data_9WX5 # _entry.id 9WX5 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.410 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9WX5 pdb_00009wx5 10.2210/pdb9wx5/pdb WWPDB D_1300063994 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-04-15 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9WX5 _pdbx_database_status.recvd_initial_deposition_date 2025-09-24 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email dvasu@rgcb.res.in _pdbx_contact_author.name_first DILEEP _pdbx_contact_author.name_last VASUDEVAN _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-5568-628X # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Jagdev, M.K.' 1 ? 'Vasudevan, D.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Biochemistry _citation.journal_id_ASTM BICHAW _citation.journal_id_CSD 0033 _citation.journal_id_ISSN 0006-2960 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 65 _citation.language ? _citation.page_first 614 _citation.page_last 625 _citation.title 'Gradual Modification of Ferritin 4-Fold Pore Promotes Cage Instability, Fe 2+ Exit, and Iron-Induced Protein Precipitation.' _citation.year 2026 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.biochem.5c00744 _citation.pdbx_database_id_PubMed 41700891 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Subhadarshanee, B.' 1 ? primary 'Jagdev, M.K.' 2 ? primary 'Bhattacharyya, G.' 3 0000-0002-8890-2521 primary 'Parida, A.' 4 0000-0002-8483-3821 primary 'Mohanty, A.' 5 ? primary 'Vasudevan, D.' 6 ? primary 'Behera, R.K.' 7 0000-0003-2849-3292 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Ferritin, middle subunit' 20344.791 1 1.16.3.1 ? ? ? 2 non-polymer syn 'MAGNESIUM ION' 24.305 9 ? ? ? ? 3 non-polymer syn 'CHLORIDE ION' 35.453 11 ? ? ? ? 4 water nat water 18.015 219 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Ferritin M,Ferritin H',Ferritin X ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;VSQVRQNYHSDCEAAVNRMLNLELYASYTYSSMYAFFDRDDVALHNVAEFFKEHSHEEREHAEKFMKYQNKRGGRVVLQD IKKPERDEWGNTLEAMQAALQLEKTVNQALLDLHKLATDKVDPHLCDFLASEYLEEQVKDIKRIGDFITNLKRLGLPENG EGEYLFDKHSVKES ; _entity_poly.pdbx_seq_one_letter_code_can ;VSQVRQNYHSDCEAAVNRMLNLELYASYTYSSMYAFFDRDDVALHNVAEFFKEHSHEEREHAEKFMKYQNKRGGRVVLQD IKKPERDEWGNTLEAMQAALQLEKTVNQALLDLHKLATDKVDPHLCDFLASEYLEEQVKDIKRIGDFITNLKRLGLPENG EGEYLFDKHSVKES ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'MAGNESIUM ION' MG 3 'CHLORIDE ION' CL 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 VAL n 1 2 SER n 1 3 GLN n 1 4 VAL n 1 5 ARG n 1 6 GLN n 1 7 ASN n 1 8 TYR n 1 9 HIS n 1 10 SER n 1 11 ASP n 1 12 CYS n 1 13 GLU n 1 14 ALA n 1 15 ALA n 1 16 VAL n 1 17 ASN n 1 18 ARG n 1 19 MET n 1 20 LEU n 1 21 ASN n 1 22 LEU n 1 23 GLU n 1 24 LEU n 1 25 TYR n 1 26 ALA n 1 27 SER n 1 28 TYR n 1 29 THR n 1 30 TYR n 1 31 SER n 1 32 SER n 1 33 MET n 1 34 TYR n 1 35 ALA n 1 36 PHE n 1 37 PHE n 1 38 ASP n 1 39 ARG n 1 40 ASP n 1 41 ASP n 1 42 VAL n 1 43 ALA n 1 44 LEU n 1 45 HIS n 1 46 ASN n 1 47 VAL n 1 48 ALA n 1 49 GLU n 1 50 PHE n 1 51 PHE n 1 52 LYS n 1 53 GLU n 1 54 HIS n 1 55 SER n 1 56 HIS n 1 57 GLU n 1 58 GLU n 1 59 ARG n 1 60 GLU n 1 61 HIS n 1 62 ALA n 1 63 GLU n 1 64 LYS n 1 65 PHE n 1 66 MET n 1 67 LYS n 1 68 TYR n 1 69 GLN n 1 70 ASN n 1 71 LYS n 1 72 ARG n 1 73 GLY n 1 74 GLY n 1 75 ARG n 1 76 VAL n 1 77 VAL n 1 78 LEU n 1 79 GLN n 1 80 ASP n 1 81 ILE n 1 82 LYS n 1 83 LYS n 1 84 PRO n 1 85 GLU n 1 86 ARG n 1 87 ASP n 1 88 GLU n 1 89 TRP n 1 90 GLY n 1 91 ASN n 1 92 THR n 1 93 LEU n 1 94 GLU n 1 95 ALA n 1 96 MET n 1 97 GLN n 1 98 ALA n 1 99 ALA n 1 100 LEU n 1 101 GLN n 1 102 LEU n 1 103 GLU n 1 104 LYS n 1 105 THR n 1 106 VAL n 1 107 ASN n 1 108 GLN n 1 109 ALA n 1 110 LEU n 1 111 LEU n 1 112 ASP n 1 113 LEU n 1 114 HIS n 1 115 LYS n 1 116 LEU n 1 117 ALA n 1 118 THR n 1 119 ASP n 1 120 LYS n 1 121 VAL n 1 122 ASP n 1 123 PRO n 1 124 HIS n 1 125 LEU n 1 126 CYS n 1 127 ASP n 1 128 PHE n 1 129 LEU n 1 130 ALA n 1 131 SER n 1 132 GLU n 1 133 TYR n 1 134 LEU n 1 135 GLU n 1 136 GLU n 1 137 GLN n 1 138 VAL n 1 139 LYS n 1 140 ASP n 1 141 ILE n 1 142 LYS n 1 143 ARG n 1 144 ILE n 1 145 GLY n 1 146 ASP n 1 147 PHE n 1 148 ILE n 1 149 THR n 1 150 ASN n 1 151 LEU n 1 152 LYS n 1 153 ARG n 1 154 LEU n 1 155 GLY n 1 156 LEU n 1 157 PRO n 1 158 GLU n 1 159 ASN n 1 160 GLY n 1 161 GLU n 1 162 GLY n 1 163 GLU n 1 164 TYR n 1 165 LEU n 1 166 PHE n 1 167 ASP n 1 168 LYS n 1 169 HIS n 1 170 SER n 1 171 VAL n 1 172 LYS n 1 173 GLU n 1 174 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 174 _entity_src_gen.gene_src_common_name 'American bullfrog' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Aquarana catesbeiana' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 8400 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 VAL 1 1 1 VAL VAL A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 GLN 3 3 3 GLN GLN A . n A 1 4 VAL 4 4 4 VAL VAL A . n A 1 5 ARG 5 5 5 ARG ARG A . n A 1 6 GLN 6 6 6 GLN GLN A . n A 1 7 ASN 7 7 7 ASN ASN A . n A 1 8 TYR 8 8 8 TYR TYR A . n A 1 9 HIS 9 9 9 HIS HIS A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 CYS 12 12 12 CYS CYS A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 ASN 17 17 17 ASN ASN A . n A 1 18 ARG 18 18 18 ARG ARG A . n A 1 19 MET 19 19 19 MET MET A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 ASN 21 21 21 ASN ASN A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 TYR 25 25 25 TYR TYR A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 TYR 28 28 28 TYR TYR A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 TYR 30 30 30 TYR TYR A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 MET 33 33 33 MET MET A . n A 1 34 TYR 34 34 34 TYR TYR A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 PHE 36 36 36 PHE PHE A . n A 1 37 PHE 37 37 37 PHE PHE A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 ARG 39 39 39 ARG ARG A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 HIS 45 45 45 HIS HIS A . n A 1 46 ASN 46 46 46 ASN ASN A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 PHE 50 50 50 PHE PHE A . n A 1 51 PHE 51 51 51 PHE PHE A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 HIS 54 54 54 HIS