOH HOH B . F 2 HOH 21 321 105 HOH HOH B . F 2 HOH 22 322 89 HOH HOH B . F 2 HOH 23 323 83 HOH HOH B . F 2 HOH 24 324 25 HOH HOH B . F 2 HOH 25 325 4 HOH HOH B . F 2 HOH 26 326 34 HOH HOH B . F 2 HOH 27 327 14 HOH HOH B . F 2 HOH 28 328 82 HOH HOH B . F 2 HOH 29 329 45 HOH HOH B . F 2 HOH 30 330 11 HOH HOH B . F 2 HOH 31 331 37 HOH HOH B . F 2 HOH 32 332 111 HOH HOH B . F 2 HOH 33 333 54 HOH HOH B . F 2 HOH 34 334 13 HOH HOH B . F 2 HOH 35 335 49 HOH HOH B . F 2 HOH 36 336 5 HOH HOH B . F 2 HOH 37 337 12 HOH HOH B . F 2 HOH 38 338 35 HOH HOH B . F 2 HOH 39 339 127 HOH HOH B . F 2 HOH 40 340 128 HOH HOH B . G 2 HOH 1 301 118 HOH HOH C . G 2 HOH 2 302 77 HOH HOH C . G 2 HOH 3 303 80 HOH HOH C . G 2 HOH 4 304 62 HOH HOH C . G 2 HOH 5 305 51 HOH HOH C . G 2 HOH 6 306 64 HOH HOH C . G 2 HOH 7 307 3 HOH HOH C . G 2 HOH 8 308 81 HOH HOH C . G 2 HOH 9 309 15 HOH HOH C . G 2 HOH 10 310 74 HOH HOH C . G 2 HOH 11 311 70 HOH HOH C . G 2 HOH 12 312 52 HOH HOH C . G 2 HOH 13 313 115 HOH HOH C . G 2 HOH 14 314 32 HOH HOH C . G 2 HOH 15 315 113 HOH HOH C . G 2 HOH 16 316 56 HOH HOH C . G 2 HOH 17 317 97 HOH HOH C . G 2 HOH 18 318 71 HOH HOH C . G 2 HOH 19 319 109 HOH HOH C . G 2 HOH 20 320 69 HOH HOH C . G 2 HOH 21 321 42 HOH HOH C . G 2 HOH 22 322 36 HOH HOH C . G 2 HOH 23 323 21 HOH HOH C . G 2 HOH 24 324 121 HOH HOH C . G 2 HOH 25 325 78 HOH HOH C . G 2 HOH 26 326 92 HOH HOH C . G 2 HOH 27 327 18 HOH HOH C . H 2 HOH 1 301 17 HOH HOH D . H 2 HOH 2 302 65 HOH HOH D . H 2 HOH 3 303 84 HOH HOH D . H 2 HOH 4 304 96 HOH HOH D . H 2 HOH 5 305 99 HOH HOH D . H 2 HOH 6 306 87 HOH HOH D . H 2 HOH 7 307 79 HOH HOH D . H 2 HOH 8 308 16 HOH HOH D . H 2 HOH 9 309 104 HOH HOH D . H 2 HOH 10 310 95 HOH HOH D . H 2 HOH 11 311 76 HOH HOH D . H 2 HOH 12 312 50 HOH HOH D . H 2 HOH 13 313 120 HOH HOH D . H 2 HOH 14 314 44 HOH HOH D . H 2 HOH 15 315 41 HOH HOH D . H 2 HOH 16 316 58 HOH HOH D . H 2 HOH 17 317 112 HOH HOH D . H 2 HOH 18 318 28 HOH HOH D . H 2 HOH 19 319 88 HOH HOH D . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A MET 1 ? CG ? A MET 7 CG 2 1 Y 1 A MET 1 ? SD ? A MET 7 SD 3 1 Y 1 A MET 1 ? CE ? A MET 7 CE 4 1 Y 1 A SER 15 ? OG ? A SER 21 OG 5 1 Y 1 A LYS 53 ? CG ? A LYS 59 CG 6 1 Y 1 A LYS 53 ? CD ? A LYS 59 CD 7 1 Y 1 A LYS 53 ? CE ? A LYS 59 CE 8 1 Y 1 A LYS 53 ? NZ ? A LYS 59 NZ 9 1 Y 1 A GLU 65 ? CG ? A GLU 71 CG 10 1 Y 1 A GLU 65 ? CD ? A GLU 71 CD 11 1 Y 1 A GLU 65 ? OE1 ? A GLU 71 OE1 12 1 Y 1 A GLU 65 ? OE2 ? A GLU 71 OE2 13 1 Y 1 A GLU 75 ? CG ? A GLU 81 CG 14 1 Y 1 A GLU 75 ? CD ? A GLU 81 CD 15 1 Y 1 A GLU 75 ? OE1 ? A GLU 81 OE1 16 1 Y 1 A GLU 75 ? OE2 ? A GLU 81 OE2 17 1 Y 1 A GLU 176 ? CG ? A GLU 182 CG 18 1 Y 1 A GLU 176 ? CD ? A GLU 182 CD 19 1 Y 1 A GLU 176 ? OE1 ? A GLU 182 OE1 20 1 Y 1 A GLU 176 ? OE2 ? A GLU 182 OE2 21 1 Y 1 A LYS 178 ? CE ? A LYS 184 CE 22 1 Y 1 A LYS 178 ? NZ ? A LYS 184 NZ 23 1 Y 1 A LYS 206 ? CG ? A LYS 212 CG 24 1 Y 1 A LYS 206 ? CD ? A LYS 212 CD 25 1 Y 1 A LYS 206 ? CE ? A LYS 212 CE 26 1 Y 1 A LYS 206 ? NZ ? A LYS 212 NZ 27 1 Y 1 A TYR 212 ? CG ? A TYR 218 CG 28 1 Y 1 A TYR 212 ? CD1 ? A TYR 218 CD1 29 1 Y 1 A TYR 212 ? CD2 ? A TYR 218 CD2 30 1 Y 1 A TYR 212 ? CE1 ? A TYR 218 CE1 31 1 Y 1 A TYR 212 ? CE2 ? A TYR 218 CE2 32 1 Y 1 A TYR 212 ? CZ ? A TYR 218 CZ 33 1 Y 1 A TYR 212 ? OH ? A TYR 218 OH 34 1 Y 1 A GLU 233 ? CG ? A GLU 239 CG 35 1 Y 1 A GLU 233 ? CD ? A GLU 239 CD 36 1 Y 1 A GLU 233 ? OE1 ? A GLU 239 OE1 37 1 Y 1 A GLU 233 ? OE2 ? A GLU 239 OE2 38 1 Y 1 A LYS 240 ? CD ? A LYS 246 CD 39 1 Y 1 A LYS 240 ? CE ? A LYS 246 CE 40 1 Y 1 A LYS 240 ? NZ ? A LYS 246 NZ 41 1 Y 1 A LYS 247 ? CD ? A LYS 253 CD 42 1 Y 1 A LYS 247 ? CE ? A LYS 253 CE 43 1 Y 1 A LYS 247 ? NZ ? A LYS 253 NZ 44 1 Y 1 A GLU 257 ? CG ? A GLU 263 CG 45 1 Y 1 A GLU 257 ? CD ? A GLU 263 CD 46 1 Y 1 A GLU 257 ? OE1 ? A GLU 263 OE1 47 1 Y 1 A GLU 257 ? OE2 ? A GLU 263 OE2 48 1 Y 1 B MET 1 ? CG ? B MET 7 CG 49 1 Y 1 B MET 1 ? SD ? B MET 7 SD 50 1 Y 1 B MET 1 ? CE ? B MET 7 CE 51 1 Y 1 B LYS 3 ? CE ? B LYS 9 CE 52 1 Y 1 B LYS 3 ? NZ ? B LYS 9 NZ 53 1 Y 1 B GLU 65 ? CG ? B GLU 71 CG 54 1 Y 1 B GLU 65 ? CD ? B GLU 71 CD 55 1 Y 1 B GLU 65 ? OE1 ? B GLU 71 OE1 56 1 Y 1 B GLU 65 ? OE2 ? B GLU 71 OE2 57 1 Y 1 B GLU 75 ? CG ? B GLU 81 CG 58 1 Y 1 B GLU 75 ? CD ? B GLU 81 CD 59 1 Y 1 B GLU 75 ? OE1 ? B GLU 81 OE1 60 1 Y 1 B GLU 75 ? OE2 ? B GLU 81 OE2 61 1 Y 1 B LYS 88 ? CG ? B LYS 94 CG 62 1 Y 1 B LYS 88 ? CD ? B LYS 94 CD 63 1 Y 1 B LYS 88 ? CE ? B LYS 94 CE 64 1 Y 1 B LYS 88 ? NZ ? B LYS 94 NZ 65 1 Y 1 B GLU 114 ? CG ? B GLU 120 CG 66 1 Y 1 B GLU 114 ? CD ? B GLU 120 CD 67 1 Y 1 B GLU 114 ? OE1 ? B GLU 120 OE1 68 1 Y 1 B GLU 114 ? OE2 ? B GLU 120 OE2 69 1 Y 1 B LYS 125 ? CG ? B LYS 131 CG 70 1 Y 1 B LYS 125 ? CD ? B LYS 131 CD 71 1 Y 1 B LYS 125 ? CE ? B LYS 131 CE 72 1 Y 1 B LYS 125 ? NZ ? B LYS 131 NZ 73 1 Y 1 B SER 128 ? OG ? B SER 134 OG 74 1 Y 1 B LYS 131 ? CG ? B LYS 137 CG 75 1 Y 1 B LYS 131 ? CD ? B LYS 137 CD 76 1 Y 1 B LYS 131 ? CE ? B LYS 137 CE 77 1 Y 1 B LYS 131 ? NZ ? B LYS 137 NZ 78 1 Y 1 B LYS 139 ? CG ? B LYS 145 CG 79 1 Y 1 B LYS 139 ? CD ? B LYS 145 CD 80 1 Y 1 B LYS 139 ? CE ? B LYS 145 CE 81 1 Y 1 B LYS 139 ? NZ ? B LYS 145 NZ 82 1 Y 1 B PHE 175 ? CG ? B PHE 181 CG 83 1 Y 1 B PHE 175 ? CD1 ? B PHE 181 CD1 84 1 Y 1 B PHE 175 ? CD2 ? B PHE 181 CD2 85 1 Y 1 B PHE 175 ? CE1 ? B PHE 181 CE1 86 1 Y 1 B PHE 175 ? CE2 ? B PHE 181 CE2 87 1 Y 1 B PHE 175 ? CZ ? B PHE 181 CZ 88 1 Y 1 B GLU 176 ? CG ? B GLU 182 CG 89 1 Y 1 B GLU 176 ? CD ? B GLU 182 CD 90 1 Y 1 B GLU 176 ? OE1 ? B GLU 182 OE1 91 1 Y 1 B GLU 176 ? OE2 ? B GLU 182 OE2 92 1 Y 1 B LYS 204 ? CG ? B LYS 210 CG 93 1 Y 1 B LYS 204 ? CD ? B LYS 210 CD 94 1 Y 1 B LYS 204 ? CE ? B LYS 210 CE 95 1 Y 1 B LYS 204 ? NZ ? B LYS 210 NZ 96 1 Y 1 B LYS 206 ? CG ? B LYS 212 CG 97 1 Y 1 B LYS 206 ? CD ? B LYS 212 CD 98 1 Y 1 B LYS 206 ? CE ? B LYS 212 CE 99 1 Y 1 B LYS 206 ? NZ ? B LYS 212 NZ 100 1 Y 1 B ASN 210 ? CG ? B ASN 216 CG 101 1 Y 1 B ASN 210 ? OD1 ? B ASN 216 OD1 102 1 Y 1 B ASN 210 ? ND2 ? B ASN 216 ND2 103 1 Y 1 B TYR 212 ? CG ? B TYR 218 CG 104 1 Y 1 B TYR 212 ? CD1 ? B TYR 218 CD1 105 1 Y 1 B TYR 212 ? CD2 ? B TYR 218 CD2 106 1 Y 1 B TYR 212 ? CE1 ? B TYR 218 CE1 107 1 Y 1 B TYR 212 ? CE2 ? B TYR 218 CE2 108 1 Y 1 B TYR 212 ? CZ ? B TYR 218 CZ 109 1 Y 1 B TYR 212 ? OH ? B TYR 218 OH 110 1 Y 1 B GLU 231 ? CG ? B GLU 237 CG 111 1 Y 1 B GLU 231 ? CD ? B GLU 237 CD 112 1 Y 1 B GLU 231 ? OE1 ? B GLU 237 OE1 113 1 Y 1 B GLU 231 ? OE2 ? B GLU 237 OE2 114 1 Y 1 B LYS 247 ? CG ? B LYS 253 CG 115 1 Y 1 B LYS 247 ? CD ? B LYS 253 CD 116 1 Y 1 B LYS 247 ? CE ? B LYS 253 CE 117 1 Y 1 B LYS 247 ? NZ ? B LYS 253 NZ 118 1 Y 1 B LYS 253 ? CD ? B LYS 259 CD 119 1 Y 1 B LYS 253 ? CE ? B LYS 259 CE 120 1 Y 1 B LYS 253 ? NZ ? B LYS 259 NZ 121 1 Y 1 B LYS 256 ? CG ? B LYS 262 CG 122 1 Y 1 B LYS 256 ? CD ? B LYS 262 CD 123 1 Y 1 B LYS 256 ? CE ? B LYS 262 CE 124 1 Y 1 B LYS 256 ? NZ ? B LYS 262 NZ 125 1 Y 1 B GLU 257 ? CG ? B GLU 263 CG 126 1 Y 1 B GLU 257 ? CD ? B GLU 263 CD 127 1 Y 1 B GLU 257 ? OE1 ? B GLU 263 OE1 128 1 Y 1 B GLU 257 ? OE2 ? B GLU 263 OE2 129 1 Y 1 C MET 1 ? CG ? C MET 7 CG 130 1 Y 1 C MET 1 ? SD ? C MET 7 SD 131 1 Y 1 C MET 1 ? CE ? C MET 7 CE 132 1 Y 1 C SER 15 ? OG ? C SER 21 OG 133 1 Y 1 C GLU 16 ? CG ? C GLU 22 CG 134 1 Y 1 C GLU 16 ? CD ? C GLU 22 CD 135 1 Y 1 C GLU 16 ? OE1 ? C GLU 22 OE1 136 1 Y 1 C GLU 16 ? OE2 ? C GLU 22 OE2 137 1 Y 1 C LYS 69 ? CD ? C LYS 75 CD 138 1 Y 1 C LYS 69 ? CE ? C LYS 75 CE 139 1 Y 1 C LYS 69 ? NZ ? C LYS 75 NZ 140 1 Y 1 C GLU 75 ? CG ? C GLU 81 CG 141 1 Y 1 C GLU 75 ? CD ? C GLU 81 CD 142 1 Y 1 C GLU 75 ? OE1 ? C GLU 81 OE1 143 1 Y 1 C GLU 75 ? OE2 ? C GLU 81 OE2 144 1 Y 1 C LYS 88 ? CG ? C LYS 94 CG 145 1 Y 1 C LYS 88 ? CD ? C LYS 94 CD 146 1 Y 1 C LYS 88 ? CE ? C LYS 94 CE 147 1 Y 1 C LYS 88 ? NZ ? C LYS 94 NZ 148 1 Y 1 C LYS 125 ? CG ? C LYS 131 CG 149 1 Y 1 C LYS 125 ? CD ? C LYS 131 CD 150 1 Y 1 C LYS 125 ? CE ? C LYS 131 CE 151 1 Y 1 C LYS 125 ? NZ ? C LYS 131 NZ 152 1 Y 1 C GLU 129 ? CG ? C GLU 135 CG 153 1 Y 1 C GLU 129 ? CD ? C GLU 135 CD 154 1 Y 1 C GLU 129 ? OE1 ? C GLU 135 OE1 155 1 Y 1 C GLU 129 ? OE2 ? C GLU 135 OE2 156 1 Y 1 C LYS 139 ? CG ? C LYS 145 CG 157 1 Y 1 C LYS 139 ? CD ? C LYS 145 CD 158 1 Y 1 C LYS 139 ? CE ? C LYS 145 CE 159 1 Y 1 C LYS 139 ? NZ ? C LYS 145 NZ 160 1 Y 1 C GLU 176 ? CG ? C GLU 182 CG 161 1 Y 1 C GLU 176 ? CD ? C GLU 182 CD 162 1 Y 1 C GLU 176 ? OE1 ? C GLU 182 OE1 163 1 Y 1 C GLU 176 ? OE2 ? C GLU 182 OE2 164 1 Y 1 C LYS 204 ? CG ? C LYS 210 CG 165 1 Y 1 C LYS 204 ? CD ? C LYS 210 CD 166 1 Y 1 C LYS 204 ? CE ? C LYS 210 CE 167 1 Y 1 C LYS 204 ? NZ ? C LYS 210 NZ 168 1 Y 1 C LYS 206 ? CG ? C LYS 212 CG 169 1 Y 1 C LYS 206 ? CD ? C LYS 212 CD 170 1 Y 1 C LYS 206 ? CE ? C LYS 212 CE 171 1 Y 1 C LYS 206 ? NZ ? C LYS 212 NZ 172 1 Y 1 C LYS 240 ? CG ? C LYS 246 CG 173 1 Y 1 C LYS 240 ? CD ? C LYS 246 CD 174 1 Y 1 C LYS 240 ? CE ? C LYS 246 CE 175 1 Y 1 C LYS 240 ? NZ ? C LYS 246 NZ 176 1 Y 1 C LYS 253 ? CD ? C LYS 259 CD 177 1 Y 1 C LYS 253 ? CE ? C LYS 259 CE 178 1 Y 1 C LYS 253 ? NZ ? C LYS 259 NZ 179 1 Y 1 C LYS 256 ? CG ? C LYS 262 CG 180 1 Y 1 C LYS 256 ? CD ? C LYS 262 CD 181 1 Y 1 C LYS 256 ? CE ? C LYS 262 CE 182 1 Y 1 C LYS 256 ? NZ ? C LYS 262 NZ 183 1 Y 1 C PHE 258 ? CG ? C PHE 264 CG 184 1 Y 1 C PHE 258 ? CD1 ? C PHE 264 CD1 185 1 Y 1 C PHE 258 ? CD2 ? C PHE 264 CD2 186 1 Y 1 C PHE 258 ? CE1 ? C PHE 264 CE1 187 1 Y 1 C PHE 258 ? CE2 ? C PHE 264 CE2 188 1 Y 1 C PHE 258 ? CZ ? C PHE 264 CZ 189 1 Y 1 D LEU 14 ? CG ? D LEU 20 CG 190 1 Y 1 D LEU 14 ? CD1 ? D LEU 20 CD1 191 1 Y 1 D LEU 14 ? CD2 ? D LEU 20 CD2 192 1 Y 1 D SER 15 ? OG ? D SER 21 OG 193 1 Y 1 D GLU 16 ? CG ? D GLU 22 CG 194 1 Y 1 D GLU 16 ? CD ? D GLU 22 CD 195 1 Y 1 D GLU 16 ? OE1 ? D GLU 22 OE1 196 1 Y 1 D GLU 16 ? OE2 ? D GLU 22 OE2 197 1 Y 1 D LYS 53 ? CG ? D LYS 59 CG 198 1 Y 1 D LYS 53 ? CD ? D LYS 59 CD 199 1 Y 1 D LYS 53 ? CE ? D LYS 59 CE 200 1 Y 1 D LYS 53 ? NZ ? D LYS 59 NZ 201 1 Y 1 D GLU 58 ? CG ? D GLU 64 CG 202 1 Y 1 D GLU 58 ? CD ? D GLU 64 CD 203 1 Y 1 D GLU 58 ? OE1 ? D GLU 64 OE1 204 1 Y 1 D GLU 58 ? OE2 ? D GLU 64 OE2 205 1 Y 1 D GLU 65 ? CG ? D GLU 71 CG 206 1 Y 1 D GLU 65 ? CD ? D GLU 71 CD 207 1 Y 1 D GLU 65 ? OE1 ? D GLU 71 OE1 208 1 Y 1 D GLU 65 ? OE2 ? D GLU 71 OE2 209 1 Y 1 D LYS 69 ? CG ? D LYS 75 CG 210 1 Y 1 D LYS 69 ? CD ? D LYS 75 CD 211 1 Y 1 D LYS 69 ? CE ? D LYS 75 CE 212 1 Y 1 D LYS 69 ? NZ ? D LYS 75 NZ 213 1 Y 1 D GLU 75 ? CG ? D GLU 81 CG 214 1 Y 1 D GLU 75 ? CD ? D GLU 81 CD 215 1 Y 1 D GLU 75 ? OE1 ? D GLU 81 OE1 216 1 Y 1 D GLU 75 ? OE2 ? D GLU 81 OE2 217 1 Y 1 D LYS 88 ? CG ? D LYS 94 CG 218 1 Y 1 D LYS 88 ? CD ? D LYS 94 CD 219 1 Y 1 D LYS 88 ? CE ? D LYS 94 CE 220 1 Y 1 D LYS 88 ? NZ ? D LYS 94 