HIS A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 HIS 56 56 56 HIS HIS A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 ARG 59 59 59 ARG ARG A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 HIS 61 61 61 HIS HIS A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 PHE 65 65 65 PHE PHE A . n A 1 66 MET 66 66 66 MET MET A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 TYR 68 68 68 TYR TYR A . n A 1 69 GLN 69 69 69 GLN GLN A . n A 1 70 ASN 70 70 70 ASN ASN A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 ARG 72 72 72 ARG ARG A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 ARG 75 75 75 ARG ARG A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 GLN 79 79 79 GLN GLN A . n A 1 80 ASP 80 80 80 ASP ASP A . n A 1 81 ILE 81 81 81 ILE ILE A . n A 1 82 LYS 82 82 82 LYS LYS A . n A 1 83 LYS 83 83 83 LYS LYS A . n A 1 84 PRO 84 84 84 PRO PRO A . n A 1 85 GLU 85 85 85 GLU GLU A . n A 1 86 ARG 86 86 86 ARG ARG A . n A 1 87 ASP 87 87 87 ASP ASP A . n A 1 88 GLU 88 88 88 GLU GLU A . n A 1 89 TRP 89 89 89 TRP TRP A . n A 1 90 GLY 90 90 90 GLY GLY A . n A 1 91 ASN 91 91 91 ASN ASN A . n A 1 92 THR 92 92 92 THR THR A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 MET 96 96 96 MET MET A . n A 1 97 GLN 97 97 97 GLN GLN A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 GLN 101 101 101 GLN GLN A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 GLU 103 103 103 GLU GLU A . n A 1 104 LYS 104 104 104 LYS LYS A . n A 1 105 THR 105 105 105 THR THR A . n A 1 106 VAL 106 106 106 VAL VAL A . n A 1 107 ASN 107 107 107 ASN ASN A . n A 1 108 GLN 108 108 108 GLN GLN A . n A 1 109 ALA 109 109 109 ALA ALA A . n A 1 110 LEU 110 110 110 LEU LEU A . n A 1 111 LEU 111 111 111 LEU LEU A . n A 1 112 ASP 112 112 112 ASP ASP A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 HIS 114 114 114 HIS HIS A . n A 1 115 LYS 115 115 115 LYS LYS A . n A 1 116 LEU 116 116 116 LEU LEU A . n A 1 117 ALA 117 117 117 ALA ALA A . n A 1 118 THR 118 118 118 THR THR A . n A 1 119 ASP 119 119 119 ASP ASP A . n A 1 120 LYS 120 120 120 LYS LYS A . n A 1 121 VAL 121 121 121 VAL VAL A . n A 1 122 ASP 122 122 122 ASP ASP A . n A 1 123 PRO 123 123 123 PRO PRO A . n A 1 124 HIS 124 124 124 HIS HIS A . n A 1 125 LEU 125 125 125 LEU LEU A . n A 1 126 CYS 126 126 126 CYS CYS A . n A 1 127 ASP 127 127 127 ASP ASP A . n A 1 128 PHE 128 128 128 PHE PHE A . n A 1 129 LEU 129 129 129 LEU LEU A . n A 1 130 ALA 130 130 130 ALA ALA A . n A 1 131 SER 131 131 131 SER SER A . n A 1 132 GLU 132 132 132 GLU GLU A . n A 1 133 TYR 133 133 133 TYR TYR A . n A 1 134 LEU 134 134 134 LEU LEU A . n A 1 135 GLU 135 135 135 GLU GLU A . n A 1 136 GLU 136 136 136 GLU GLU A . n A 1 137 GLN 137 137 137 GLN GLN A . n A 1 138 VAL 138 138 138 VAL VAL A . n A 1 139 LYS 139 139 139 LYS LYS A . n A 1 140 ASP 140 140 140 ASP ASP A . n A 1 141 ILE 141 141 141 ILE ILE A . n A 1 142 LYS 142 142 142 LYS LYS A . n A 1 143 ARG 143 143 143 ARG ARG A . n A 1 144 ILE 144 144 144 ILE ILE A . n A 1 145 GLY 145 145 145 GLY GLY A . n A 1 146 ASP 146 146 146 ASP ASP A . n A 1 147 PHE 147 147 147 PHE PHE A . n A 1 148 ILE 148 148 148 ILE ILE A . n A 1 149 THR 149 149 149 THR THR A . n A 1 150 ASN 150 150 150 ASN ASN A . n A 1 151 LEU 151 151 151 LEU LEU A . n A 1 152 LYS 152 152 152 LYS LYS A . n A 1 153 ARG 153 153 153 ARG ARG A . n A 1 154 LEU 154 154 154 LEU LEU A . n A 1 155 GLY 155 155 155 GLY GLY A . n A 1 156 LEU 156 156 156 LEU LEU A . n A 1 157 PRO 157 157 157 PRO PRO A . n A 1 158 GLU 158 158 158 GLU GLU A . n A 1 159 ASN 159 159 159 ASN ASN A . n A 1 160 GLY 160 160 160 GLY GLY A . n A 1 161 GLU 161 161 161 GLU GLU A . n A 1 162 GLY 162 162 162 GLY GLY A . n A 1 163 GLU 163 163 163 GLU GLU A . n A 1 164 TYR 164 164 164 TYR TYR A . n A 1 165 LEU 165 165 165 LEU LEU A . n A 1 166 PHE 166 166 166 PHE PHE A . n A 1 167 ASP 167 167 167 ASP ASP A . n A 1 168 LYS 168 168 168 LYS LYS A . n A 1 169 HIS 169 169 169 HIS HIS A . n A 1 170 SER 170 170 170 SER SER A . n A 1 171 VAL 171 171 171 VAL VAL A . n A 1 172 LYS 172 172 172 LYS LYS A . n A 1 173 GLU 173 173 173 GLU GLU A . n A 1 174 SER 174 174 174 SER SER A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MG 1 201 1 MG MG A . C 2 MG 1 202 2 MG MG A . D 2 MG 1 203 3 MG MG A . E 2 MG 1 204 4 MG MG A . F 2 MG 1 205 5 MG MG A . G 2 MG 1 206 6 MG MG A . H 2 MG 1 207 7 MG MG A . I 2 MG 1 208 8 MG MG A . J 2 MG 1 209 9 MG MG A . K 3 CL 1 210 1 CL CL A . L 3 CL 1 211 2 CL CL A . M 3 CL 1 212 3 CL CL A . N 3 CL 1 213 4 CL CL A . O 3 CL 1 214 5 CL CL A . P 3 CL 1 215 6 CL CL A . Q 3 CL 1 216 7 CL CL A . R 3 CL 1 217 8 CL CL A . S 3 CL 1 218 9 CL CL A . T 3 CL 1 219 10 CL CL A . U 3 CL 1 220 11 CL CL A . V 4 HOH 1 301 2 HOH HOH A . V 4 HOH 2 302 3 HOH HOH A . V 4 HOH 3 303 219 HOH HOH A . V 4 HOH 4 304 5 HOH HOH A . V 4 HOH 5 305 6 HOH HOH A . V 4 HOH 6 306 7 HOH HOH A . V 4 HOH 7 307 8 HOH HOH A . V 4 HOH 8 308 9 HOH HOH A . V 4 HOH 9 309 10 HOH HOH A . V 4 HOH 10 310 11 HOH HOH A . V 4 HOH 11 311 12 HOH HOH A . V 4 HOH 12 312 13 HOH HOH A . V 4 HOH 13 313 14 HOH HOH A . V 4 HOH 14 314 16 HOH HOH A . V 4 HOH 15 315 17 HOH HOH A . V 4 HOH 16 316 18 HOH HOH A . V 4 HOH 17 317 19 HOH HOH A . V 4 HOH 18 318 20 HOH HOH A . V 4 HOH 19 319 21 HOH HOH A . V 4 HOH 20 320 22 HOH HOH A . V 4 HOH 21 321 23 HOH HOH A . V 4 HOH 22 322 24 HOH HOH A . V 4 HOH 23 323 25 HOH HOH A . V 4 HOH 24 324 26 HOH HOH A . V 4 HOH 25 325 27 HOH HOH A . V 4 HOH 26 326 28 HOH HOH A . V 4 HOH 27 327 29 HOH HOH A . V 4 HOH 28 328 40 HOH HOH A . V 4 HOH 29 329 30 HOH HOH A . V 4 HOH 30 330 31 HOH HOH A . V 4 HOH 31 331 32 HOH HOH A . V 4 HOH 32 332 33 HOH HOH A . V 4 HOH 33 333 34 HOH HOH A . V 4 HOH 34 334 35 HOH HOH A . V 4 HOH 35 335 36 HOH HOH A . V 4 HOH 36 336 37 HOH HOH A . V 4 HOH 37 337 38 HOH HOH A . V 4 HOH 38 338 39 HOH HOH A . V 4 HOH 39 339 41 HOH HOH A . V 4 HOH 40 340 43 HOH HOH A . V 4 HOH 41 341 44 HOH HOH A . V 4 HOH 42 342 45 HOH HOH A . V 4 HOH 43 343 46 HOH HOH A . V 4 HOH 44 344 47 HOH HOH A . V 4 HOH 45 345 48 HOH HOH A . V 4 HOH 46 346 49 HOH HOH A . V 4 HOH 47 347 50 HOH HOH A . V 4 HOH 48 348 51 HOH HOH A . V 4 HOH 49 349 52 HOH HOH A . V 4 HOH 50 350 53 HOH HOH A . V 4 HOH 51 351 54 HOH HOH A . V 4 HOH 52 352 55 HOH HOH A . V 4 HOH 53 353 56 HOH HOH A . V 4 HOH 54 354 57 HOH HOH A . V 4 HOH 55 355 58 HOH HOH A . V 4 HOH 56 356 59 HOH HOH A . V 4 HOH 57 357 60 HOH HOH A . V 4 HOH 58 358 61 HOH HOH A . V 4 HOH 59 359 62 HOH HOH A . V 4 HOH 60 360 64 HOH HOH A . V 4 HOH 61 361 65 HOH HOH A . V 4 HOH 62 362 66 HOH HOH A . V 4 HOH 63 363 15 HOH HOH A . V 4 HOH 64 364 67 HOH HOH A . V 4 HOH 65 365 68 HOH HOH A . V 4 HOH 66 366 4 HOH HOH A . V 4 HOH 67 367 70 HOH HOH A . V 4 HOH 68 368 69 HOH HOH A . V 4 HOH 69 369 83 HOH HOH A . V 4 HOH 70 370 71 HOH HOH A . V 4 HOH 71 371 72 HOH HOH A . V 4 HOH 72 372 73 HOH HOH A . V 4 HOH 73 373 74 HOH HOH A . V 4 HOH 74 374 75 HOH HOH A . V 4 HOH 75 375 76 HOH HOH A . V 4 HOH 76 376 78 HOH HOH A . V 4 HOH 77 377 79 HOH HOH A . V 4 HOH 78 378 80 HOH HOH A . V 4 HOH 79 379 81 HOH HOH A . V 4 HOH 80 380 82 HOH HOH A . V 4 HOH 81 381 84 HOH HOH A . V 4 HOH 82 382 85 HOH HOH A . V 4 HOH 83 383 86 HOH HOH A . V 4 HOH 84 384 87 HOH HOH A . V 4 HOH 85 385 88 HOH HOH A . V 4 HOH 86 386 89 HOH HOH A . V 4 HOH 87 387 63 HOH HOH A . V 4 HOH 88 388 90 HOH HOH A . V 4 HOH 89 389 91 HOH HOH A . V 4 HOH 90 390 92 HOH HOH A . V 4 HOH 91 391 93 HOH HOH A . V 4 HOH 92 392 94 HOH HOH A . V 4 HOH 93 393 95 HOH HOH A . V 4 HOH 94 394 96 HOH HOH A . V 4 HOH 95 395 97 HOH HOH A . V 4 HOH 96 396 98 HOH HOH A . V 4 HOH 97 397 99 HOH HOH A . V 4 HOH 98 398 100 HOH HOH A . V 4 HOH 99 399 101 HOH HOH A . V 4 HOH 100 400 102 HOH HOH A . V 4 HOH 101 401 103 HOH HOH A . V 4 HOH 102 402 104 HOH HOH A . V 4 HOH 103 403 105 HOH HOH A . V 4 HOH 104 404 106 HOH HOH A . V 4 HOH 105 405 107 HOH HOH A . V 4 HOH 106 406 109 HOH HOH A . V 4 HOH 107 407 110 HOH HOH A . V 4 HOH 108 408 111 HOH HOH A . V 4 HOH 109 409 112 HOH HOH A . V 4 HOH 110 410 114 HOH HOH A . V 4 HOH 111 411 115 HOH HOH A . V 4 HOH 112 412 113 HOH HOH A . V 4 HOH 113 413 116 HOH HOH A . V 4 HOH 114 414 1 HOH HOH A . V 4 HOH 115 415 117 HOH HOH A . V 4 HOH 116 416 118 HOH HOH A . V 4 HOH 117 417 119 HOH HOH A . V 4 HOH 118 418 120 HOH HOH A . V 4 HOH 119 419 121 HOH HOH A . V 4 HOH 120 420 122 HOH HOH A . V 4 HOH 121 421 77 HOH HOH A . V 4 HOH 122 422 123 HOH HOH A . V 4 HOH 123 423 124 HOH HOH A . V 4 HOH 124 424 125 HOH HOH A . V 4 HOH 125 425 126 HOH HOH A . V 4 HOH 126 426 108 HOH HOH A . V 4 HOH 127 427 127 HOH HOH A . V 4 HOH 128 428 128 HOH HOH A . V 4 HOH 129 429 129 HOH HOH A . V 4 HOH 130 430 130 HOH HOH A . V 4 HOH 131 431 131 HOH HOH A . V 4 HOH 132 432 132 HOH HOH A . V 4 HOH 133 433 133 HOH HOH A . V 4 HOH 134 434 134 HOH HOH A . V 4 HOH 135 435 135 HOH HOH A . V 4 HOH 136 436 136 HOH HOH A . V 4 HOH 137 437 137 HOH HOH A . V 4 HOH 138 438 138 HOH HOH A . V 4 HOH 139 439 139 HOH HOH A . V 4 HOH 140 440 140 HOH HOH A . V 4 HOH 141 441 141 HOH HOH A . V 4 HOH 142 442 142 HOH HOH A . V 4 HOH 143 443 42 HOH HOH A . V 4 HOH 144 444 143 HOH HOH A . V 4 HOH 145 445 144 HOH HOH A . V 4 HOH 146 446 148 HOH HOH A . V 4 HOH 147 447 145 HOH HOH A . V 4 HOH 148 448 146 HOH HOH A . V 4 HOH 149 449 147 HOH HOH A . V 4 HOH 150 450 149 HOH HOH A . V 4 HOH 151 451 150 HOH HOH A . V 4 HOH 152 452 151 HOH HOH A . V 4 HOH 153 453 152 HOH HOH A . V 4 HOH 154 454 153 HOH HOH A . V 4 HOH 155 455 154 HOH HOH A . V 4 HOH 156 456 155 HOH HOH A . V 4 HOH 157 457 156 HOH HOH A . V 4 HOH 158 458 157 HOH HOH A . V 4 HOH 159 459 158 HOH HOH A . V 4 HOH 160 460 159 HOH HOH A . V 4 HOH 161 461 160 HOH HOH A . V 4 HOH 162 462 161 HOH HOH A . V 4 HOH 163 463 162 HOH HOH A . V 4 HOH 164 464 163 HOH HOH A . V 4 HOH 165 465 164 HOH HOH A . V 4 HOH 166 466 165 HOH HOH A . V 4 HOH 167 467 166 HOH HOH A . V 4 HOH 168 468 167 HOH HOH A . V 4 HOH 169 469 168 HOH HOH A . V 4 HOH 170 470 169 HOH HOH A . V 4 HOH 171 471 170 HOH HOH A . V 4 HOH 172 472 171 HOH HOH A . V 4 HOH 173 473 172 HOH HOH A . V 4 HOH 174 474 173 HOH HOH A . V 4 HOH 175 475 174 HOH HOH A . V 4 HOH 176 476 175 HOH HOH A . V 4 HOH 177 477 176 HOH HOH A . V 4 HOH 178 478 177 HOH HOH A . V 4 HOH 179 479 178 HOH HOH A . V 4 HOH 180 480 179 HOH HOH A . V 4 HOH 181 481 180 HOH HOH A . V 4 HOH 182 482 181 HOH HOH A . V 4 HOH 183 483 182 HOH HOH A . V 4 HOH 184 484 183 HOH HOH A . V 4 HOH 185 485 184 HOH HOH A . V 4 HOH 186 486 185 HOH HOH A . V 4 HOH 187 487 186 HOH HOH A . V 4 HOH 188 488 187 HOH HOH A . V 4 HOH 189 489 188 HOH HOH A . V 4 HOH 190 490 189 HOH HOH A . V 4 HOH 191 491 190 HOH HOH A . V 4 HOH 192 492 191 HOH HOH A . V 4 HOH 193 493 192 HOH HOH A . V 4 HOH 194 494 193 HOH HOH A . V 4 HOH 195 495 194 HOH HOH A . V 4 HOH 196 496 195 HOH HOH A . V 4 HOH 197 497 196 HOH HOH A . V 4 HOH 198 498 197 HOH HOH A . V 4 HOH 199 499 198 HOH HOH A . V 4 HOH 200 500 199 HOH HOH A . V 4 HOH 201 501 200 HOH HOH A . V 4 HOH 202 502 201 HOH HOH A . V 4 HOH 203 503 202 HOH HOH A . V 4 HOH 204 504 203 HOH HOH A . V 4 HOH 205 505 204 HOH HOH A . V 4 HOH 206 506 205 HOH HOH A . V 4 HOH 207 507 206 HOH HOH A . V 4 HOH 208 508 207 HOH HOH A . V 4 HOH 209 509 208 HOH HOH A . V 4 HOH 210 510 209 HOH HOH A . V 4 HOH 211 511 210 HOH HOH A . V 4 HOH 212 512 211 HOH HOH A . V 4 HOH 213 513 212 HOH HOH A . V 4 HOH 214 514 213 HOH HOH A . V 4 HOH 215 515 214 HOH HOH A . V 4 HOH 216 516 215 HOH HOH A . V 4 HOH 217 517 216 HOH HOH A . V 4 HOH 218 518 217 HOH HOH A . V 4 HOH 219 519 218 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? '5.8.0431 (REFMACAT 0.4.105)' ? 1 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? . ? 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . ? 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . ? 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . ? 