NZ 221 1 Y 1 D GLU 129 ? CG ? D GLU 135 CG 222 1 Y 1 D GLU 129 ? CD ? D GLU 135 CD 223 1 Y 1 D GLU 129 ? OE1 ? D GLU 135 OE1 224 1 Y 1 D GLU 129 ? OE2 ? D GLU 135 OE2 225 1 Y 1 D GLU 176 ? CG ? D GLU 182 CG 226 1 Y 1 D GLU 176 ? CD ? D GLU 182 CD 227 1 Y 1 D GLU 176 ? OE1 ? D GLU 182 OE1 228 1 Y 1 D GLU 176 ? OE2 ? D GLU 182 OE2 229 1 Y 1 D LYS 204 ? CG ? D LYS 210 CG 230 1 Y 1 D LYS 204 ? CD ? D LYS 210 CD 231 1 Y 1 D LYS 204 ? CE ? D LYS 210 CE 232 1 Y 1 D LYS 204 ? NZ ? D LYS 210 NZ 233 1 Y 1 D LYS 206 ? CG ? D LYS 212 CG 234 1 Y 1 D LYS 206 ? CD ? D LYS 212 CD 235 1 Y 1 D LYS 206 ? CE ? D LYS 212 CE 236 1 Y 1 D LYS 206 ? NZ ? D LYS 212 NZ 237 1 Y 1 D GLU 208 ? CG ? D GLU 214 CG 238 1 Y 1 D GLU 208 ? CD ? D GLU 214 CD 239 1 Y 1 D GLU 208 ? OE1 ? D GLU 214 OE1 240 1 Y 1 D GLU 208 ? OE2 ? D GLU 214 OE2 241 1 Y 1 D ASN 210 ? CG ? D ASN 216 CG 242 1 Y 1 D ASN 210 ? OD1 ? D ASN 216 OD1 243 1 Y 1 D ASN 210 ? ND2 ? D ASN 216 ND2 244 1 Y 1 D TYR 212 ? CG ? D TYR 218 CG 245 1 Y 1 D TYR 212 ? CD1 ? D TYR 218 CD1 246 1 Y 1 D TYR 212 ? CD2 ? D TYR 218 CD2 247 1 Y 1 D TYR 212 ? CE1 ? D TYR 218 CE1 248 1 Y 1 D TYR 212 ? CE2 ? D TYR 218 CE2 249 1 Y 1 D TYR 212 ? CZ ? D TYR 218 CZ 250 1 Y 1 D TYR 212 ? OH ? D TYR 218 OH 251 1 Y 1 D LYS 240 ? CD ? D LYS 246 CD 252 1 Y 1 D LYS 240 ? CE ? D LYS 246 CE 253 1 Y 1 D LYS 240 ? NZ ? D LYS 246 NZ 254 1 Y 1 D LYS 256 ? CG ? D LYS 262 CG 255 1 Y 1 D LYS 256 ? CD ? D LYS 262 CD 256 1 Y 1 D LYS 256 ? CE ? D LYS 262 CE 257 1 Y 1 D LYS 256 ? NZ ? D LYS 262 NZ 258 1 Y 1 D GLU 257 ? CG ? D GLU 263 CG 259 1 Y 1 D GLU 257 ? CD ? D GLU 263 CD 260 1 Y 1 D GLU 257 ? OE1 ? D GLU 263 OE1 261 1 Y 1 D GLU 257 ? OE2 ? D GLU 263 OE2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.15.2_3472 ? 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . ? 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . ? 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . ? 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 94.059 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 9WPO _cell.details ? _cell.formula_units_Z ? _cell.length_a 50.706 _cell.length_a_esd ? _cell.length_b 152.019 _cell.length_b_esd ? _cell.length_c 74.365 _cell.length_c_esd ? _cell.volume 571788.073 _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9WPO _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall 'P 2yb' _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9WPO _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.31 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 46.66 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'PEG 8000, NaCl, imidazole' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 291 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER2 S 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2024-12-24 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97933 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PAL/PLS BEAMLINE 7A (6B, 6C1)' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97933 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline '7A (6B, 6C1)' _diffrn_source.pdbx_synchrotron_site PAL/PLS # _reflns.B_iso_Wilson_estimate 32.53 _reflns.entry_id 9WPO _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.3 _reflns.d_resolution_low 30 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 49466 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 97.7 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 2.9 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 9.6 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.987 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.30 _reflns_shell.d_res_low 2.34 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.1 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 2262 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 2.4 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.618 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 89.8 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 38.64 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9WPO _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.30 _refine.ls_d_res_low 28.95 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 48673 _refine.ls_number_reflns_R_free 2325 _refine.ls_number_reflns_R_work 46348 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.86 _refine.ls_percent_reflns_R_free 4.78 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2093 _refine.ls_R_factor_R_free 0.2460 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2075 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 9WPN _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 26.4601 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3163 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.30 _refine_hist.d_res_low 28.95 _refine_hist.number_atoms_solvent 110 _refine_hist.number_atoms_total 8356 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 8246 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0042 ? 8434 ? f_bond_d ? ? ? 'X-RAY DIFFRACTION' ? 0.7402 ? 11392 ? f_angle_d ? ? ? 'X-RAY DIFFRACTION' ? 0.0475 ? 1275 ? f_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.0050 ? 1418 ? f_plane_restr ? ? ? 'X-RAY DIFFRACTION' ? 18.4110 ? 3081 ? f_dihedral_angle_d ? ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.30 2.35 . . 109 2560 92.45 . . . . 0.2794 . . . . . . . . . . . . . . . 0.3643 'X-RAY DIFFRACTION' 2.35 2.40 . . 107 2675 94.72 . . . . 0.2703 . . . . . . . . . . . . . . . 0.3002 'X-RAY DIFFRACTION' 2.40 2.45 . . 136 2659 96.11 . . . . 0.2629 . . . . . . . . . . . . . . . 0.3014 'X-RAY DIFFRACTION' 2.45 2.52 . . 116 2701 96.87 . . . . 0.2642 . . . . . . . . . . . . . . . 0.3141 'X-RAY DIFFRACTION' 2.52 2.58 . . 130 2699 96.42 . . . . 0.2513 . . . . . . . . . . . . . . . 0.3313 'X-RAY DIFFRACTION' 2.58 2.66 . . 154 2733 97.90 . . . . 0.2427 . . . . . . . . . . . . . . . 0.2949 'X-RAY DIFFRACTION' 2.66 2.74 . . 125 2711 98.51 . . . . 0.2322 . . . . . . . . . . . . . . . 0.2441 'X-RAY DIFFRACTION' 2.74 2.84 . . 159 2731 98.70 . . . . 0.2275 . . . . . . . . . . . . . . . 0.2803 'X-RAY DIFFRACTION' 2.84 2.96 . . 138 2750 98.50 . . . . 0.2272 . . . . . . . . . . . . . . . 0.2967 'X-RAY DIFFRACTION' 2.96 3.09 . . 147 2753 99.01 . . . . 0.2223 . . . . . . . . . . . . . . . 0.2721 'X-RAY DIFFRACTION' 3.09 3.25 . . 131 2747 99.31 . . . . 0.2216 . . . . . . . . . . . . . . . 0.2762 'X-RAY DIFFRACTION' 3.25 3.46 . . 140 2762 99.25 . . . . 0.2022 . . . . . . . . . . . . . . . 0.2282 'X-RAY DIFFRACTION' 3.46 3.72 . . 142 2769 98.64 . . . . 0.1961 . . . . . . . . . . . . . . . 0.2140 'X-RAY DIFFRACTION' 3.72 4.10 . . 161 2713 98.90 . . . . 0.1831 . . . . . . . . . . . . . . . 0.2339 'X-RAY DIFFRACTION' 4.10 4.69 . . 143 2802 99.53 . . . . 0.1662 . . . . . . . . . . . . . . . 0.2069 'X-RAY DIFFRACTION' 4.69 5.90 . . 163 2738 99.15 . . . . 0.1842 . . . . . . . . . . . . . . . 0.2244 'X-RAY DIFFRACTION' 5.90 28.95 . . 124 2845 99.56 . . . . 0.1903 . . . . . . . . . . . . . . . 0.2027 # loop_ _struct_ncs_dom.id _struct_ncs_dom.pdbx_ens_id _struct_ncs_dom.details 1 1 ? 2 1 ? 3 1 ? 4 1 ? # loop_ _struct_ncs_dom_lim.pdbx_ens_id _struct_ncs_dom_lim.dom_id _struct_ncs_dom_lim.pdbx_component_id _struct_ncs_dom_lim.beg_label_asym_id _struct_ncs_dom_lim.beg_label_comp_id _struct_ncs_dom_lim.beg_label_seq_id _struct_ncs_dom_lim.beg_label_alt_id _struct_ncs_dom_lim.end_label_asym_id _struct_ncs_dom_lim.end_label_comp_id _struct_ncs_dom_lim.end_label_seq_id _struct_ncs_dom_lim.end_label_alt_id _struct_ncs_dom_lim.beg_auth_asym_id _struct_ncs_dom_lim.beg_auth_comp_id _struct_ncs_dom_lim.beg_auth_seq_id _struct_ncs_dom_lim.end_auth_asym_id _struct_ncs_dom_lim.end_auth_comp_id _struct_ncs_dom_lim.end_auth_seq_id _struct_ncs_dom_lim.pdbx_refine_code _struct_ncs_dom_lim.selection_details 1 1 1 A SER 8 . A LEU 20 . A SER 2 A LEU 14 ? ;(chain 'A' and (resid 2 or (resid 3 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 4 through 13 or (resid 14 through 15 and (name N or name CA or name C or name O or name CB )) or resid 17 through 57 or (resid 58 and (name N or name CA or name C or name O or name CB )) or resid 59 through 68 or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 87 or resid 89 through 113 or resid 115 through 124 or (resid 125 and (name N or name CA or name C or name O or name CB )) or resid 126 through 127 or (resid 128 through 129 and (name N or name CA or name C or name O or name CB )) or resid 130 or resid 132 through 138 or (resid 139 and (name N or name CA or name C or name O or name CB )) or resid 140 through 174 or resid 176 through 203 or (resid 204 and (name N or name CA or name C or name O or name CB )) or resid 205 through 206 or (resid 208 and (name N or name CA or name C or name O or name CB )) or resid 209 or (resid 210 and (name N or name CA or name C or name O or name CB )) or resid 211 through 230 or (resid 231 and (name N or name CA or name C or name O or name CB )) or resid 232 through 239 or (resid 240 and (name N or name CA or name C or name O or name CB )) or resid 241 through 246 or (resid 247 and (name N or name CA or name C or name O or name CB )) or resid 248 through 252 or (resid 253 and (name N or name CA or name C or name O or name CB or name CG )) or resid 254 through 255 or (resid 256 through 258 and (name N or name CA or name C or name O or name CB )))) ; 1 1 2 A SER 23 . A GLU 92 . A SER 17 A GLU 86 ? ;(chain 'A' and (resid 2 or (resid 3 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 4 through 13 or (resid 14 through 15 and (name N or name CA or name C or name O or name CB )) or resid 17 through 57 or (resid 58 and (name N or name CA or name C or name O or name CB )) or resid 59 through 68 or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 87 or resid 89 through 113 or resid 115 through 124 or (resid 125 and (name N or name CA or name C or name O or name CB )) or resid 126 through 127 or (resid 128 through 129 and (name N or name CA or name C or name O or name CB )) or resid 130 or resid 132 through 138 or (resid 139 and (name N or name CA or name C or name O or name CB )) or resid 140 through 174 or resid 176 through 203 or (resid 204 and (name N or name CA or name C or name O or name CB )) or resid 205 through 206 or (resid 208 and (name N or name CA or name C or name O or name CB )) or resid 209 or (resid 210 and (name N or name CA or name C or name O or name CB )) or resid 211 through 230 or (resid 231 and (name N or name CA or name C or name O or name CB )) or resid 232 through 239 or (resid 240 and (name N or name CA or name C or name O or name CB )) or resid 241 through 246 or (resid 247 and (name N or name CA or name C or