5 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 9WX5 _cell.details ? _cell.formula_units_Z ? _cell.length_a 184.032 _cell.length_a_esd ? _cell.length_b 184.032 _cell.length_b_esd ? _cell.length_c 184.032 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 96 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9WX5 _symmetry.cell_setting ? _symmetry.Int_Tables_number 209 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'F 4 3 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9WX5 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.28 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 61.46 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '2.0 M MgCl2 and 100 mM Bicine (pH 9.0)' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 277.15 # _diffrn.ambient_environment ? _diffrn.ambient_temp 103 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'MARMOSAIC 225 mm CCD' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-05-13 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9794 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'RRCAT INDUS-2 BEAMLINE PX-BL21' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9794 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline PX-BL21 _diffrn_source.pdbx_synchrotron_site 'RRCAT INDUS-2' # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 9WX5 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.50 _reflns.d_resolution_low 41.19 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 43133 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 14.2 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 27.3 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1.00 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.50 _reflns_shell.d_res_low 1.53 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 3127 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.963 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] 0.00000 _refine.aniso_B[1][2] 0.00000 _refine.aniso_B[1][3] 0.00000 _refine.aniso_B[2][2] 0.00000 _refine.aniso_B[2][3] 0.00000 _refine.aniso_B[3][3] 0.00000 _refine.B_iso_max ? _refine.B_iso_mean 13.05 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.975 _refine.correlation_coeff_Fo_to_Fc_free 0.967 _refine.details ;HYDROGENS HAVE BEEN ADDED IN THEIR RIDING POSITIONS ; _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9WX5 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.50 _refine.ls_d_res_low 41.19 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 40992 _refine.ls_number_reflns_R_free 2141 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.9 _refine.ls_percent_reflns_R_free 4.964 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.163 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.128 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'MASK BULK SOLVENT' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3KA3 _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.053 _refine.pdbx_overall_ESU_R_Free 0.052 _refine.pdbx_solvent_vdw_probe_radii 1.40 _refine.pdbx_solvent_ion_probe_radii 0.90 _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.50 _refine_hist.d_res_low 41.19 _refine_hist.number_atoms_solvent 219 _refine_hist.number_atoms_total 1669 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1430 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 20 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.019 0.016 1621 ? r_bond_refined_d ? ? ? 'X-RAY DIFFRACTION' ? 0.000 0.016 1529 ? r_bond_other_d ? ? ? 'X-RAY DIFFRACTION' ? 1.984 1.813 2217 ? r_angle_refined_deg ? ? ? 'X-RAY DIFFRACTION' ? 0.809 1.575 3541 ? r_angle_other_deg ? ? ? 'X-RAY DIFFRACTION' ? 4.922 5.201 224 ? r_dihedral_angle_1_deg ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_dihedral_angle_2_deg ? ? ? 'X-RAY DIFFRACTION' ? 14.339 10.000 318 ? r_dihedral_angle_3_deg ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_dihedral_angle_4_deg ? ? ? 'X-RAY DIFFRACTION' ? 0.137 0.200 232 ? r_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.010 0.020 1958 ? r_gen_planes_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.020 0.020 382 ? r_gen_planes_other ? ? ? 'X-RAY DIFFRACTION' ? 0.246 0.200 354 ? r_nbd_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.281 0.200 124 ? r_nbd_other ? ? ? 'X-RAY DIFFRACTION' ? 0.189 0.200 749 ? r_nbtor_refined ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? ? 'X-RAY DIFFRACTION' ? 0.254 0.200 128 ? r_xyhbond_nbd_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.022 0.200 2 ? r_xyhbond_nbd_other ? ? ? 'X-RAY DIFFRACTION' ? 0.134 0.200 6 ? r_metal_ion_refined ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? ? 'X-RAY DIFFRACTION' ? 0.107 0.200 4 ? r_symmetry_metal_ion_refined ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? ? 'X-RAY DIFFRACTION' ? 3.745 1.020 745 ? r_mcbond_it ? ? ? 'X-RAY DIFFRACTION' ? 4.067 73.511 745 ? r_mcbond_other ? ? ? 'X-RAY DIFFRACTION' ? 4.842 1.839 942 ? r_mcangle_it ? ? ? 'X-RAY DIFFRACTION' ? 4.951 2.275 943 ? r_mcangle_other ? ? ? 'X-RAY DIFFRACTION' ? 6.537 1.279 876 ? r_scbond_it ? ? ? 'X-RAY DIFFRACTION' ? 6.754 97.105 877 ? r_scbond_other ? ? ? 'X-RAY DIFFRACTION' ? 8.639 2.247 1250 ? r_scangle_it ? ? ? 'X-RAY DIFFRACTION' ? 8.635 2.250 1251 ? r_scangle_other ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_long_range_B_refined ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_long_range_B_other ? ? ? 'X-RAY DIFFRACTION' ? 3.630 3.000 1621 ? r_rigid_bond_restr ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.50 _refine_ls_shell.d_res_low 1.54 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 155 _refine_ls_shell.number_reflns_R_work 2950 _refine_ls_shell.percent_reflns_obs 99.87 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.1650 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.correlation_coeff_Fo_to_Fc ? _refine_ls_shell.correlation_coeff_Fo_to_Fc_free ? _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work ? _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? _refine_ls_shell.R_factor_R_free 0.2410 # _struct.entry_id 9WX5 _struct.title 'Crystal structure of frog M-ferritin E130A_M161E mutant' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9WX5 _struct_keywords.text 'Iron binding and transport, METAL TRANSPORT' _struct_keywords.pdbx_keywords 'METAL TRANSPORT' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 2 ? F N N 2 ? G N N 2 ? H N N 2 ? I N N 2 ? J N N 2 ? K N N 3 ? L N N 3 ? M N N 3 ? N N N 3 ? O N N 3 ? P N N 3 ? Q N N 3 ? R N N 3 ? S N N 3 ? T N N 3 ? U N N 3 ? V N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FRI2_AQUCT _struct_ref.pdbx_db_accession P07798 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;VSQVRQNYHSDCEAAVNRMLNLELYASYTYSSMYAFFDRDDVALHNVAEFFKEHSHEEREHAEKFMKYQNKRGGRVVLQD IKKPERDEWGNTLEAMQAALQLEKTVNQALLDLHKLATDKVDPHLCDFLESEYLEEQVKDIKRIGDFITNLKRLGLPENG MGEYLFDKHSVKES ; _struct_ref.pdbx_align_begin 2 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9WX5 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 174 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P07798 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 175 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 174 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9WX5 ALA A 130 ? UNP P07798 GLU 131 'engineered mutation' 130 1 1 9WX5 GLU A 161 ? UNP P07798 MET 162 'engineered mutation' 161 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details 24-meric _pdbx_struct_assembly.oligomeric_count 24 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 91610 ? 1 MORE -272 ? 1 'SSA (A^2)' 137130 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_575 -x,-y+2,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 368.0640000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_557 -x,y,-z+2 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 368.0640000000 4 'crystal symmetry operation' 4_577 x,-y+2,-z+2 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 368.0640000000 0.0000000000 0.0000000000 -1.0000000000 368.0640000000 5 'crystal symmetry operation' 5_465 z-1,x+1,y 0.0000000000 0.0000000000 1.0000000000 -184.0320000000 1.0000000000 0.0000000000 0.0000000000 184.0320000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 6 'crystal symmetry operation' 6_467 z-1,-x+1,-y+2 0.0000000000 0.0000000000 1.0000000000 -184.0320000000 -1.0000000000 0.0000000000 0.0000000000 184.0320000000 0.0000000000 -1.0000000000 0.0000000000 368.0640000000 7 'crystal symmetry operation' 7_665 -z+1,-x+1,y 0.0000000000 0.0000000000 -1.0000000000 184.0320000000 -1.0000000000 0.0000000000 0.0000000000 184.0320000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 8 'crystal symmetry operation' 8_667 -z+1,x+1,-y+2 0.0000000000 0.0000000000 -1.0000000000 184.0320000000 1.0000000000 0.0000000000 0.0000000000 184.0320000000 0.0000000000 -1.0000000000 0.0000000000 368.0640000000 9 'crystal symmetry operation' 9_456 y-1,z,x+1 0.0000000000 1.0000000000 0.0000000000 -184.0320000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 184.0320000000 10 'crystal symmetry operation' 10_656 -y+1,z,-x+1 0.0000000000 -1.0000000000 0.0000000000 184.0320000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 184.0320000000 11 'crystal symmetry operation' 11_476 y-1,-z+2,-x+1 0.0000000000 1.0000000000 0.0000000000 -184.0320000000 0.0000000000 0.0000000000 -1.0000000000 368.0640000000 -1.0000000000 0.0000000000 0.0000000000 184.0320000000 12 'crystal symmetry operation' 12_676 -y+1,-z+2,x+1 0.0000000000 -1.0000000000 0.0000000000 184.0320000000 0.0000000000 0.0000000000 -1.0000000000 368.0640000000 1.0000000000 0.0000000000 0.0000000000 184.0320000000 13 'crystal symmetry operation' 13_467 y-1,x+1,-z+2 0.0000000000 1.0000000000 0.0000000000 -184.0320000000 1.0000000000 0.0000000000 0.0000000000 184.0320000000 0.0000000000 0.0000000000 -1.0000000000 368.0640000000 14 'crystal symmetry operation' 14_667 -y+1,-x+1,-z+2 0.0000000000 -1.0000000000 0.0000000000 184.0320000000 -1.0000000000 0.0000000000 0.0000000000 184.0320000000 0.0000000000 0.0000000000 -1.0000000000 368.0640000000 15 'crystal symmetry operation' 15_465 y-1,-x+1,z 0.0000000000 1.0000000000 0.0000000000 -184.0320000000 -1.0000000000 0.0000000000 0.0000000000 184.0320000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 16 'crystal symmetry operation' 16_665 -y+1,x+1,z 0.0000000000 -1.0000000000 0.0000000000 184.0320000000 1.0000000000 0.0000000000 0.0000000000 184.0320000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 17 'crystal symmetry operation' 17_557 x,z,-y+2 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 368.0640000000 18 'crystal symmetry operation' 18_555 -x,z,y -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 19 'crystal symmetry operation' 19_577 -x,-z+2,-y+2 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 368.0640000000 0.0000000000 -1.0000000000 0.0000000000 368.0640000000 20 'crystal symmetry operation' 20_575 x,-z+2,y 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 368.0640000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 21 'crystal symmetry operation' 21_456 z-1,y,-x+1 0.0000000000 0.0000000000 1.0000000000 -184.0320000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 184.0320000000 22 'crystal symmetry operation' 22_476 z-1,-y+2,x+1 0.0000000000 0.0000000000 1.0000000000 -184.0320000000 0.0000000000 -1.0000000000 0.0000000000 368.0640000000 1.0000000000 0.0000000000 0.0000000000 184.0320000000 23 'crystal symmetry operation' 23_656 -z+1,y,x+1 0.0000000000 0.0000000000 -1.0000000000 184.0320000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 184.0320000000 24 'crystal symmetry operation' 24_676 -z+1,-y+2,-x+1 0.0000000000 0.0000000000 -1.0000000000 184.0320000000 0.0000000000 -1.0000000000 0.0000000000 368.0640000000 -1.0000000000 0.0000000000 0.0000000000 184.0320000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 HIS A 9 ? ASP A 38 ? HIS A 9 ASP A 38 1 ? 30 HELX_P HELX_P2 AA2 LEU A 44 ? GLY A 73 ? LEU A 44 GLY A 73 1 ? 30 HELX_P HELX_P3 AA3 ASN A 91 ? LYS A 120 ? ASN A 91 LYS A 120 1 ? 30 HELX_P HELX_P4 AA4 ASP A 122 ? TYR A 133 ? ASP A 122 TYR A 133 1 ? 12 HELX_P HELX_P5 AA5 TYR A 133 ? LEU A 154 ? TYR A 133 LEU A 154 1 ? 22 HELX_P HELX_P6 AA6 ASN A 159 ? SER A 170 ? ASN A 159 SER A 170 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A SER 10 OG A ? ? 1_555 J MG . MG ? ? A SER 10 A MG 209 1_555 ? ? ? ? ? ? ? 2.151 ? ? metalc2 metalc ? ? A GLU 57 OE2 ? ? ? 1_555 E MG . MG ? ? A GLU 57 A MG 204 1_555 ? ? ? ? ? ? ? 1.941 ? ? metalc3 metalc ? ? A GLU 103 OE1 ? ? ? 1_555 H MG . MG ? ? A GLU 103 A MG 207 1_555 ? ? ? ? ? ? ? 1.821 ? ? metalc4 metalc ? ? A GLU 103 OE2 ? ? ? 1_555 H MG . MG ? ? A GLU 103 A MG 207 1_555 ? ? ? ? ? ? ? 2.746 ? ? metalc5 metalc ? ? A GLU 136 OE1 ? ? ? 1_555 E MG . MG ? ? A GLU 136 A MG 204 1_555 ? ? ? ? ? ? ? 1.985 ? ? metalc6 metalc ? ? A GLU 136 OE2 ? ? ? 1_555 G MG . MG ? ? A GLU 136 A MG 206 1_555 ? ? ? ? ? ? ? 1.986 ? ? metalc7 metalc ? ? A GLN 137 OE1 ? ? ? 1_555 G MG . MG ? ? A GLN 137 A MG 206 1_555 ? ? ? ? ? ? ? 1.954 ? ? metalc8 metalc ? ? A ASP 140 OD2 ? ? ? 1_555 E MG . MG ? ? A ASP 140 A MG 204 1_555 ? ? ? ? ? ? ? 2.230 ? ? metalc9 metalc ? ? A GLU 161 OE1 B ? ? 1_555 I MG . MG ? ? A GLU 161 A MG 208 1_555 ? ? ? ? ? ? ? 2.528 ? ? metalc10 metalc ? ? A GLU 161 OE1 B ? ? 1_555 I MG . MG ? ? A GLU 161 A MG 208 15_465 ? ? ? ? ? ? ? 2.528 ? ? metalc11 metalc ? ? D MG . MG ? ? ? 1_555 V HOH . O ? ? A MG 203 A HOH 464 1_555 ? ? ? ? ? ? ? 2.105 ? ? metalc12 metalc ? ? D MG . MG ? ? ? 1_555 V HOH . O ? ? A MG 203 A HOH 464 70_475 ? ? ? ? ? ? ? 2.105 ? ? metalc13 metalc ? ? D MG . MG ? ? ? 1_555 V HOH . O ? ? A MG 203 A HOH 474 1_555 ? ? ? ? ? ? ? 2.081 ? ? metalc14 metalc ? ? D MG . MG ? ? ? 1_555 V HOH . O ? ? A MG 203 A HOH 474 70_475 ? ? ? ? ? ? ? 2.081 ? ? metalc15 metalc ? ? D MG . MG ? ? ? 1_555 V HOH . O ? ? A MG 203 A HOH 492 1_555 ? ? ? ? ? ? ? 2.124 ? ? metalc16 metalc ? ? D MG . MG ? ? ? 1_555 V HOH . O ? ? A MG 203 A HOH 492 70_475 ? ? ? ? ? ? ? 2.124 ? ? metalc17 metalc ? ? D MG . MG ? ? ? 1_555 V HOH . O ? ? A MG 203 A HOH 517 1_555 ? ? ? ? ? ? ? 2.002 ? ? metalc18 metalc ? ? D MG . MG ? ? ? 1_555 V HOH . O ? ? A MG 203 A HOH 517 70_475 ? ? ? ? ? ? ? 2.002 ? ? metalc19 metalc ? ? E MG . MG ? ? ? 1_555 V HOH . O ? ? A MG 204 A HOH 305 1_555 ? ? ? ? ? ? ? 1.995 ? ? metalc20 metalc ? ? E MG . MG ? ? ? 1_555 V HOH . O ? ? A MG 204 A HOH 358 1_555 ? ? ? ? ? ? ? 2.030 ? ? metalc21 metalc ? ? E MG . MG ? ? ? 1_555 V HOH . O ? ? A MG 204 A HOH 422 1_555 ? ? ? ? ? ? ? 2.095 ? ? metalc22 metalc ? ? G MG . MG ? ? ? 1_555 V HOH . O ? ? A MG 206 A HOH 304 1_555 ? ? ? ? ? ? ? 1.865 ? ? metalc23 metalc ? ? G MG . MG ? ? ? 1_555 V HOH . O ? ? A MG 206 A HOH 325 1_555 ? ? ? ? ? ? ? 2.456 ? ? metalc24 metalc ? ? G MG . MG ? ? ? 1_555 V HOH . O ? ? A MG 206 A HOH 375 1_555 ? ? ? ? ? ? ? 2.061 ? ? metalc25 metalc ? ? H MG . MG ? ? ? 1_555 V HOH . O ? ? A MG 207 A HOH 302 1_555 ? ? ? ? ? ? ? 2.704 ? ? metalc26 metalc ? ? H MG . MG ? ? ? 1_555 V HOH . O ? ? A MG 207 A HOH 304 1_555 ? ? ? ? ? ? ? 2.588 ? ? metalc27 metalc ? ? H MG . MG ? ? ? 1_555 V HOH . O ? ? A MG 207 A HOH 325 1_555 ? ? ? ? ? ? ? 1.966 ? ? metalc28 metalc ? ? J MG . MG ? ? ? 1_555 V HOH . O ? ? A MG 209 A HOH 342 1_555 ? ? ? ? ? ? ? 2.079 ? ? metalc29 metalc ? ? J MG . MG ? ? ? 1_555 V HOH . O ? ? A MG 209 A HOH 399 1_555 ? ? ? ? ? ? ? 2.117 ? ? metalc30 metalc ? ? J MG . MG ? ? ? 1_555 V HOH . O ? ? A MG 209 A HOH 416 1_555 ? ? ? ? ? ? ? 2.128 ? ? metalc31 metalc ? ? J MG . MG ? ? ? 1_555 V HOH . O ? ? A MG 209 A HOH 417 1_555 ? ? ? ? ? ? ? 2.029 ? ? metalc32 metalc ? ? J MG . MG ? ? ? 1_555 V HOH . O ? ? A MG 209 A HOH 488 1_555 ? ? ? ? ? ? ? 2.028 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OG A A SER 10 ? A SER 10 ? 1_555 MG ? J MG . ? A MG 209 ? 1_555 O ? V HOH . ? A HOH 342 ? 1_555 95.1 ? 2 OG A A SER 10 ? A SER 10 ? 1_555 MG ? J MG . ? A MG 209 ? 1_555 O ? V HOH . ? A HOH 399 ? 1_555 87.1 ? 3 O ? V HOH . ? A HOH 342 ? 1_555 MG ? J MG . ? A MG 209 ? 1_555 O ? V HOH . ? A HOH 399 ? 1_555 94.3 ? 4 OG A A SER 10 ? A SER 10 ? 1_555 MG ? J MG . ? A MG 209 ? 1_555 O ? V HOH . ? A HOH 416 ? 1_555 85.0 ? 5 O ? V HOH . ? A HOH 342 ? 1_555 MG ? J MG . ? A MG 209 ? 1_555 O ? V HOH . ? A HOH 416 ? 1_555 179.6 ? 6 O ? V HOH . ? A HOH 399 ? 1_555 MG ? J MG . ? A MG 209 ? 1_555 O ? V HOH . ? A HOH 416 ? 1_555 85.3 ? 7 OG A A SER 10 ? A SER 10 ? 1_555 MG ? J MG . ? A MG 209 ? 1_555 O ? V HOH . ? A HOH 417 ? 1_555 87.7 ? 8 O ? V HOH . ? A HOH 342 ? 1_555 MG ? J MG . ? A MG 209 ? 1_555 O ? V HOH . ? A HOH 417 ? 1_555 89.4 ? 9 O ? V HOH . ? A HOH 399 ? 1_555 MG ? J MG . ? A MG 209 ? 1_555 O ? V HOH . ? A HOH 417 ? 1_555 173.9 ? 10 O ? V HOH . ? A HOH 416 ? 1_555 MG ? J MG . ? A MG 209 ? 1_555 O ? V HOH . ? A HOH 417 ? 1_555 90.9 ? 11 OG A A SER 10 ? A SER 10 ? 1_555 MG ? J MG . ? A MG 209 ? 1_555 O ? V HOH . ? A HOH 488 ? 1_555 178.0 ? 12 O ? V HOH . ? A HOH 342 ? 1_555 MG ? J MG . ? A MG 209 ? 1_555 O ? V HOH . ? A HOH 488 ? 1_555 86.2 ? 13 O ? V HOH . ? A HOH 399 ? 1_555 MG ? J MG . ? A MG 209 ? 1_555 O ? V HOH . ? A HOH 488 ? 1_555 91.2 ? 14 O ? V HOH . ? A HOH 416 ? 1_555 MG ? J MG . ? A MG 209 ? 1_555 O ? V HOH . ? A HOH 488 ? 1_555 93.7 ? 15 O ? V HOH . ? A HOH 417 ? 1_555 MG ? J MG . ? A MG 209 ? 1_555 O ? V HOH . ? A HOH 488 ? 1_555 93.9 ? 16 OE2 ? A GLU 57 ? A GLU 57 ? 1_555 MG ? E MG . ? A MG 204 ? 1_555 OE1 ? A GLU 136 ? A GLU 136 ? 1_555 86.3 ? 17 OE2 ? A GLU 57 ? A GLU 57 ? 1_555 MG ? E MG . ? A MG 204 ? 1_555 OD2 ? A ASP 140 ? A ASP 140 ? 1_555 94.2 ? 18 OE1 ? A GLU 136 ? A GLU 136 ? 1_555 MG ? E MG . ? A MG 204 ? 1_555 OD2 ? A ASP 140 ? A ASP 140 ? 1_555 83.4 ? 19 OE2 ? A GLU 57 ? A GLU 57 ? 1_555 MG ? E MG . ? A MG 204 ? 1_555 O ? V HOH . ? A HOH 305 ? 1_555 94.5 ? 20 OE1 ? A GLU 136 ? A GLU 136 ? 1_555 MG ? E MG . ? A MG 204 ? 1_555 O ? V HOH . ? A HOH 305 ? 1_555 173.7 ? 21 OD2 ? A ASP 140 ? A ASP 140 ? 1_555 MG ? E MG . ? A MG 204 ? 1_555 O ? V HOH . ? A HOH 305 ? 1_555 90.3 ? 22 OE2 ? A GLU 57 ? A GLU 57 ? 1_555 MG ? E MG . ? A MG 204 ? 1_555 O ? V HOH . ? A HOH 358 ? 1_555 87.8 ? 23 OE1 ? A GLU 136 ? A GLU 136 ? 1_555 MG ? E MG . ? A MG 204 ? 1_555 O ? V HOH . ? A HOH 358 ? 1_555 96.3 ? 24 OD2 ? A ASP 140 ? A ASP 140 ? 1_555 MG ? E MG . ? A MG 204 ? 1_555 O ? V HOH . ? A HOH 358 ? 1_555 178.0 ? 25 O ? V HOH . ? A HOH 305 ? 1_555 MG ? E MG . ? A MG 204 ? 1_555 O ? V HOH . ? A HOH 358 ? 1_555 89.9 ? 26 OE2 ? A GLU 57 ? A GLU 57 ? 1_555 MG ? E MG . ? A MG 204 ? 1_555 O ? V HOH . ? A HOH 422 ? 1_555 174.3 ? 27 OE1 ? A GLU 136 ? A GLU 136 ? 1_555 MG ? E MG . ? A MG 204 ? 1_555 O ? V HOH . ? A HOH 422 ? 1_555 96.9 ? 28 OD2 ? A ASP 140 ? A ASP 140 ? 1_555 MG ? E MG . ? A MG 204 ? 1_555 O ? V HOH . ? A HOH 422 ? 1_555 90.8 ? 29 O ? V HOH . ? A HOH 305 ? 1_555 MG ? E MG . ? A MG 204 ? 1_555 O ? V HOH . ? A HOH 422 ? 1_555 82.9 ? 