name O or name CB )) or resid 248 through 252 or (resid 253 and (name N or name CA or name C or name O or name CB or name CG )) or resid 254 through 255 or (resid 256 through 258 and (name N or name CA or name C or name O or name CB )))) ; 1 1 3 A SER 95 . A TYR 119 . A SER 89 A TYR 113 ? ;(chain 'A' and (resid 2 or (resid 3 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 4 through 13 or (resid 14 through 15 and (name N or name CA or name C or name O or name CB )) or resid 17 through 57 or (resid 58 and (name N or name CA or name C or name O or name CB )) or resid 59 through 68 or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 87 or resid 89 through 113 or resid 115 through 124 or (resid 125 and (name N or name CA or name C or name O or name CB )) or resid 126 through 127 or (resid 128 through 129 and (name N or name CA or name C or name O or name CB )) or resid 130 or resid 132 through 138 or (resid 139 and (name N or name CA or name C or name O or name CB )) or resid 140 through 174 or resid 176 through 203 or (resid 204 and (name N or name CA or name C or name O or name CB )) or resid 205 through 206 or (resid 208 and (name N or name CA or name C or name O or name CB )) or resid 209 or (resid 210 and (name N or name CA or name C or name O or name CB )) or resid 211 through 230 or (resid 231 and (name N or name CA or name C or name O or name CB )) or resid 232 through 239 or (resid 240 and (name N or name CA or name C or name O or name CB )) or resid 241 through 246 or (resid 247 and (name N or name CA or name C or name O or name CB )) or resid 248 through 252 or (resid 253 and (name N or name CA or name C or name O or name CB or name CG )) or resid 254 through 255 or (resid 256 through 258 and (name N or name CA or name C or name O or name CB )))) ; 1 1 4 A HIS 121 . A LEU 136 . A HIS 115 A LEU 130 ? ;(chain 'A' and (resid 2 or (resid 3 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 4 through 13 or (resid 14 through 15 and (name N or name CA or name C or name O or name CB )) or resid 17 through 57 or (resid 58 and (name N or name CA or name C or name O or name CB )) or resid 59 through 68 or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 87 or resid 89 through 113 or resid 115 through 124 or (resid 125 and (name N or name CA or name C or name O or name CB )) or resid 126 through 127 or (resid 128 through 129 and (name N or name CA or name C or name O or name CB )) or resid 130 or resid 132 through 138 or (resid 139 and (name N or name CA or name C or name O or name CB )) or resid 140 through 174 or resid 176 through 203 or (resid 204 and (name N or name CA or name C or name O or name CB )) or resid 205 through 206 or (resid 208 and (name N or name CA or name C or name O or name CB )) or resid 209 or (resid 210 and (name N or name CA or name C or name O or name CB )) or resid 211 through 230 or (resid 231 and (name N or name CA or name C or name O or name CB )) or resid 232 through 239 or (resid 240 and (name N or name CA or name C or name O or name CB )) or resid 241 through 246 or (resid 247 and (name N or name CA or name C or name O or name CB )) or resid 248 through 252 or (resid 253 and (name N or name CA or name C or name O or name CB or name CG )) or resid 254 through 255 or (resid 256 through 258 and (name N or name CA or name C or name O or name CB )))) ; 1 1 5 A ILE 138 . A THR 180 . A ILE 132 A THR 174 ? ;(chain 'A' and (resid 2 or (resid 3 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 4 through 13 or (resid 14 through 15 and (name N or name CA or name C or name O or name CB )) or resid 17 through 57 or (resid 58 and (name N or name CA or name C or name O or name CB )) or resid 59 through 68 or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 87 or resid 89 through 113 or resid 115 through 124 or (resid 125 and (name N or name CA or name C or name O or name CB )) or resid 126 through 127 or (resid 128 through 129 and (name N or name CA or name C or name O or name CB )) or resid 130 or resid 132 through 138 or (resid 139 and (name N or name CA or name C or name O or name CB )) or resid 140 through 174 or resid 176 through 203 or (resid 204 and (name N or name CA or name C or name O or name CB )) or resid 205 through 206 or (resid 208 and (name N or name CA or name C or name O or name CB )) or resid 209 or (resid 210 and (name N or name CA or name C or name O or name CB )) or resid 211 through 230 or (resid 231 and (name N or name CA or name C or name O or name CB )) or resid 232 through 239 or (resid 240 and (name N or name CA or name C or name O or name CB )) or resid 241 through 246 or (resid 247 and (name N or name CA or name C or name O or name CB )) or resid 248 through 252 or (resid 253 and (name N or name CA or name C or name O or name CB or name CG )) or resid 254 through 255 or (resid 256 through 258 and (name N or name CA or name C or name O or name CB )))) ; 1 1 6 A GLU 182 . A THR 211 . A GLU 176 A THR 205 ? ;(chain 'A' and (resid 2 or (resid 3 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 4 through 13 or (resid 14 through 15 and (name N or name CA or name C or name O or name CB )) or resid 17 through 57 or (resid 58 and (name N or name CA or name C or name O or name CB )) or resid 59 through 68 or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 87 or resid 89 through 113 or resid 115 through 124 or (resid 125 and (name N or name CA or name C or name O or name CB )) or resid 126 through 127 or (resid 128 through 129 and (name N or name CA or name C or name O or name CB )) or resid 130 or resid 132 through 138 or (resid 139 and (name N or name CA or name C or name O or name CB )) or resid 140 through 174 or resid 176 through 203 or (resid 204 and (name N or name CA or name C or name O or name CB )) or resid 205 through 206 or (resid 208 and (name N or name CA or name C or name O or name CB )) or resid 209 or (resid 210 and (name N or name CA or name C or name O or name CB )) or resid 211 through 230 or (resid 231 and (name N or name CA or name C or name O or name CB )) or resid 232 through 239 or (resid 240 and (name N or name CA or name C or name O or name CB )) or resid 241 through 246 or (resid 247 and (name N or name CA or name C or name O or name CB )) or resid 248 through 252 or (resid 253 and (name N or name CA or name C or name O or name CB or name CG )) or resid 254 through 255 or (resid 256 through 258 and (name N or name CA or name C or name O or name CB )))) ; 1 1 7 A GLU 214 . A GLU 263 . A GLU 208 A GLU 257 ? ;(chain 'A' and (resid 2 or (resid 3 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 4 through 13 or (resid 14 through 15 and (name N or name CA or name C or name O or name CB )) or resid 17 through 57 or (resid 58 and (name N or name CA or name C or name O or name CB )) or resid 59 through 68 or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 87 or resid 89 through 113 or resid 115 through 124 or (resid 125 and (name N or name CA or name C or name O or name CB )) or resid 126 through 127 or (resid 128 through 129 and (name N or name CA or name C or name O or name CB )) or resid 130 or resid 132 through 138 or (resid 139 and (name N or name CA or name C or name O or name CB )) or resid 140 through 174 or resid 176 through 203 or (resid 204 and (name N or name CA or name C or name O or name CB )) or resid 205 through 206 or (resid 208 and (name N or name CA or name C or name O or name CB )) or resid 209 or (resid 210 and (name N or name CA or name C or name O or name CB )) or resid 211 through 230 or (resid 231 and (name N or name CA or name C or name O or name CB )) or resid 232 through 239 or (resid 240 and (name N or name CA or name C or name O or name CB )) or resid 241 through 246 or (resid 247 and (name N or name CA or name C or name O or name CB )) or resid 248 through 252 or (resid 253 and (name N or name CA or name C or name O or name CB or name CG )) or resid 254 through 255 or (resid 256 through 258 and (name N or name CA or name C or name O or name CB )))) ; 1 2 1 B SER 8 . B LEU 20 . B SER 2 B LEU 14 ? ;(chain 'B' and (resid 2 through 13 or (resid 14 through 15 and (name N or name CA or name C or name O or name CB )) or resid 17 through 52 or (resid 53 and (name N or name CA or name C or name O or name CB )) or resid 54 through 57 or (resid 58 and (name N or name CA or name C or name O or name CB )) or resid 59 through 68 or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 87 or resid 89 through 113 or resid 115 through 128 or (resid 129 and (name N or name CA or name C or name O or name CB )) or resid 130 or resid 132 through 174 or resid 176 through 177 or (resid 178 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 179 through 206 or (resid 208 and (name N or name CA or name C or name O or name CB )) or resid 209 through 232 or (resid 233 and (name N or name CA or name C or name O or name CB )) or resid 234 through 239 or (resid 240 and (name N or name CA or name C or name O or name CB )) or resid 241 through 257 or (resid 258 and (name N or name CA or name C or name O or name CB )))) ; 1 2 2 B SER 23 . B GLU 92 . B SER 17 B GLU 86 ? ;(chain 'B' and (resid 2 through 13 or (resid 14 through 15 and (name N or name CA or name C or name O or name CB )) or resid 17 through 52 or (resid 53 and (name N or name CA or name C or name O or name CB )) or resid 54 through 57 or (resid 58 and (name N or name CA or name C or name O or name CB )) or resid 59 through 68 or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 87 or resid 89 through 113 or resid 115 through 128 or (resid 129 and (name N or name CA or name C or name O or name CB )) or resid 130 or resid 132 through 174 or resid 176 through 177 or (resid 178 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 179 through 206 or (resid 208 and (name N or name CA or name C or name O or name CB )) or resid 209 through 232 or (resid 233 and (name N or name CA or name C or name O or name CB )) or resid 234 through 239 or (resid 240 and (name N or name CA or name C or name O or name CB )) or resid 241 through 257 or (resid 258 and (name N or name CA or name C or name O or name CB )))) ; 1 2 3 B SER 95 . B TYR 119 . B SER 89 B TYR 113 ? ;(chain 'B' and (resid 2 through 13 or (resid 14 through 15 and (name N or name CA or name C or name O or name CB )) or resid 17 through 52 or (resid 53 and (name N or name CA or name C or name O or name CB )) or resid 54 through 57 or (resid 58 and (name N or name CA or name C or name O or name CB )) or resid 59 through 68 or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 87 or resid 89 through 113 or resid 115 through 128 or (resid 