30 O ? V HOH . ? A HOH 358 ? 1_555 MG ? E MG . ? A MG 204 ? 1_555 O ? V HOH . ? A HOH 422 ? 1_555 87.2 ? 31 OE1 ? A GLU 103 ? A GLU 103 ? 1_555 MG ? H MG . ? A MG 207 ? 1_555 OE2 ? A GLU 103 ? A GLU 103 ? 1_555 51.9 ? 32 OE1 ? A GLU 103 ? A GLU 103 ? 1_555 MG ? H MG . ? A MG 207 ? 1_555 O ? V HOH . ? A HOH 302 ? 1_555 107.0 ? 33 OE2 ? A GLU 103 ? A GLU 103 ? 1_555 MG ? H MG . ? A MG 207 ? 1_555 O ? V HOH . ? A HOH 302 ? 1_555 56.9 ? 34 OE1 ? A GLU 103 ? A GLU 103 ? 1_555 MG ? H MG . ? A MG 207 ? 1_555 O ? V HOH . ? A HOH 304 ? 1_555 166.9 ? 35 OE2 ? A GLU 103 ? A GLU 103 ? 1_555 MG ? H MG . ? A MG 207 ? 1_555 O ? V HOH . ? A HOH 304 ? 1_555 133.9 ? 36 O ? V HOH . ? A HOH 302 ? 1_555 MG ? H MG . ? A MG 207 ? 1_555 O ? V HOH . ? A HOH 304 ? 1_555 82.8 ? 37 OE1 ? A GLU 103 ? A GLU 103 ? 1_555 MG ? H MG . ? A MG 207 ? 1_555 O ? V HOH . ? A HOH 325 ? 1_555 91.3 ? 38 OE2 ? A GLU 103 ? A GLU 103 ? 1_555 MG ? H MG . ? A MG 207 ? 1_555 O ? V HOH . ? A HOH 325 ? 1_555 95.4 ? 39 O ? V HOH . ? A HOH 302 ? 1_555 MG ? H MG . ? A MG 207 ? 1_555 O ? V HOH . ? A HOH 325 ? 1_555 110.0 ? 40 O ? V HOH . ? A HOH 304 ? 1_555 MG ? H MG . ? A MG 207 ? 1_555 O ? V HOH . ? A HOH 325 ? 1_555 76.9 ? 41 OE2 ? A GLU 136 ? A GLU 136 ? 1_555 MG ? G MG . ? A MG 206 ? 1_555 OE1 ? A GLN 137 ? A GLN 137 ? 1_555 93.9 ? 42 OE2 ? A GLU 136 ? A GLU 136 ? 1_555 MG ? G MG . ? A MG 206 ? 1_555 O ? V HOH . ? A HOH 304 ? 1_555 97.6 ? 43 OE1 ? A GLN 137 ? A GLN 137 ? 1_555 MG ? G MG . ? A MG 206 ? 1_555 O ? V HOH . ? A HOH 304 ? 1_555 163.4 ? 44 OE2 ? A GLU 136 ? A GLU 136 ? 1_555 MG ? G MG . ? A MG 206 ? 1_555 O ? V HOH . ? A HOH 325 ? 1_555 178.7 ? 45 OE1 ? A GLN 137 ? A GLN 137 ? 1_555 MG ? G MG . ? A MG 206 ? 1_555 O ? V HOH . ? A HOH 325 ? 1_555 86.1 ? 46 O ? V HOH . ? A HOH 304 ? 1_555 MG ? G MG . ? A MG 206 ? 1_555 O ? V HOH . ? A HOH 325 ? 1_555 82.2 ? 47 OE2 ? A GLU 136 ? A GLU 136 ? 1_555 MG ? G MG . ? A MG 206 ? 1_555 O ? V HOH . ? A HOH 375 ? 1_555 93.8 ? 48 OE1 ? A GLN 137 ? A GLN 137 ? 1_555 MG ? G MG . ? A MG 206 ? 1_555 O ? V HOH . ? A HOH 375 ? 1_555 95.9 ? 49 O ? V HOH . ? A HOH 304 ? 1_555 MG ? G MG . ? A MG 206 ? 1_555 O ? V HOH . ? A HOH 375 ? 1_555 95.3 ? 50 O ? V HOH . ? A HOH 325 ? 1_555 MG ? G MG . ? A MG 206 ? 1_555 O ? V HOH . ? A HOH 375 ? 1_555 87.5 ? 51 OE1 B A GLU 161 ? A GLU 161 ? 1_555 MG ? I MG . ? A MG 208 ? 1_555 OE1 B A GLU 161 ? A GLU 161 ? 1_555 0.0 ? 52 O ? V HOH . ? A HOH 464 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O ? V HOH . ? A HOH 464 ? 70_475 25.0 ? 53 O ? V HOH . ? A HOH 464 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O ? V HOH . ? A HOH 474 ? 1_555 100.5 ? 54 O ? V HOH . ? A HOH 464 ? 70_475 MG ? D MG . ? A MG 203 ? 1_555 O ? V HOH . ? A HOH 474 ? 1_555 76.1 ? 55 O ? V HOH . ? A HOH 464 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O ? V HOH . ? A HOH 474 ? 70_475 76.1 ? 56 O ? V HOH . ? A HOH 464 ? 70_475 MG ? D MG . ? A MG 203 ? 1_555 O ? V HOH . ? A HOH 474 ? 70_475 100.5 ? 57 O ? V HOH . ? A HOH 474 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O ? V HOH . ? A HOH 474 ? 70_475 176.6 ? 58 O ? V HOH . ? A HOH 464 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O ? V HOH . ? A HOH 492 ? 1_555 157.2 ? 59 O ? V HOH . ? A HOH 464 ? 70_475 MG ? D MG . ? A MG 203 ? 1_555 O ? V HOH . ? A HOH 492 ? 1_555 176.6 ? 60 O ? V HOH . ? A HOH 474 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O ? V HOH . ? A HOH 492 ? 1_555 101.1 ? 61 O ? V HOH . ? A HOH 474 ? 70_475 MG ? D MG . ? A MG 203 ? 1_555 O ? V HOH . ? A HOH 492 ? 1_555 82.3 ? 62 O ? V HOH . ? A HOH 464 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O ? V HOH . ? A HOH 492 ? 70_475 176.6 ? 63 O ? V HOH . ? A HOH 464 ? 70_475 MG ? D MG . ? A MG 203 ? 1_555 O ? V HOH . ? A HOH 492 ? 70_475 157.2 ? 64 O ? V HOH . ? A HOH 474 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O ? V HOH . ? A HOH 492 ? 70_475 82.3 ? 65 O ? V HOH . ? A HOH 474 ? 70_475 MG ? D MG . ? A MG 203 ? 1_555 O ? V HOH . ? A HOH 492 ? 70_475 101.1 ? 66 O ? V HOH . ? A HOH 492 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O ? V HOH . ? A HOH 492 ? 70_475 21.0 ? 67 O ? V HOH . ? A HOH 464 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O ? V HOH . ? A HOH 517 ? 1_555 86.3 ? 68 O ? V HOH . ? A HOH 464 ? 70_475 MG ? D MG . ? A MG 203 ? 1_555 O ? V HOH . ? A HOH 517 ? 1_555 90.9 ? 69 O ? V HOH . ? A HOH 474 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O ? V HOH . ? A HOH 517 ? 1_555 88.1 ? 70 O ? V HOH . ? A HOH 474 ? 70_475 MG ? D MG . ? A MG 203 ? 1_555 O ? V HOH . ? A HOH 517 ? 1_555 91.8 ? 71 O ? V HOH . ? A HOH 492 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O ? V HOH . ? A HOH 517 ? 1_555 87.0 ? 72 O ? V HOH . ? A HOH 492 ? 70_475 MG ? D MG . ? A MG 203 ? 1_555 O ? V HOH . ? A HOH 517 ? 1_555 95.8 ? 73 O ? V HOH . ? A HOH 464 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O ? V HOH . ? A HOH 517 ? 70_475 90.9 ? 74 O ? V HOH . ? A HOH 464 ? 70_475 MG ? D MG . ? A MG 203 ? 1_555 O ? V HOH . ? A HOH 517 ? 70_475 86.3 ? 75 O ? V HOH . ? A HOH 474 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O ? V HOH . ? A HOH 517 ? 70_475 91.8 ? 76 O ? V HOH . ? A HOH 474 ? 70_475 MG ? D MG . ? A MG 203 ? 1_555 O ? V HOH . ? A HOH 517 ? 70_475 88.1 ? 77 O ? V HOH . ? A HOH 492 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O ? V HOH . ? A HOH 517 ? 70_475 95.8 ? 78 O ? V HOH . ? A HOH 492 ? 70_475 MG ? D MG . ? A MG 203 ? 1_555 O ? V HOH . ? A HOH 517 ? 70_475 87.0 ? 79 O ? V HOH . ? A HOH 517 ? 1_555 MG ? D MG . ? A MG 203 ? 1_555 O ? V HOH . ? A HOH 517 ? 70_475 177.1 ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id LEU _struct_mon_prot_cis.label_seq_id 156 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id LEU _struct_mon_prot_cis.auth_seq_id 156 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 157 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 157 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 0.47 # _pdbx_entry_details.entry_id 9WX5 _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.has_protein_modification N # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id VAL _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 42 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -123.52 _pdbx_validate_torsion.psi -65.20 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A MG 201 ? B MG . 