129 and (name N or name CA or name C or name O or name CB )) or resid 130 or resid 132 through 174 or resid 176 through 177 or (resid 178 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 179 through 206 or (resid 208 and (name N or name CA or name C or name O or name CB )) or resid 209 through 232 or (resid 233 and (name N or name CA or name C or name O or name CB )) or resid 234 through 239 or (resid 240 and (name N or name CA or name C or name O or name CB )) or resid 241 through 257 or (resid 258 and (name N or name CA or name C or name O or name CB )))) ; 1 2 4 B HIS 121 . B LEU 136 . B HIS 115 B LEU 130 ? ;(chain 'B' and (resid 2 through 13 or (resid 14 through 15 and (name N or name CA or name C or name O or name CB )) or resid 17 through 52 or (resid 53 and (name N or name CA or name C or name O or name CB )) or resid 54 through 57 or (resid 58 and (name N or name CA or name C or name O or name CB )) or resid 59 through 68 or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 87 or resid 89 through 113 or resid 115 through 128 or (resid 129 and (name N or name CA or name C or name O or name CB )) or resid 130 or resid 132 through 174 or resid 176 through 177 or (resid 178 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 179 through 206 or (resid 208 and (name N or name CA or name C or name O or name CB )) or resid 209 through 232 or (resid 233 and (name N or name CA or name C or name O or name CB )) or resid 234 through 239 or (resid 240 and (name N or name CA or name C or name O or name CB )) or resid 241 through 257 or (resid 258 and (name N or name CA or name C or name O or name CB )))) ; 1 2 5 B ILE 138 . B THR 180 . B ILE 132 B THR 174 ? ;(chain 'B' and (resid 2 through 13 or (resid 14 through 15 and (name N or name CA or name C or name O or name CB )) or resid 17 through 52 or (resid 53 and (name N or name CA or name C or name O or name CB )) or resid 54 through 57 or (resid 58 and (name N or name CA or name C or name O or name CB )) or resid 59 through 68 or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 87 or resid 89 through 113 or resid 115 through 128 or (resid 129 and (name N or name CA or name C or name O or name CB )) or resid 130 or resid 132 through 174 or resid 176 through 177 or (resid 178 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 179 through 206 or (resid 208 and (name N or name CA or name C or name O or name CB )) or resid 209 through 232 or (resid 233 and (name N or name CA or name C or name O or name CB )) or resid 234 through 239 or (resid 240 and (name N or name CA or name C or name O or name CB )) or resid 241 through 257 or (resid 258 and (name N or name CA or name C or name O or name CB )))) ; 1 2 6 B GLU 182 . B THR 211 . B GLU 176 B THR 205 ? ;(chain 'B' and (resid 2 through 13 or (resid 14 through 15 and (name N or name CA or name C or name O or name CB )) or resid 17 through 52 or (resid 53 and (name N or name CA or name C or name O or name CB )) or resid 54 through 57 or (resid 58 and (name N or name CA or name C or name O or name CB )) or resid 59 through 68 or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 87 or resid 89 through 113 or resid 115 through 128 or (resid 129 and (name N or name CA or name C or name O or name CB )) or resid 130 or resid 132 through 174 or resid 176 through 177 or (resid 178 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 179 through 206 or (resid 208 and (name N or name CA or name C or name O or name CB )) or resid 209 through 232 or (resid 233 and (name N or name CA or name C or name O or name CB )) or resid 234 through 239 or (resid 240 and (name N or name CA or name C or name O or name CB )) or resid 241 through 257 or (resid 258 and (name N or name CA or name C or name O or name CB )))) ; 1 2 7 B GLU 214 . B GLU 263 . B GLU 208 B GLU 257 ? ;(chain 'B' and (resid 2 through 13 or (resid 14 through 15 and (name N or name CA or name C or name O or name CB )) or resid 17 through 52 or (resid 53 and (name N or name CA or name C or name O or name CB )) or resid 54 through 57 or (resid 58 and (name N or name CA or name C or name O or name CB )) or resid 59 through 68 or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 87 or resid 89 through 113 or resid 115 through 128 or (resid 129 and (name N or name CA or name C or name O or name CB )) or resid 130 or resid 132 through 174 or resid 176 through 177 or (resid 178 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 179 through 206 or (resid 208 and (name N or name CA or name C or name O or name CB )) or resid 209 through 232 or (resid 233 and (name N or name CA or name C or name O or name CB )) or resid 234 through 239 or (resid 240 and (name N or name CA or name C or name O or name CB )) or resid 241 through 257 or (resid 258 and (name N or name CA or name C or name O or name CB )))) ; 1 3 1 C SER 8 . C LEU 20 . C SER 2 C LEU 14 ? ;(chain 'C' and (resid 2 or (resid 3 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 4 through 13 or (resid 14 through 15 and (name N or name CA or name C or name O or name CB )) or resid 17 through 52 or (resid 53 and (name N or name CA or name C or name O or name CB )) or resid 54 through 57 or (resid 58 and (name N or name CA or name C or name O or name CB )) or resid 59 through 64 or (resid 65 and (name N or name CA or name C or name O or name CB )) or resid 66 through 68 or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 87 or resid 89 through 113 or resid 115 through 127 or (resid 128 through 129 and (name N or name CA or name C or name O or name CB )) or resid 130 or resid 132 through 174 or resid 176 through 177 or (resid 178 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 179 through 206 or (resid 208 and (name N or name CA or name C or name O or name CB )) or resid 209 or (resid 210 and (name N or name CA or name C or name O or name CB )) or resid 211 or (resid 212 and (name N or name CA or name C or name O or name CB )) or resid 213 through 230 or (resid 231 and (name N or name CA or name C or name O or name CB )) or resid 232 or (resid 233 and (name N or name CA or name C or name O or name CB )) or resid 234 through 246 or (resid 247 and (name N or name CA or name C or name O or name CB )) or resid 248 through 256 or (resid 257 through 258 and (name N or name CA or name C or name O or name CB )))) ; 1 3 2 C SER 23 . C GLU 92 . C SER 17 C GLU 86 ? ;(chain 'C' and (resid 2 or (resid 3 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 4 through 13 or (resid 14 through 15 and (name N or name CA or name C or name O or name CB )) or resid 17 through 52 or (resid 53 and (name N or name CA or name C or name O or name CB )) or resid 54 through 57 or (resid 58 and (name N or name CA or name C or name O or name CB )) or resid 59 through 64 or (resid 65 and (name N or name CA or name C or name O or name CB )) or resid 66 through 68 or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 87 or resid 89 through 113 or resid 115 through 127 or (resid 128 through 129 and (name N or name CA or name C or name O or name CB )) or resid 130 or resid 132 through 174 or resid 176 through 177 or (resid 178 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 179 through 206 or (resid 208 and (name N or name CA or name C or name O or name CB )) or resid 209 or (resid 210 and (name N or name CA or name C or name O or name CB )) or resid 211 or (resid 212 and (name N or name CA or name C or name O or name CB )) or resid 213 through 230 or (resid 231 and (name N or name CA or name C or name O or name CB )) or resid 232 or (resid 233 and (name N or name CA or name C or name O or name CB )) or resid 234 through 246 or (resid 247 and (name N or name CA or name C or name O or name CB )) or resid 248 through 256 or (resid 257 through 258 and (name N or name CA or name C or name O or name CB )))) ; 1 3 3 C SER 95 . C TYR 119 . C SER 89 C TYR 113 ? ;(chain 'C' and (resid 2 or (resid 3 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 4 through 13 or (resid 14 through 15 and (name N or name CA or name C or name O or name CB )) or resid 17 through 52 or (resid 53 and (name N or name CA or name C or name O or name CB )) or resid 54 through 57 or (resid 58 and (name N or name CA or name C or name O or name CB )) or resid 59 through 64 or (resid 65 and (name N or name CA or name C or name O or name CB )) or resid 66 through 68 or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 87 or resid 89 through 113 or resid 115 through 127 or (resid 128 through 129 and (name N or name CA or name C or name O or name CB )) or resid 130 or resid 132 through 174 or resid 176 through 177 or (resid 178 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 179 through 206 or (resid 208 and (name N or name CA or name C or name O or name CB )) or resid 209 or (resid 210 and (name N or name CA or name C or name O or name CB )) or resid 211 or (resid 212 and (name N or name CA or name C or name O or name CB )) or resid 213 through 230 or (resid 231 and (name N or name CA or name C or name O or name CB )) or resid 232 or (resid 233 and (name N or name CA or name C or name O or name CB )) or resid 234 through 246 or (resid 247 and (name N or name CA or name C or name O or name CB )) or resid 248 through 256 or (resid 257 through 258 and (name N or name CA or name C or name O or name CB )))) ; 1 3 4 C HIS 121 . C LEU 136 . C HIS 115 C LEU 130 ? ;(chain 'C' and (resid 2 or (resid 3 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 4 through 13 or (resid 14 through 15 and (name N or name CA or name C or name O or name CB )) or resid 17 through 52 or (resid 53 and (name N or name CA or name C or name O or name CB )) or resid 54 through 57 or (resid 58 and (name N or name CA or name C or name O or name CB )) or resid 59 through 64 or (resid 65 and (name N or name CA or name C or name O or name CB )) or resid 66 through 68 or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 87 or resid 89 through 113 or resid 115 through 127 or (resid 128 through 129 and (name N or name CA or name C or name O or name CB )) or resid 130 or resid 132 through 174 or resid 176 through 177 or (resid 178 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 179 through 206 or (resid 208 and (name N or name CA or name C or name O or name CB )) or resid 209 or (resid 210 and (name N or name CA or name C or name O or name CB )) or resid 211 or (resid 212 and (name N or name CA or name C or name O or name CB )) or resid 213 through 230 or (resid 231 and (name N or name CA or name C or name O or name CB )) or resid 232 or (resid 233 and (name N or name CA or name C or name O or name CB )) or resid 234 through 246 or (resid 247 and (name N or name CA or name C or name O or name CB )) or resid 248 through 256 or (resid 257 through 258 and (name N or name CA or name C or name O or name CB )))) ; 1 3 5 C ILE 138 . C THR 180 . C ILE 132 C THR 174 ? ;(chain 'C' and (resid 2 or (resid 3 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 4 through 13 or (resid 14 through 15 and (name N or name CA or name C or name O or name CB )) or resid 17 through 52 or (resid 53 and (name N or name CA or name C or name O or name CB )) or resid 54 through 57 or (resid 58 and (name N or name CA or name C or name O or name CB )) or resid 59 through 64 or (resid 65 and (name N or name CA or name C or name O or name CB )) or resid 66 through 68 or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 87 or resid 89 through 113 or resid 115 through 127 or (resid 128 through 129 and (name N or name CA or name C or name O or name CB )) or resid 130 or resid 132 through 174 or resid 176 through 177 or (resid 178 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 179 through 206 or (resid 208 and (name N or name CA or name C or name O or name CB )) or resid 209 or (resid 210 and (name N or name CA or name C or name O or name CB )) or resid 211 or (resid 212 and (name N or name CA or name C or name O or name CB )) or resid 213 through 230 or (resid 231 and (name N or name CA or name C or name O or name CB )) or resid 232 or (resid 233 and (name N or name CA or name C or name O or name CB )) or resid 234 through 246 or (resid 247 and (name N or name CA or name C or name O or name CB )) or resid 248 through 256 or (resid 257 through 258 and (name N or name CA or name C or name O or name CB )))) ; 1 3 6 C GLU 182 . C THR 211 . C GLU 176 C THR 205 ? ;(chain 'C' and (resid 2 or (resid 3 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 4 through 13 or (resid 14 through 15 and (name N or name CA or name C or name O or name CB )) or resid 17 through 52 or (resid 53 and (name N or name CA or name C or name O or name CB )) or resid 54 through 57 or (resid 58 and (name N or name CA or name C or name O or name CB )) or resid 59 through 64 or (resid 65 and (name N or name CA or name C or name O or name CB )) or resid 66 through 68 or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 87 or resid 89 through 113 or resid 115 through 127 or (resid 128 through 129 and (name N or name CA or name C or name O or name CB )) or resid 130 or resid 132 through 174 or resid 176 through 177 or (resid 178 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 179 through 206 or (resid 208 and (name N or name CA or name C or name O or name CB )) or resid 209 or (resid 210 and (name N or name CA or name C or name O or name CB )) or resid 211 or (resid 212 and (name N or name CA or name C or name O or name CB )) or resid 213 through 230 or (resid 231 and (name N or name CA or name C or name O or name CB )) or resid 232 or (resid 233 and (name N or name CA or name C or name O or name CB )) or resid 234 through 246 or (resid 247 and (name N or name CA or name C or name O or name CB )) or resid 248 through 256 or (resid 257 through 258 and (name N or name CA or name C or name O or name CB )))) ; 1 3 7 C GLU 214 . C GLU 263 . C GLU 208 C GLU 257 ? ;(chain 'C' and (resid 2 or (resid 3 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 4 through 13 or (resid 14 through 15 and (name N or name CA or name C or name O or name CB )) or resid 17 through 52 or (resid 53 and (name N or name CA or name C or name O or name CB )) or resid 54 through 57 or (resid 58 and (name N or name CA or name C or name O or name CB )) or resid 59 through 64 or (resid 65 and (name N or name CA or name C or name O or name CB )) or resid 66 through 68 or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 87 or resid 89 through 113 or resid 115 through 127 or (resid 128 through 129 and (name N or name CA or name C or name O or name CB )) or resid 130 or resid 132 through 174 or resid 176 through 177 or (resid 178 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 179 through 206 or (resid 208 and (name N or name CA or name C or name O or name CB )) or resid 209 or (resid 210 and (name N or name CA or name C or name O or name CB )) or resid 211 or (resid 212 and (name N or name CA or name C or name O or name CB )) or resid 213 through 230 or (resid 231 and (name N or name CA or name C or name O or name CB )) or resid 232 or (resid 233 and (name N or name CA or name C or name O or name CB )) or resid 234 through 246 or (resid 247 and (name N or name CA or name C or name O or name CB )) or resid 248 through 256 or (resid 257 through 258 and (name N or name CA or name C or name O or name CB )))) ; 1 4 1 D SER 8 . D LEU 20 . D SER 2 D LEU 14 ? ;(chain 'D' and (resid 2 or (resid 3 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 4 through 15 or resid 17 through 87 or resid 89 through 113 or resid 115 through 124 or (resid 125 and (name N or name CA or name C or name O or name CB )) or resid 126 through 127 or (resid 128 through 129 and (name N or name CA or name C or name O or name CB )) or resid 130 or resid 132 through 138 or (resid 139 and (name N or name CA or name C or name O or name CB )) or resid 140 through 174 or resid 176 through 177 or (resid 178 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 179 through 206 or resid 208 through 230 or (resid 231 and (name N or name CA or name C or name O or name CB )) or resid 232 or (resid 233 and (name N or name CA or name C or name O or name CB )) or resid 234 through 239 or (resid 240 and (name N or name CA or name C or name O or name CB )) or resid 241 through 246 or (resid 247 and (name N or name CA or name C or name O or name CB )) or resid 248 through 252 or (resid 253 and (name N or name CA or name C or name O or name CB or name CG )) or resid 254 through 257 or (resid 258 and (name N or name CA or name C or name O or name CB )))) ; 1 4 2 D SER 23 . D GLU 92 . D SER 17 D GLU 86 ? ;(chain 'D' and (resid 2 or (resid 3 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 4 through 15 or resid 17 through 87 or resid 89 through 113 or resid 115 through 124 or (resid 125 and (name N or name CA or name C or name O or name CB )) or resid 126 through 127 or (resid 128 through 129 and (name N or name CA or name C or name O or name CB )) or resid 130 or resid 132 through 138 or (resid 139 and (name N or name CA or name C or name O or name CB )) or resid 140 through 174 or resid 176 through 177 or (resid 178 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 179 through 206 or resid 208 through 230 or (resid 231 and (name N or name CA or name C or name O or name CB )) or resid 232 or (resid 233 and (name N or name CA or name C or name O or name CB )) or resid 234 through 239 or (resid 240 and (name N or name CA or name C or name O or name CB )) or resid 241 through 246 or (resid 247 and (name N or name CA or name C or name O or name CB )) or resid 248 through 252 or (resid 253 and (name N or name CA or name C or name O or name CB or name CG )) or resid 254 through 257 or (resid 258 and (name N or name CA or name C or name O or name CB )))) ; 1 4 3 D SER 95 . D TYR 119 . D SER 89 D TYR 113 ? ;(chain 'D' and (resid 2 or (resid 3 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 4 through 15 or resid 17 through 87 or resid 89 through 113 or resid 115 through 124 or (resid 125 and (name N or name CA or name C or name O or name CB )) or resid 126 through 127 or (resid 128 through 129 and (name N or name CA or name C or name O or name CB )) or resid 130 or resid 132 through 138 or (resid 139 and (name N or name CA or name C or name O or name CB )) or resid 140 through 174 or resid 176 through 177 or (resid 178 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 179 through 206 or resid 208 through 230 or (resid 231 and (name N or name CA or name C or name O or name CB )) or resid 232 or (resid 233 and (name N or name CA or name C or name O or name CB )) or resid 234 through 239 or (resid 240 and (name N or name CA or name C or name O or name CB )) or resid 241 through 246 or (resid 247 and (name N or name CA or name C or name O or name CB )) or resid 248 through 252 or (resid 253 and (name N or name CA or name C or name O or name CB or name CG )) or resid 254 through 257 or (resid 258 and (name N or name CA or name C or name O or name CB )))) ; 1 4 4 D HIS 121 . D LEU 136 . D HIS 115 D LEU 130 ? ;(chain 'D' and (resid 2 or (resid 3 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 4 through 15 or resid 17 through 87 or resid 89 through 113 or resid 115 through 124 or (resid 125 and (name N or name CA or name C or name O or name CB )) or resid 126 through 127 or (resid 128 through 129 and (name N or name CA or name C or name O or name CB )) or resid 130 or resid 132 through 138 or (resid 139 and (name N or name CA or name C or name O or name CB )) or resid 140 through 174 or resid 176 through 177 or (resid 178 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 179 through 206 or resid 208 through 230 or (resid 231 and (name N or name CA or name C or name O or name CB )) or resid 232 or (resid 233 and (name N or name CA or name C or name O or name CB )) or resid 234 through 239 or (resid 240 and (name N or name CA or name C or name O or name CB )) or resid 241 through 246 or (resid 247 and (name N or name CA or name C or name O or name CB )) or resid 248 through 252 or (resid 253 and (name N or name CA or name C or name O or name CB or name CG )) or resid 254 through 257 or (resid 258 and (name N or name CA or name C or name O or name CB )))) ; 1 4 5 D ILE 138 . D THR 180 . D ILE 132 D THR 174 ? ;(chain 'D' and (resid 2 or (resid 3 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 4 through 15 or resid 17 through 87 or resid 89 through 113 or resid 115 through 124 or (resid 125 and (name N or name CA or name C or name O or name CB )) or resid 126 through 127 or (resid 128 through 129 and (name N or name CA or name C or name O or name CB )) or resid 130 or resid 132 through 138 or (resid 139 and (name N or name CA or name C or name O or name CB )) or resid 140 through 174 or resid 176 through 177 or (resid 178 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 179 through 206 or resid 208 through 230 or (resid 231 and (name N or name CA or name C or name O or name CB )) or resid 232 or (resid 233 and (name N or name CA or name C or name O or name CB )) or resid 234 through 239 or (resid 240 and (name N or name CA or name C or name O or name CB )) or resid 241 through 246 or (resid 247 and (name N or name CA or name C or name O or name CB )) or