2 1 A MG 202 ? C MG . 3 1 A MG 203 ? D MG . 4 1 A MG 208 ? I MG . 5 1 A CL 217 ? R CL . # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 518 ? 5.87 . 2 1 O ? A HOH 519 ? 6.38 . # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CL CL CL N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 HIS N N N N 138 HIS CA C N S 139 HIS C C N N 140 HIS O O N N 141 HIS CB C N N 142 HIS CG C Y N 143 HIS ND1 N Y N 144 HIS CD2 C Y N 145 HIS CE1 C Y N 146 HIS NE2 N Y N 147 HIS OXT O N N 148 HIS H H N N 149 HIS H2 H N N 150 HIS HA H N N 151 HIS HB2 H N N 152 HIS HB3 H N N 153 HIS HD1 H N N 154 HIS HD2 H N N 155 HIS HE1 H N N 156 HIS HE2 H N N 157 HIS HXT H N N 158 HOH O O N N 159 HOH H1 H N N 160 HOH H2 H N N 161 ILE N N N N 162 ILE CA C N S 163 ILE C C N N 164 ILE O O N N 165 ILE CB C N S 166 ILE CG1 C N N 167 ILE CG2 C N N 168 ILE CD1 C N N 169 ILE OXT O N N 170 ILE H H N N 171 ILE H2 H N N 172 ILE HA H N N 173 ILE HB H N N 174 ILE HG12 H N N 175 ILE HG13 H N N 176 ILE HG21 H N N 177 ILE HG22 H N N 178 ILE HG23 H N N 179 ILE HD11 H N N 180 ILE HD12 H N N 181 ILE HD13 H N N 182 ILE HXT H N N 183 LEU N N N N 184 LEU CA C N S 185 LEU C C N N 186 LEU O O N N 187 LEU CB C N N 188 LEU CG C N N 189 LEU CD1 C N N 190 LEU CD2 C N N 191 LEU OXT O N N 192 LEU H H N N 193 LEU H2 H N N 194 LEU HA H N N 195 LEU HB2 H N N 196 LEU HB3 H N N 197 LEU HG H N N 198 LEU HD11 H N N 199 LEU HD12 H N N 200 LEU HD13 H N N 201 LEU HD21 H N N 202 LEU HD22 H N N 203 LEU HD23 H N N 204 LEU HXT H N N 205 LYS N N N N 206 LYS CA C N S 207 LYS C C N N 208 LYS O O N N 209 LYS CB C N N 210 LYS CG C N N 211 LYS CD C N N 212 LYS CE C N N 213 LYS NZ N N N 214 LYS OXT O N N 215 LYS H H N N 216 LYS H2 H N N 217 LYS HA H N N 218 LYS HB2 H N N 219 LYS HB3 H N N 220 LYS HG2 H N N 221 LYS HG3 H N N 222 LYS HD2 H N N 223 LYS HD3 H N N 224 LYS HE2 H N N 225 LYS HE3 H N N 226 LYS HZ1 H N N 227 LYS HZ2 H N N 228 LYS HZ3 H N N 229 LYS HXT H N N 230 MET N N N N 231 MET CA C N S 232 MET C C N N 233 MET O O N N 234 MET CB C N N 235 MET CG C N N 236 MET SD S N N 237 MET CE C N N 238 MET OXT O N N 239 MET H H N N 240 MET H2 H N N 241 MET HA H N N 242 MET HB2 H N N 243 MET HB3 H N N 244 MET HG2 H N N 245 MET HG3 H N N 246 MET HE1 H N N 247 MET HE2 H N N 248 MET HE3 H N N 249 MET HXT H N N 250 MG MG MG N N 251 PHE N N N N 252 PHE CA C N S 253 PHE C C N N 254 PHE O O N N 255 PHE CB C N N 256 PHE CG C Y N 257 PHE CD1 C Y N 258 PHE CD2 C Y N 259 PHE CE1 C Y N 260 PHE CE2 C Y N 261 PHE CZ C Y N 262 PHE OXT O N N 263 PHE H H N N 264 PHE H2 H N N 265 PHE HA H N N 266 PHE HB2 H N N 267 PHE HB3 H N N 268 PHE HD1 H N N 269 PHE HD2 H N N 270 PHE HE1 H N N 271 PHE HE2 H N N 272 PHE HZ H N N 273 PHE HXT H N N 274 PRO N N N N 275 PRO CA C N S 276 PRO C C N N 277 PRO O O N N 278 PRO CB C N N 279 PRO CG C N N 280 PRO CD C N N 281 PRO OXT O N N 282 PRO H H N N 283 PRO HA H N N 284 PRO HB2 H N N 285 PRO HB3 H N N 286 PRO HG2 H N N 287 PRO HG3 H N N 288 PRO HD2 H N N 289 PRO HD3 H N N 290 PRO HXT H N N 291 SER N N N N 292 SER CA C N S 293 SER C C N N 294 SER O O N N 295 SER CB C N N 296 SER OG O N N 297 SER OXT O N N 298 SER H H N N 299 SER H2 H N N 300 SER HA H N N 301 SER HB2 H N N 302 SER HB3 H N N 303 SER HG H N N 304 SER HXT H N N 305 THR N N N N 306 THR CA C N S 307 THR C C N N 308 THR O O N N 309 THR CB C N R 310 THR OG1 O N N 311 THR CG2 C N N 312 THR OXT O N N 313 THR H H N N 314 THR H2 H N N 315 THR HA H N N 316 THR HB H N N 317 THR HG1 H N N 318 THR HG21 H N N 319 THR HG22 H N N 320 THR HG23 H N N 321 THR HXT H N N 322 TRP N N N N 323 TRP CA C N S 324 TRP C C N N 325 TRP O O N N 326 TRP CB C N N 327 TRP CG C Y N 328 TRP CD1 C Y N 329 TRP CD2 C Y N 330 TRP NE1 N Y N 331 TRP CE2 C Y N 332 TRP CE3 C Y N 333 TRP CZ2 C Y N 334 TRP CZ3 C Y N 335 TRP CH2 C Y N 336 TRP OXT O N N 337 TRP H H N N 338 TRP H2 H N N 339 TRP HA H N N 340 TRP HB2 H N N 341 TRP HB3 H N N 342 TRP HD1 H N N 343 TRP HE1 H N N 344 TRP HE3 H N N 345 TRP HZ2 H N N 346 TRP HZ3 H N N 347 TRP HH2 H N N 348 TRP HXT H N N 349 TYR N N N N 350 TYR CA C N S 351 TYR C C N N 352 TYR O O N N 353 TYR CB C N N 354 TYR CG C Y N 355 TYR CD1 C Y N 356 TYR CD2 C Y N 357 TYR CE1 C Y N 358 TYR CE2 C Y N 359 TYR CZ C Y N 360 TYR OH O N N 361 TYR OXT O N N 362 TYR H H N N 363 TYR H2 H N N 364 TYR HA H N N 365 TYR HB2 H N N 366 TYR HB3 H N N 367 TYR HD1 H N N 368 TYR HD2 H N N 369 TYR HE1 H N N 370 TYR HE2 H N N 371 TYR HH H N N 372 TYR HXT H N N 373 VAL N N N N 374 VAL CA C N S 375 VAL C C N N 376 VAL O O N N 377 VAL CB C N N 378 VAL CG1 C N N 379 VAL CG2 C N N 380 VAL OXT O N N 381 VAL H H N N 382 VAL H2 H N N 383 VAL HA H N N 384 VAL HB H N N 385 VAL HG11 H N N 386 VAL HG12 H N N 387 VAL HG13 H N N 388 VAL HG21 H N N 389 VAL HG22 H N N 390 VAL HG23 H N N 391 VAL HXT H N N 392 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # _pdbx_audit_support.funding_organization 'Department of Biotechnology (DBT, India)' _pdbx_audit_support.country India _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3KA3 _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 9WX5 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.005434 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.005434 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005434 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.pdbx_scat_Z _atom_type.pdbx_N_electrons _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c C 6 6 2.3103 20.8439 1.0201 10.2075 1.5888 0.5687 0.8651 51.6512 0.2156 CL 17 17 11.4601 0.0104 7.1962 1.1662 6.2554 18.5194 1.6455 47.7784 -9.3442 H 1 1 0.4930 10.5109 0.3229 26.1257 0.1402 3.1424 0.0408 57.7997 0.0030 MG ? ? ? ? ? ? ? ? ? ? ? MG+2 12 10 3.4988 2.1676 3.8378 4.7542 1.3284 0.1850 0.8497 10.1411 0.5610 N 7 7 12.2220 0.0057 3.1346 9.8933 2.0141 28.9975 1.1672 0.5826 -11.5379 O 8 8 3.0487 13.2771 2.2870 5.7011 1.5464 0.3239 0.8671 32.9089 0.2508 S 16 16 6.9054 1.4679 5.2035 22.2151 1.4379 0.2536 1.5863 56.1720 1.0496 # loop_ # loop_ #