resid 248 through 252 or (resid 253 and (name N or name CA or name C or name O or name CB or name CG )) or resid 254 through 257 or (resid 258 and (name N or name CA or name C or name O or name CB )))) ; 1 4 6 D GLU 182 . D THR 211 . D GLU 176 D THR 205 ? ;(chain 'D' and (resid 2 or (resid 3 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 4 through 15 or resid 17 through 87 or resid 89 through 113 or resid 115 through 124 or (resid 125 and (name N or name CA or name C or name O or name CB )) or resid 126 through 127 or (resid 128 through 129 and (name N or name CA or name C or name O or name CB )) or resid 130 or resid 132 through 138 or (resid 139 and (name N or name CA or name C or name O or name CB )) or resid 140 through 174 or resid 176 through 177 or (resid 178 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 179 through 206 or resid 208 through 230 or (resid 231 and (name N or name CA or name C or name O or name CB )) or resid 232 or (resid 233 and (name N or name CA or name C or name O or name CB )) or resid 234 through 239 or (resid 240 and (name N or name CA or name C or name O or name CB )) or resid 241 through 246 or (resid 247 and (name N or name CA or name C or name O or name CB )) or resid 248 through 252 or (resid 253 and (name N or name CA or name C or name O or name CB or name CG )) or resid 254 through 257 or (resid 258 and (name N or name CA or name C or name O or name CB )))) ; 1 4 7 D GLU 214 . D GLU 263 . D GLU 208 D GLU 257 ? ;(chain 'D' and (resid 2 or (resid 3 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 4 through 15 or resid 17 through 87 or resid 89 through 113 or resid 115 through 124 or (resid 125 and (name N or name CA or name C or name O or name CB )) or resid 126 through 127 or (resid 128 through 129 and (name N or name CA or name C or name O or name CB )) or resid 130 or resid 132 through 138 or (resid 139 and (name N or name CA or name C or name O or name CB )) or resid 140 through 174 or resid 176 through 177 or (resid 178 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 179 through 206 or resid 208 through 230 or (resid 231 and (name N or name CA or name C or name O or name CB )) or resid 232 or (resid 233 and (name N or name CA or name C or name O or name CB )) or resid 234 through 239 or (resid 240 and (name N or name CA or name C or name O or name CB )) or resid 241 through 246 or (resid 247 and (name N or name CA or name C or name O or name CB )) or resid 248 through 252 or (resid 253 and (name N or name CA or name C or name O or name CB or name CG )) or resid 254 through 257 or (resid 258 and (name N or name CA or name C or name O or name CB )))) ; # _struct_ncs_ens.id 1 _struct_ncs_ens.details ? # _struct.entry_id 9WPO _struct.title 'Crystal structure of the nitrilase superfamily protein CJ1056C from Campylobacter jejuni in space group P21' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9WPO _struct_keywords.text 'CJ1056C, Campylobacter jejuni, nitrilase, amidase, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 1 ? D N N 1 ? E N N 2 ? F N N 2 ? G N N 2 ? H N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A5T0F3Q1_CAMJU _struct_ref.pdbx_db_accession A0A5T0F3Q1 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSKIAALQFPTLALSESRLDYYLKASKDNGVNLVVLGEYVINSFFTELLHMPKNMIKEQSEAKKESLIKLAKKYELEIIA PYVSVEAKSYKKLCLKVTPNGVKSYEQQILMPYEHWNEEKFFSNKTPSELKIFTFNYEKLKCALLFGFETHFDIFWQQIM AKKIDLVIVPSACTFESKQRWEELLKTRAFLNSTSILRVNRIGKTKDEWNFYGDTLLINAFGEIESKLGSEEEMLIIEPK KSDEARKLWGFDKIIKEFKN ; _struct_ref.pdbx_align_begin 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 9WPO A 7 ? 266 ? A0A5T0F3Q1 1 ? 260 ? 1 260 2 1 9WPO B 7 ? 266 ? A0A5T0F3Q1 1 ? 260 ? 1 260 3 1 9WPO C 7 ? 266 ? A0A5T0F3Q1 1 ? 260 ? 1 260 4 1 9WPO D 7 ? 266 ? A0A5T0F3Q1 1 ? 260 ? 1 260 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9WPO GLY A 1 ? UNP A0A5T0F3Q1 ? ? 'expression tag' -5 1 1 9WPO SER A 2 ? UNP A0A5T0F3Q1 ? ? 'expression tag' -4 2 1 9WPO ALA A 3 ? UNP A0A5T0F3Q1 ? ? 'expression tag' -3 3 1 9WPO LYS A 4 ? UNP A0A5T0F3Q1 ? ? 'expression tag' -2 4 1 9WPO ASP A 5 ? UNP A0A5T0F3Q1 ? ? 'expression tag' -1 5 1 9WPO PRO A 6 ? UNP A0A5T0F3Q1 ? ? 'expression tag' 0 6 1 9WPO PHE A 223 ? UNP A0A5T0F3Q1 LEU 217 conflict 217 7 2 9WPO GLY B 1 ? UNP A0A5T0F3Q1 ? ? 'expression tag' -5 8 2 9WPO SER B 2 ? UNP A0A5T0F3Q1 ? ? 'expression tag' -4 9 2 9WPO ALA B 3 ? UNP A0A5T0F3Q1 ? ? 'expression tag' -3 10 2 9WPO LYS B 4 ? UNP A0A5T0F3Q1 ? ? 'expression tag' -2 11 2 9WPO ASP B 5 ? UNP A0A5T0F3Q1 ? ? 'expression tag' -1 12 2 9WPO PRO B 6 ? UNP A0A5T0F3Q1 ? ? 'expression tag' 0 13 2 9WPO PHE B 223 ? UNP A0A5T0F3Q1 LEU 217 conflict 217 14 3 9WPO GLY C 1 ? UNP A0A5T0F3Q1 ? ? 'expression tag' -5 15 3 9WPO SER C 2 ? UNP A0A5T0F3Q1 ? ? 'expression tag' -4 16 3 9WPO ALA C 3 ? UNP A0A5T0F3Q1 ? ? 'expression tag' -3 17 3 9WPO LYS C 4 ? UNP A0A5T0F3Q1 ? ? 'expression tag' -2 18 3 9WPO ASP C 5 ? UNP A0A5T0F3Q1 ? ? 'expression tag' -1 19 3 9WPO PRO C 6 ? UNP A0A5T0F3Q1 ? ? 'expression tag' 0 20 3 9WPO PHE C 223 ? UNP A0A5T0F3Q1 LEU 217 conflict 217 21 4 9WPO GLY D 1 ? UNP A0A5T0F3Q1 ? ? 'expression tag' -5 22 4 9WPO SER D 2 ? UNP A0A5T0F3Q1 ? ? 'expression tag' -4 23 4 9WPO ALA D 3 ? UNP A0A5T0F3Q1 ? ? 'expression tag' -3 24 4 9WPO LYS D 4 ? UNP A0A5T0F3Q1 ? ? 'expression tag' -2 25 4 9WPO ASP D 5 ? UNP A0A5T0F3Q1 ? ? 'expression tag' -1 26 4 9WPO PRO D 6 ? UNP A0A5T0F3Q1 ? ? 'expression tag' 0 27 4 9WPO PHE D 223 ? UNP A0A5T0F3Q1 LEU 217 conflict 217 28 # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PISA dimeric 2 2 author_and_software_defined_assembly PISA dimeric 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2780 ? 1 MORE -20 ? 1 'SSA (A^2)' 20460 ? 2 'ABSA (A^2)' 2660 ? 2 MORE -18 ? 2 'SSA (A^2)' 20690 ? # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,E,F 2 1 C,D,G,H # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 23 ? ASN A 35 ? SER A 17 ASN A 29 1 ? 13 HELX_P HELX_P2 AA2 PHE A 50 ? LEU A 55 ? PHE A 44 LEU A 49 1 ? 6 HELX_P HELX_P3 AA3 PRO A 58 ? GLU A 81 ? PRO A 52 GLU A 75 1 ? 24 HELX_P HELX_P4 AA4 GLU A 124 ? PHE A 128 ? GLU A 118 PHE A 122 1 ? 5 HELX_P HELX_P5 AA5 GLY A 153 ? HIS A 157 ? GLY A 147 HIS A 151 5 ? 5 HELX_P HELX_P6 AA6 PHE A 158 ? LYS A 168 ? PHE A 152 LYS A 162 1 ? 11 HELX_P HELX_P7 AA7 THR A 180 ? GLU A 182 ? THR A 174 GLU A 176 5 ? 3 HELX_P HELX_P8 AA8 SER A 183 ? SER A 199 ? SER A 177 SER A 193 1 ? 17 HELX_P HELX_P9 AA9 SER A 248 ? GLY A 256 ? SER A 242 GLY A 250 1 ? 9 HELX_P HELX_P10 AB1 GLY A 256 ? LYS A 262 ? GLY A 250 LYS A 256 1 ? 7 HELX_P HELX_P11 AB2 GLU B 22 ? ASN B 35 ? GLU B 16 ASN B 29 1 ? 14 HELX_P HELX_P12 AB3 PHE B 50 ? LEU B 55 ? PHE B 44 LEU B 49 1 ? 6 HELX_P HELX_P13 AB4 PRO B 58 ? GLU B 81 ? PRO B 52 GLU B 75 1 ? 24 HELX_P HELX_P14 AB5 GLU B 124 ? PHE B 128 ? GLU B 118 PHE B 122 1 ? 5 HELX_P HELX_P15 AB6 PHE B 152 ? HIS B 157 ? PHE B 146 HIS B 151 5 ? 6 HELX_P HELX_P16 AB7 PHE B 158 ? LYS B 168 ? PHE B 152 LYS B 162 1 ? 11 HELX_P HELX_P17 AB8 THR B 180 ? GLU B 182 ? THR B 174 GLU B 176 5 ? 3 HELX_P HELX_P18 AB9 SER B 183 ? SER B 199 ? SER B 177 SER B 193 1 ? 17 HELX_P HELX_P19 AC1 SER B 248 ? GLY B 256 ? SER B 242 GLY B 250 1 ? 9 HELX_P HELX_P20 AC2 GLY B 256 ? LYS B 262 ? GLY B 250 LYS B 256 1 ? 7 HELX_P HELX_P21 AC3 SER C 23 ? ASN C 35 ? SER C 17 ASN C 29 1 ? 13 HELX_P HELX_P22 AC4 PHE C 50 ? LEU C 55 ? PHE C 44 LEU C 49 1 ? 6 HELX_P HELX_P23 AC5 PRO C 58 ? GLU C 81 ? PRO C 52 GLU C 75 1 ? 24 HELX_P HELX_P24 AC6 TYR C 119 ? TRP C 122 ? TYR C 113 TRP C 116 5 ? 4 HELX_P HELX_P25 AC7 ASN C 123 ? PHE C 128 ? ASN C 117 PHE C 122 1 ? 6 HELX_P HELX_P26 AC8 PHE C 152 ? HIS C 157 ? PHE C 146 HIS C 151 5 ? 6 HELX_P HELX_P27 AC9 PHE C 158 ? LYS C 168 ? PHE C 152 LYS C 162 1 ? 11 HELX_P HELX_P28 AD1 THR C 180 ? GLU C 182 ? THR C 174 GLU C 176 5 ? 3 HELX_P HELX_P29 AD2 SER C 183 ? SER C 199 ? SER C 177 SER C 193 1 ? 17 HELX_P HELX_P30 AD3 SER C 248 ? GLY C 256 ? SER C 242 GLY C 250 1 ? 9 HELX_P HELX_P31 AD4 GLY C 256 ? LYS C 262 ? GLY C 250 LYS C 256 1 ? 7 HELX_P HELX_P32 AD5 GLU D 22 ? ASN D 35 ? GLU D 16 ASN D 29 1 ? 14 HELX_P HELX_P33 AD6 PHE D 50 ? LEU D 55 ? PHE D 44 LEU D 49 1 ? 6 HELX_P HELX_P34 AD7 PRO D 58 ? GLU D 81 ? PRO D 52 GLU D 75 1 ? 24 HELX_P HELX_P35 AD8 GLU D 124 ? PHE D 128 ? GLU D 118 PHE D 122 1 ? 5 HELX_P HELX_P36 AD9 GLY D 153 ? HIS D 157 ? GLY D 147 HIS D 151 5 ? 5 HELX_P HELX_P37 AE1 PHE D 158 ? LYS D 168 ? PHE D 152 LYS D 162 1 ? 11 HELX_P HELX_P38 AE2 THR D 180 ? GLU D 182 ? THR D 174 GLU D 176 5 ? 3 HELX_P HELX_P39 AE3 SER D 183 ? SER D 199 ? SER D 177 SER D 193 1 ? 17 HELX_P HELX_P40 AE4 SER D 248 ? GLY D 256 ? SER D 242 GLY D 250 1 ? 9 HELX_P HELX_P41 AE5 GLY D 256 ? LYS D 262 ? GLY D 250 LYS D 256 1 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 6 ? AA2 ? 2 ? AA3 ? 6 ? AA4 ? 2 ? AA5 ? 6 ? AA6 ? 2 ? AA7 ? 6 ? AA8 ? 2 ? AA9 ? 6 ? AB1 ? 6 ? AB2 ? 2 ? AB3 ? 6 ? AB4 ? 2 ? AB5 ? 6 ? AB6 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? parallel AA3 3 4 ? parallel AA3 4 5 ? anti-parallel AA3 5 6 ? anti-parallel AA4 1 2 ? anti-parallel AA5 1 2 ? anti-parallel AA5 2 3 ? anti-parallel AA5 3 4 ? parallel AA5 4 5 ? parallel AA5 5 6 ? anti-parallel AA6 1 2 ? anti-parallel AA7 1 2 ? anti-parallel AA7 2 3 ? parallel AA7 3 4 ? parallel AA7 4 5 ? anti-parallel AA7 5 6 ? anti-parallel AA8 1 2 ? anti-parallel AA9 1 2 ? anti-parallel AA9 2 3 ? anti-parallel AA9 3 4 ? parallel AA9 4 5 ? parallel AA9 5 6 ? anti-parallel AB1 1 2 ? anti-parallel AB1 2 3 ? parallel AB1 3 4 ? parallel AB1 4 5 ? anti-parallel AB1 5 6 ? anti-parallel AB2 1 2 ? anti-parallel AB3 1 2 ? anti-parallel AB3 2 3 ? anti-parallel AB3 3 4 ? parallel AB3 4 5 ? parallel AB3 5 6 ? anti-parallel AB4 1 2 ? anti-parallel AB5 1 2 ? anti-parallel AB5 2 3 ? parallel AB5 3 4 ? parallel AB5 4 5 ? anti-parallel AB5 5 6 ? anti-parallel AB6 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLY A 107 ? GLU A 112 ? GLY A 101 GLU A 106 AA1 2 SER A 95 ? THR A 104 ? SER A 89 THR A 98 AA1 3 GLU A 83 ? GLU A 92 ? GLU A 77 GLU A 86 AA1 4 LEU A 39 ? LEU A 42 ? LEU A 33 LEU A 36 AA1 5 ILE A 10 ? GLN A 14 ? ILE A 4 GLN A 8 AA1 6 GLU A 239 ? ILE A 243 ? GLU A 233 ILE A 237 AA2 1 PRO A 118 ? TYR A 119 ? PRO A 112 TYR A 113 AA2 2 TRP A 122 ? ASN A 123 ? TRP A 116 ASN A 117 AA3 1 PHE A 139 ? TYR A 143 ? PHE A 133 TYR A 137 AA3 2 LEU A 146 ? LEU A 150 ? LEU A 140 LEU A 144 AA3 3 LEU A 172 ? PRO A 176 ? LEU A 166 PRO A 170 AA3 4 SER A 201 ? VAL A 205 ? SER A 195 VAL A 199 AA3 5 LEU A 222 ? ILE A 224 ? LEU A 216 ILE A 218 AA3 6 ILE A 230 ? LYS A 233 ? ILE A 224 LYS A 227 AA4 1 ILE A 208 ? LYS A 210 ? ILE A 202 LYS A 204 AA4 2 ASN A 216 ? TYR A 218 ? ASN A 210 TYR A 212 AA5 1 GLY B 107 ? GLU B 112 ? GLY B 101 GLU B 106 AA5 2 SER B 95 ? THR B 104 ? SER B 89 THR B 98 AA5 3 GLU B 83 ? GLU B 92 ? GLU B 77 GLU B 86 AA5 4 LEU B 39 ? LEU B 42 ? LEU B 33 LEU B 36 AA5 5 ILE B 10 ? GLN B 14 ? ILE B 4 GLN B 8 AA5 6 GLU B 239 ? ILE B 243 ? GLU B 233 ILE B 237 AA6 1 PRO B 118 ? TYR B 119 ? PRO B 112 TYR B 113 AA6 2 TRP B 122 ? ASN B 123 ? TRP B 116 ASN B 117 AA7 1 PHE B 139 ? TYR B 143 ? PHE B 133 TYR B 137 AA7 2 LEU B 146 ? LEU B 150 ? LEU B 140 LEU B 144 AA7 3 LEU B 172 ? PRO B 176 ? LEU B 166 PRO B 170 AA7 4 SER B 201 ? VAL B 205 ? SER B 195 VAL B 199 AA7 5 LEU B 222 ? ILE B 224 ? LEU B 216 ILE B 218 AA7 6 ILE B 230 ? LYS B 233 ? ILE B 224 LYS B 227 AA8 1 ILE B 208 ? LYS B 210 ? ILE B 202 LYS B 204 AA8 2 ASN B 216 ? TYR B 218 ? ASN B 210 TYR B 212 AA9 1 GLY C 107 ? GLU C 112 ? GLY C 101 GLU C 106 AA9 2 TYR C 96 ? THR C 104 ? TYR C 90 THR C 98 AA9 3 GLU C 83 ? VAL C 91 ? GLU C 77 VAL C 85 AA9 4 LEU C 39 ? LEU C 42 ? LEU C 33 LEU C 36 AA9 5 ILE C 10 ? GLN C 14 ? ILE C 4 GLN C 8 AA9 6 GLU C 239 ? ILE C 243 ? GLU C 233 ILE C 237 AB1 1 PHE C 139 ? TYR C 143 ? PHE C 133 TYR C 137 AB1 2 LEU C 146 ? LEU C 150 ? LEU C 140 LEU C 144 AB1 3 LEU C 172 ? PRO C 176 ? LEU C 166 PRO C 170 AB1 4 SER C 201 ? VAL C 205 ? SER C 195 VAL C 199 AB1 5 LEU C 222 ? ILE C 224 ? LEU C 216 ILE C 218 AB1 6 ILE C 230 ? LYS C 233 ? ILE C 224 LYS C 227 AB2 1 ILE C 208 ? LYS C 210 ? ILE C 202 LYS C 204 AB2 2 ASN C 216 ? TYR C 218 ? ASN C 210 TYR C 212 AB3 1 GLY D 107 ? GLU D 112 ? GLY D 101 GLU D 106 AB3 2 SER D 95 ? THR D 104 ? SER D 89 THR D 98 AB3 3 GLU D 83 ? GLU D 92 ? GLU D 77 GLU D 86 AB3 4 LEU D 39 ? LEU D 42 ? LEU D 33 LEU D 36 AB3 5 ILE D 10 ? GLN D 14 ? ILE D 4 GLN D 8 AB3 6 GLU D 239 ? ILE D 243 ? GLU D 233 ILE D 237 AB4 1 PRO D 118 ? TYR D 119 ? PRO D 112 TYR D 113 AB4 2 TRP D 122 ? ASN D 123 ? TRP D 116 ASN D 117 AB5 1 PHE D 139 ? TYR D 143 ? PHE D 133 TYR D 137 AB5 2 LEU D 146 ? LEU D 150 ? LEU D 140 LEU D 144 AB5 3 LEU D 172 ? PRO D 176 ? LEU D 166 PRO D 170 AB5 4 SER D 201 ? VAL D 205 ? SER D 195 VAL D 199 AB5 5 LEU D 222 ? ILE D 224 ? LEU D 216 ILE D 218 AB5 6 ILE D 230 ? LYS D 233 ? ILE D 224 LYS D 227 AB6 1 ILE D 208 ? LYS D 210 ? ILE D 202 LYS D 204 AB6 2 ASN D 216 ? TYR D 218 ? ASN D 210 TYR D 212 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O LYS A 109 ? O LYS A 103 N LYS A 102 ? N LYS A 96 AA1 2 3 O SER A 95 ? O SER A 89 N GLU A 92 ? N GLU A 86 AA1 3 4 O ILE A 85 ? O ILE A 79 N VAL A 40 ? N VAL A 34 AA1 4 5 O VAL A 41 ? O VAL A 35 N LEU A 13 ? N LEU A 7 AA1 5 6 N ALA A 12 ? N ALA A 6 O LEU A 241 ? O LEU A 235 AA2 1 2 N TYR A 119 ? N TYR A 113 O TRP A 122 ? O TRP A 116 AA3 1 2 N TYR A 143 ? N TYR A 137 O LEU A 146 ? O LEU A 140 AA3 2 3 N ALA A 149 ? N ALA A 143 O ILE A 174 ? O ILE A 168 AA3 3 4 N VAL A 175 ? N VAL A 169 O LEU A 203 ? O LEU A 197 AA3 4 5 N ILE A 202 ? N ILE A 196 O ILE A 224 ? O ILE A 218 AA3 5 6 N PHE A 223 ? N PHE A 217 O SER A 232 ? O SER A 226 AA4 1 2 N GLY A 209 ? N GLY A 203 O PHE A 217 ? O PHE A 211 AA5 1 2 O LYS B 109 ? O LYS B 103 N LYS B 102 ? N LYS B 96 AA5 2 3 O VAL B 103 ? O VAL B 97 N ILE B 84 ? N ILE B 78 AA5 3 4 O ILE B 85 ? O ILE B 79 N VAL B 40 ? N VAL B 34 AA5 4 5 O VAL B 41 ? O VAL B 35 N LEU B 13 ? N LEU B 7 AA5 5 6 N ALA B 12 ? N ALA B 6 O LEU B 241 ? O LEU B 235 AA6 1 2 N TYR B 119 ? N TYR B 113 O TRP B 122 ? O TRP B 116 AA7 1 2 N TYR B 143 ? N TYR B 137 O LEU B 146 ? O LEU B 140 AA7 2 3 N ALA B 149 ? N ALA B 143 O ILE B 174 ? O ILE B 168 AA7 3 4 N VAL B 175 ? N VAL B 169 O LEU B 203 ? O LEU B 197 AA7 4 5 N ILE B 202 ? N ILE B 196 O ILE B 224 ? O ILE B 218 AA7 5 6 N PHE B 223 ? N PHE B 217 O GLU B 231 ? O GLU B 225 AA8 1 2 N GLY B 209 ? N GLY B 203 O PHE B 217 ? O PHE B 211 AA9 1 2 O GLY C 107 ? O GLY C 101 N THR C 104 ? N THR C 98 AA9 2 3 O LYS C 97 ? O LYS C 91 N SER C 90 ? N SER C 84 AA9 3 4 O ILE C 85 ? O ILE C 79 N VAL C 40 ? N VAL C 34 AA9 4 5 O VAL C 41 ? O VAL C 35 N LEU C 13 ? N LEU C 7 AA9 5 6 N ALA C 12 ? N ALA C 6 O LEU C 241 ? O LEU C 235 AB1 1 2 N PHE C 141 ? N PHE C 135 O CYS C 148 ? O CYS C 142 AB1 2 3 N ALA C 149 ? N ALA C 143 O ILE C 174 ? O ILE C 168 AB1 3 4 N VAL C 175 ? N VAL C 169 O LEU C 203 ? O LEU C 197 AB1 4 5 N ILE C 202 ? N ILE C 196 O ILE C 224 ? O ILE C 218 AB1 5 6 N PHE C 223 ? N PHE C 217 O SER C 232 ? O SER C 226 AB2 1 2 N GLY C 209 ? N GLY C 203 O PHE C 217 ? O PHE C 211 AB3 1 2 O LYS D 109 ? O LYS D 103 N LYS D 102 ? N LYS D 96 AB3 2 3 O LEU D 99 ? O LEU D 93 N TYR D 88 ? N TYR D 82 AB3 3 4 O ILE D 85 ? O ILE D 79 N VAL D 40 ? N VAL D 34 AB3 4 5 O VAL D 41 ? O VAL D 35 N LEU D 13 ? N LEU D 7 AB3 5 6 N ALA D 12 ? N ALA D 6 O LEU D 241 ? O LEU D 235 AB4 1 2 N TYR D 119 ? N TYR D 113 O TRP D 122 ? O TRP D 116 AB5 1 2 N PHE D 141 ? N PHE D 135 O CYS D 148 ? O CYS D 142 AB5 2 3 N ALA D 149 ? N ALA D 143 O ILE D 174 ? O ILE D 168 AB5 3 4 N VAL D 175 ? N VAL D 169 O LEU D 203 ? O LEU D 197 AB5 4 5 N ILE D 202 ? N ILE D 196 O ILE D 224 ? O ILE D 218 AB5 5 6 N PHE D 223 ? N PHE D 217 O GLU D 231 ? O GLU D 225 AB6 1 2 N GLY D 209 ? N GLY D 203 O PHE D 217 ? O PHE D 211 # _pdbx_entry_details.entry_id 9WPO _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification N # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 CB _pdbx_validate_rmsd_angle.auth_asym_id_1 B _pdbx_validate_rmsd_angle.auth_comp_id_1 GLU _pdbx_validate_rmsd_angle.auth_seq_id_1 86 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CA _pdbx_validate_rmsd_angle.auth_asym_id_2 B _pdbx_validate_rmsd_angle.auth_comp_id_2 GLU _pdbx_validate_rmsd_angle.auth_seq_id_2 86 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 C _pdbx_validate_rmsd_angle.auth_asym_id_3 B _pdbx_validate_rmsd_angle.auth_comp_id_3 GLU _pdbx_validate_rmsd_angle.auth_seq_id_3 86 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 123.44 _pdbx_validate_rmsd_angle.angle_target_value 110.40 _pdbx_validate_rmsd_angle.angle_deviation 13.04 _pdbx_validate_rmsd_angle.angle_standard_deviation 2.00 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 87 ? ? 39.26 -114.78 2 1 TRP A 116 ? ? -152.16 66.04 3 1 GLU A 138 ? ? 57.62 -107.11 4 1 GLU A 257 ? ? -95.11 41.70 5 1 ALA B 87 ? ? -27.72 -59.30 6 1 TRP B 116 ? ? -153.37 65.05 7 1 GLU B 138 ? ? 56.51 -107.01 8 1 GLU B 257 ? ? -92.76 44.08 9 1 TRP C 116 ? ? -152.86 65.18 10 1 GLU C 138 ? ? 56.14 -107.54 11 1 GLU C 257 ? ? -90.94 53.42 12 1 GLU D 16 ? ? -67.16 4.66 13 1 ALA D 87 ? ? 52.61 -108.32 14 1 TRP D 116 ? ? -152.89 66.67 15 1 GLU D 138 ? ? 57.10 -108.30 16 1 GLU D 257 ? ? -96.84 42.69 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -x,y+1/2,-z # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 3.280019965 5.89903718265 23.7384096326 0.396383177501 ? 0.0435210886889 ? 0.0570740439682 ? 0.354992188769 ? 0.0345187777524 ? 0.198693241954 ? 4.74113039648 ? -0.608665058173 ? 2.35331278829 ? 2.46577706874 ? 0.114816344857 ? 3.22365196864 ? -0.0553605131857 ? 0.462984519261 ? 0.071760937422 ? -0.47568952557 ? 0.0786116473875 ? -0.0380301616972 ? -0.446816293856 ? -0.193625410506 ? 0.00511872943238 ? 2 'X-RAY DIFFRACTION' ? refined 6.64734484522 12.2961189559 34.5794061925 0.432206482736 ? -0.0052016382066 ? 0.00657356087741 ? 0.188207645504 ? 0.0274884231768 ? 0.267061832168 ? 4.08718432499 ? 1.45257429425 ? 1.24302053636 ? 2.85300271361 ? 0.930172448029 ? 1.83390468369 ? -0.222888514874 ? 0.0641998082306 ? 0.546819069736 ? -0.00519946599216 ? 0.117885061634 ? 0.275881997879 ? -0.48786345186 ? 0.0112636042879 ? 0.0960313868061 ? 3 'X-RAY DIFFRACTION' ? refined 2.96549498474 7.31331562533 40.9561583921 0.282409389461 ? 0.0479654703032 ? 0.0383080982444 ? 0.213768818494 ? -0.00794609799625 ? 0.237630713457 ? 5.71583825818 ? 1.02957361221 ? 3.27445377978 ? 3.65120985782 ? -0.605727554584 ? 7.44539017353 ? -0.137537619766 ? -0.125053606683 ? 0.0483500256633 ? -0.0850859756569 ? 0.0553206431594 ? -0.0934394678175 ? -0.190717158134 ? -0.355968848625 ? 0.131069130311 ? 4 'X-RAY DIFFRACTION' ? refined 11.2133511329 -3.80104513178 43.2962829551 0.291520083177 ? 0.0252590664198 ? 0.0407050044305 ? 0.172942229666 ? -0.00176535472296 ? 0.212236500585 ? 3.10825400878 ? 3.0656003837 ? 1.32839564982 ? 6.60275865615 ? 0.664205505014 ? 2.07335111221 ? 0.0975560595731 ? -0.116816806994 ? -0.0161290834561 ? 0.526698835803 ? -0.0177287229553 ? -0.0103777081095 ? -0.0999115479424 ? -0.0603812754547 ? -0.0844699516901 ? 5 'X-RAY DIFFRACTION' ? refined 20.4184392346 -10.8655074957 33.7869677072 0.321573889402 ? 0.0481023831681 ? -0.0139200894225 ? 0.276385934022 ? 0.0258926795184 ? 0.223262118868 ? 9.66751065963 ? 7.89531444379 ? -6.21778685492 ? 9.03354143458 ? -6.86626587901 ? 8.50023073417 ? 0.15571280941 ? 0.481849919652 ? 0.370577035242 ? -0.276810955172 ? -0.0687068226765 ? 0.188490151228 ? 0.147659552988 ? 0.359543056134 ? -0.068255708384 ? 6 'X-RAY DIFFRACTION' ? refined 16.8146843296 -2.64531412494 29.773034089 0.296333318077 ? -0.0122800991331 ? 0.0132832613785 ? 0.265082653808 ? -0.00641125874435 ? 0.20501429723 ? 2.16791738096 ? -0.218287913351 ? -0.0561523886009 ? 7.69831517216 ? 0.636791104881 ? 4.47807866696 ? -0.0777033729803 ? 0.147893820218 ? 0.120490383649 ? -0.658211215699 ? -0.00354763990925 ? -0.287307446904 ? -0.223931734015 ? 0.596877514993 ? 0.113525735513 ? 7 'X-RAY DIFFRACTION' ? refined 9.0241955232 -6.44199460147 23.7786934556 0.380601070221 ? -0.0310221735827 ? -0.0483067053298 ? 0.244171034853 ? -0.0469272112063 ? 0.211756118859 ? 6.87984679769 ? -1.19026220279 ? -1.10483023805 ? 4.40238624266 ? -2.68553437773 ? 8.40855256144 ? 0.167006845982 ? 0.369188390712 ? -0.0057539059523 ? -0.641770208431 ? -0.106826457528 ? 0.150140845276 ? 0.236832564476 ? 0.0415912938183 ? -0.132727593826 ? 8 'X-RAY DIFFRACTION' ? refined 8.58247635146 -26.1051393398 40.4253628652 0.278304960805 ? -0.0748948706555 ? -0.0707822583209 ? 0.376709281903 ? 0.0425325029138 ? 0.436648793473 ? 5.63352635706 ? -0.444118425295 ? 2.32944788974 ? 4.60725807257 ? 0.730305447517 ? 9.90922854938 ? 0.392767539818 ? -0.620997641529 ? -0.126506976771 ? 0.00343148966624 ? 0.00819151813064 ? 0.0195607118665 ? 0.513889524945 ? -0.924006778217 ? -0.461297522113 ? 9 'X-RAY DIFFRACTION' ? refined 38.2148047982 -38.0209527075 40.587322988 0.198788010529 ? 0.0429512588333 ? 0.0213030166814 ? 0.286878919125 ? 0.0222155899857 ? 0.258969553908 ? 3.65926752824 ? 0.627529207352 ? 1.08377230598 ? 4.36516227659 ? 0.67416098373 ? 3.01661601241 ? 0.0652835159998 ? 0.28374283082 ? -0.0945666742737 ? -0.137646159659 ? 0.00833710642835 ? -0.510437370955 ? 0.201461576758 ? 0.330840295701 ? -0.06753898808 ? 10 'X-RAY DIFFRACTION' ? refined 38.0469943192 -46.1511097184 48.153401748 0.341416967084 ? 0.0539313185117 ? 0.0140618688478 ? 0.254352216165 ? 0.0403613171958 ? 0.194386351542 ? 8.9570942883 ? 2.18352775059 ? 4.00893277673 ? 5.44515130482 ? 1.0644622942 ? 3.96485160748 ? 0.180042017585 ? 0.00903792510916 ? -0.0673886550751 ? 0.127265702696 ? -0.180218134043 ? 0.00178590283993 ? 0.550088844619 ? 0.408129043937 ? 0.0388966400151 ? 11 'X-RAY DIFFRACTION' ? refined 26.1597025176 -31.1962098863 48.8074719387 0.248270558991 ? -0.0194666364132 ? 0.0215242970382 ? 0.233442648058 ? 0.0335047773703 ? 0.151487119173 ? 2.1947946966 ? -0.450317594727 ? 0.46234685948 ? 3.90522422299 ? 0.574772751712 ? 1.62162859361 ? -0.0121204946529 ? -0.185897512565 ? -0.190205815455 ? 0.244844317883 ? -0.0429488704389 ? 0.119734234464 ? 0.208825339011 ? 0.0269563151328 ? 0.0552762108596 ? 12 'X-RAY DIFFRACTION' ? refined 25.0505941604 -19.0299389985 35.7434950569 0.218823153038 ? -0.0102687694757 ? -0.0146039918931 ? 0.253026643781 ? 0.034906973048 ? 0.180795376082 ? 2.78229398096 ? 0.39086299364 ? 0.884599252425 ? 9.94597366405 ? 6.96763099245 ? 8.67097688239 ? -0.0988717611723 ? 0.129539334889 ? -0.204710759261 ? 0.361475347393 ? 0.166360670515 ? -0.0684152150502 ? 0.313353748219 ? 0.111162808755 ? -0.0886407390504 ? 13 'X-RAY DIFFRACTION' ? refined 34.4931736616 -25.4083503702 36.2496002048 0.227483129489 ? -0.0591447152792 ? 0.0312937889555 ? 0.239349755276 ? 0.0328044089182 ? 0.211858474516 ? 2.6995259185 ? 0.151892465247 ? -0.312898473074 ? 4.97629134146 ? 1.09592680565 ? 1.99675300619 ? 0.0475826397789 ? 0.119773060775 ? 0.219423995674 ? -0.396034798598 ? -0.0208580827974 ? -0.105018121716 ? -0.186171037933 ? 0.258773331827 ? -0.0572535082166 ? 14 'X-RAY DIFFRACTION' ? refined 26.56426457 -5.5096796581 50.4472391833 0.496017530223 ? -0.00786542409516 ? 0.000589824374378 ? 0.283660370745 ? -0.00315053259735 ? 0.358588333007 ? 2.02988970958 ? -5.73831249538 ? 2.82810602103 ? 2.02740850235 ? 0.194793997189 ? 4.27661840088 ? -1.00364341834 ? -0.473473370193 ? 0.341103812027 ? 0.20802580322 ? 0.459555227575 ? -0.288278250944 ? 0.163837502411 ? 0.137055578182 ? 0.633594832398 ? 15 'X-RAY DIFFRACTION' ? refined 2.99388980887 -19.1277857593 1.25037022639 0.306085097627 ? 0.039513553802 ? -0.0743706010116 ? 0.313438888979 ? -0.0408109010665 ? 0.265572329074 ? 6.10406413138 ? 1.55013539213 ? 0.0992000255883 ? 5.60900637257 ? 2.078047984 ? 0.792758734973 ? -0.0712634848089 ? 0.411790726619 ? 0.125000937924 ? -0.347254416589 ? -0.178692926638 ? 0.871933483978 ? -0.150151079138 ? -0.172109538814 ? 0.197134829748 ? 16 'X-RAY DIFFRACTION' ? refined 13.3542474694 -11.2983346838 5.62418872928 0.377703821045 ? 0.0711438218961 ? -0.0705967692886 ? 0.254632865376 ? 0.00929009273031 ? 0.247865454932 ? 5.77620888226 ? 0.906606139361 ? -1.88530741364 ? 3.71664761334 ? 0.407545486664 ? 2.24401472956 ? 0.255913121722 ? 0.0690365652368 ? 0.45742812949 ? -0.0530276903129 ? -0.203929614063 ? 0.26275764667 ? -0.628739288432 ? -0.176898177207 ? -0.050095693546 ? 17 'X-RAY DIFFRACTION' ? refined 20.4636563674 -23.5231695514 11.1887244748 0.349700768624 ? -0.024393188796 ? -0.00130983301674 ? 0.28440718301 ? -0.0303632766377 ? 0.194567123314 ? 2.11506963583 ? 0.146786293261 ? 0.148937491688 ? 3.53547363857 ? -0.724500599175 ? 0.813038199334 ? 0.0287462861342 ? -0.254938396677 ? 0.173431486307 ? 0.411495742868 ? -0.0497630533695 ? 0.053707660611 ? -0.0841036258391 ? 0.0178682631518 ? 0.043725212054 ? 18 'X-RAY DIFFRACTION' ? refined 22.42189054 -35.45369069 -1.93092315987 0.379110937367 ? 0.0482187702189 ? -0.00177564677303 ? 0.240174655257 ? -0.0339183190468 ? 0.216679127519 ? 3.62215919306 ? 1.52560713962 ? -1.45100940242 ? 5.86777177312 ? -3.05582625707 ? 7.81327308176 ? 0.327325092821 ? 0.316723191584 ? 0.162990914144 ? 0.0453375988371 ? -0.145440529713 ? 0.0833935445297 ? -0.770646662903 ? 0.0480419301175 ? -0.244182832153 ? 19 'X-RAY DIFFRACTION' ? refined 17.0715336116 -27.4761103755 -3.12412680194 0.293290078375 ? 0.00322135301757 ? 0.0173262449806 ? 0.280770767387 ? -0.0483665219398 ? 0.241758760782 ? 1.8778524587 ? 1.42391778833 ? 0.418167391988 ? 7.21986361734 ? -2.30803606631 ? 1.18201042871 ? -0.221906262394 ? 0.188788317407 ? -0.186414174294 ? -0.67207530682 ? -0.0406773727444 ? -0.494702845212 ? 0.0515184568782 ? 0.0285247246111 ? 0.216165320018 ? 20 'X-RAY DIFFRACTION' ? refined 12.5829522645 -39.5184605767 5.13635835927 0.233772131142 ? -0.0823173432966 ? 0.0186535106811 ? 0.230923368581 ? -0.0501641139712 ? 0.267906353031 ? 3.81110779127 ? -3.38503871872 ? 1.74943328119 ? 6.97366868785 ? -2.27623740801 ? 3.07658954145 ? -0.0529681349649 ? -0.105681019608 ? -0.421501105884 ? -0.0863091139146 ? 0.174883215315 ? 0.380211550479 ? 0.168821458345 ? -0.344811228819 ? -0.112118522009 ? 21 'X-RAY DIFFRACTION' ? refined 40.9514799143 -65.384036548 -4.7547765985 0.615950614777 ? 0.127138316859 ? -0.0553614471239 ? 0.286031431579 ? -0.0614805736388 ? 0.365033711328 ? 2.27028187119 ? -0.261882903535 ? -0.252455062136 ? 1.97040544739 ? -0.560052011586 ? 1.63876088264 ? 0.131136266937 ? 0.213572345853 ? -0.481134202652 ? -0.342589537122 ? -0.123228754144 ? -0.0310066796496 ? 0.631400017053 ? 0.224503364342 ? 0.00102107414158 ? 22 'X-RAY DIFFRACTION' ? refined 35.4329350445 -50.4181527008 1.55936187259 0.272816726611 ? 0.0147251573698 ? -0.0438740823938 ? 0.21957199435 ? 0.0410484795554 ? 0.186026028069 ? 1.69049123375 ? -0.829415683773 ? -0.476938076355 ? 4.10007484924 ? 0.440321076322 ? 1.76531799323 ? 0.0911604088959 ? 0.121308764278 ? -0.0165251121372 ? -0.24964240236 ? -0.0619919526574 ? -0.000446824985266 ? 0.125637230299 ? 0.0133074373926 ? -0.0211165068612 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 1 through 29 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 30 through 74 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 75 through 106 ) ; 4 'X-RAY DIFFRACTION' 4 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 107 through 174 ) ; 5 'X-RAY DIFFRACTION' 5 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 175 through 192 ) ; 6 'X-RAY DIFFRACTION' 6 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 193 through 223 ) ; 7 'X-RAY DIFFRACTION' 7 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 224 through 242 ) ; 8 'X-RAY DIFFRACTION' 8 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 243 through 258 ) ; 9 'X-RAY DIFFRACTION' 9 ? ? ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 1 through 52 ) ; 10 'X-RAY DIFFRACTION' 10 ? ? ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 53 through 74 ) ; 11 'X-RAY DIFFRACTION' 11 ? ? ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 75 through 174 ) ; 12 'X-RAY DIFFRACTION' 12 ? ? ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 175 through 192 ) ; 13 'X-RAY DIFFRACTION' 13 ? ? ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 193 through 242 ) ; 14 'X-RAY DIFFRACTION' 14 ? ? ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 243 through 258 ) ; 15 'X-RAY DIFFRACTION' 15 ? ? ? ? ? ? ? ? ? ? ? ;chain 'C' and (resid 0 through 29 ) ; 16 'X-RAY DIFFRACTION' 16 ? ? ? ? ? ? ? ? ? ? ? ;chain 'C' and (resid 30 through 74 ) ; 17 'X-RAY DIFFRACTION' 17 ? ? ? ? ? ? ? ? ? ? ? ;chain 'C' and (resid 75 through 174 ) ; 18 'X-RAY DIFFRACTION' 18 ? ? ? ? ? ? ? ? ? ? ? ;chain 'C' and (resid 175 through 192 ) ; 19 'X-RAY DIFFRACTION' 19 ? ? ? ? ? ? ? ? ? ? ? ;chain 'C' and (resid 193 through 223 ) ; 20 'X-RAY DIFFRACTION' 20 ? ? ? ? ? ? ? ? ? ? ? ;chain 'C' and (resid 224 through 258 ) ; 21 'X-RAY DIFFRACTION' 21 ? ? ? ? ? ? ? ? ? ? ? ;chain 'D' and (resid 2 through 74 ) ; 22 'X-RAY DIFFRACTION' 22 ? ? ? ? ? ? ? ? ? ? ? ;chain 'D' and (resid 75 through 258 ) ; # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -5 ? A GLY 1 2 1 Y 1 A SER -4 ? A SER 2 3 1 Y 1 A ALA -3 ? A ALA 3 4 1 Y 1 A LYS -2 ? A LYS 4 5 1 Y 1 A ASP -1 ? A ASP 5 6 1 Y 1 A PRO 0 ? A PRO 6 7 1 Y 1 A LYS 259 ? A LYS 265 8 1 Y 1 A ASN 260 ? A ASN 266 9 1 Y 1 B GLY -5 ? B GLY 1 10 1 Y 1 B SER -4 ? B SER 2 11 1 Y 1 B ALA -3 ? B ALA 3 12 1 Y 1 B LYS -2 ? B LYS 4 13 1 Y 1 B ASP -1 ? B ASP 5 14 1 Y 1 B PRO 0 ? B PRO 6 15 1 Y 1 B LYS 259 ? B LYS 265 16 1 Y 1 B ASN 260 ? B ASN 266 17 1 Y 1 C GLY -5 ? C GLY 1 18 1 Y 1 C SER -4 ? C SER 2 19 1 Y 1 C ALA -3 ? C ALA 3 20 1 Y 1 C LYS -2 ? C LYS 4 21 1 Y 1 C ASP -1 ? C ASP 5 22 1 Y 1 C LYS 259 ? C LYS 265 23 1 Y 1 C ASN 260 ? C ASN 266 24 1 Y 1 D GLY -5 ? D GLY 1 25 1 Y 1 D SER -4 ? D SER 2 26 1 Y 1 D ALA -3 ? D ALA 3 27 1 Y 1 D LYS -2 ? D LYS 4 28 1 Y 1 D ASP -1 ? D ASP 5 29 1 Y 1 D PRO 0 ? D PRO 6 30 1 Y 1 D MET 1 ? D MET 7 31 1 Y 1 D LYS 259 ? D LYS 265 32 1 Y 1 D ASN 260 ? D ASN 266 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TRP N N N N 321 TRP CA C N S 322 TRP C C N N 323 TRP O O N N 324 TRP CB C N N 325 TRP CG C Y N 326 TRP CD1 C Y N 327 TRP CD2 C Y N 328 TRP NE1 N Y N 329 TRP CE2 C Y N 330 TRP CE3 C Y N 331 TRP CZ2 C Y N 332 TRP CZ3 C Y N 333 TRP CH2 C Y N 334 TRP OXT O N N 335 TRP H H N N 336 TRP H2 H N N 337 TRP HA H N N 338 TRP HB2 H N N 339 TRP HB3 H N N 340 TRP HD1 H N N 341 TRP HE1 H N N 342 TRP HE3 H N N 343 TRP HZ2 H N N 344 TRP HZ3 H N N 345 TRP HH2 H N N 346 TRP HXT H N N 347 TYR N N N N 348 TYR CA C N S 349 TYR C C N N 350 TYR O O N N 351 TYR CB C N N 352 TYR CG C Y N 353 TYR CD1 C Y N 354 TYR CD2 C Y N 355 TYR CE1 C Y N 356 TYR CE2 C Y N 357 TYR CZ C Y N 358 TYR OH O N N 359 TYR OXT O N N 360 TYR H H N N 361 TYR H2 H N N 362 TYR HA H N N 363 TYR HB2 H N N 364 TYR HB3 H N N 365 TYR HD1 H N N 366 TYR HD2 H N N 367 TYR HE1 H N N 368 TYR HE2 H N N 369 TYR HH H N N 370 TYR HXT H N N 371 VAL N N N N 372 VAL CA C N S 373 VAL C C N N 374 VAL O O N N 375 VAL CB C N N 376 VAL CG1 C N N 377 VAL CG2 C N N 378 VAL OXT O N N 379 VAL H H N N 380 VAL H2 H N N 381 VAL HA H N N 382 VAL HB H N N 383 VAL HG11 H N N 384 VAL HG12 H N N 385 VAL HG13 H N N 386 VAL HG21 H N N 387 VAL HG22 H N N 388 VAL HG23 H N N 389 VAL HXT H N N 390 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # _pdbx_audit_support.funding_organization 'National Research Foundation (NRF, Korea)' _pdbx_audit_support.country 'Korea, Republic Of' _pdbx_audit_support.grant_number RS-2023-00208153 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 9WPN _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'P 1 21 1' _space_group.name_Hall 'P 2yb' _space_group.IT_number 4 _space_group.crystal_system monoclinic _space_group.id 1 # _atom_sites.entry_id 9WPO _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.019722 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.001399 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.006578 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013481 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ # loop_ #