data_9X1F # _entry.id 9X1F # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.417 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9X1F pdb_00009x1f 10.2210/pdb9x1f/pdb WWPDB D_1300064018 ? ? BMRB 36793 ? 10.13018/BMR36793 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-10-07 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr . _pdbx_database_status.entry_id 9X1F _pdbx_database_status.recvd_initial_deposition_date 2025-10-01 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs . _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category CASD-NMR _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'NMR structure of the membrane-active toxin U11-MYRTX-Tb1a from ant Tetramorium bicarinatum in DPC micelle' _pdbx_database_related.db_id 36793 _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email lyukmanova_ekaterina@smbu.edu.cn _pdbx_contact_author.name_first Ekaterina _pdbx_contact_author.name_last Lyukmanova _pdbx_contact_author.name_mi N. _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-9728-9407 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Gorelov, S.A.' 1 0009-0006-5733-3238 'Chernaya, E.M.' 2 0000-0002-1271-0259 'Mironov, P.A.' 3 0000-0002-7884-3257 'Shenkarev, Z.O.' 4 0000-0003-1383-3522 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title ;Membrane-active Toxin U11-MTRTX-Tb1a from the Ant Tetramorium bicarinatum Undergoes Significant Structural Rearrangement upon Micelle Binding ; _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # _citation_author.citation_id primary _citation_author.name 'Lyukmanova, E.N.' _citation_author.ordinal 1 _citation_author.identifier_ORCID 0000-0002-9728-9407 # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description U11-myrmicitoxin-Tb1a _entity.formula_weight 4033.885 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name U11-MYRTX-Tb1a # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GKEKEKLKQCFKDMTLAAIDYAKHKVEKHLFKCI _entity_poly.pdbx_seq_one_letter_code_can GKEKEKLKQCFKDMTLAAIDYAKHKVEKHLFKCI _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 LYS n 1 3 GLU n 1 4 LYS n 1 5 GLU n 1 6 LYS n 1 7 LEU n 1 8 LYS n 1 9 GLN n 1 10 CYS n 1 11 PHE n 1 12 LYS n 1 13 ASP n 1 14 MET n 1 15 THR n 1 16 LEU n 1 17 ALA n 1 18 ALA n 1 19 ILE n 1 20 ASP n 1 21 TYR n 1 22 ALA n 1 23 LYS n 1 24 HIS n 1 25 LYS n 1 26 VAL n 1 27 GLU n 1 28 LYS n 1 29 HIS n 1 30 LEU n 1 31 PHE n 1 32 LYS n 1 33 CYS n 1 34 ILE n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 34 _pdbx_entity_src_syn.organism_scientific 'Tetramorium bicarinatum' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 219812 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 LYS 2 2 2 LYS LYS A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 GLN 9 9 9 GLN GLN A . n A 1 10 CYS 10 10 10 CYS CYS A . n A 1 11 PHE 11 11 11 PHE PHE A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 MET 14 14 14 MET MET A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 TYR 21 21 21 TYR TYR A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 HIS 24 24 24 HIS HIS A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 HIS 29 29 29 HIS HIS A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 PHE 31 31 31 PHE PHE A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 CYS 33 33 33 CYS CYS A . n A 1 34 ILE 34 34 34 ILE ILE A . n # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 9X1F _cell.details ? _cell.formula_units_Z ? _cell.length_a 1.000 _cell.length_a_esd ? _cell.length_b 1.000 _cell.length_b_esd ? _cell.length_c 1.000 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB ? _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9X1F _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9X1F _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _database_PDB_matrix.entry_id 9X1F _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 9X1F _struct.title 'NMR structure of the membrane-active toxin U11-MYRTX-Tb1a from ant Tetramorium bicarinatum in DPC micelle' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9X1F _struct_keywords.text 'membrane-active peptide, neuroactive peptide, myrmicitoxin, insecticidal toxin, TOXIN' _struct_keywords.pdbx_keywords TOXIN # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TX11A_TETBN _struct_ref.pdbx_db_accession A0A6M3Z554 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code GKEKEKLKQCFKDMTLAAIDYAKHKVEKHLFKCI _struct_ref.pdbx_align_begin 25 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9X1F _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 34 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A6M3Z554 _struct_ref_seq.db_align_beg 25 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 58 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 34 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'NMR Distance Restraints' _pdbx_struct_assembly_auth_evidence.details 'not applicable' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0 _pdbx_struct_oper_list.matrix[1][2] 0.0 _pdbx_struct_oper_list.matrix[1][3] 0.0 _pdbx_struct_oper_list.vector[1] 0.0 _pdbx_struct_oper_list.matrix[2][1] 0.0 _pdbx_struct_oper_list.matrix[2][2] 1.0 _pdbx_struct_oper_list.matrix[2][3] 0.0 _pdbx_struct_oper_list.vector[2] 0.0 _pdbx_struct_oper_list.matrix[3][1] 0.0 _pdbx_struct_oper_list.matrix[3][2] 0.0 _pdbx_struct_oper_list.matrix[3][3] 1.0 _pdbx_struct_oper_list.vector[3] 0.0 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id GLY _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 1 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id HIS _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 24 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id GLY _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 1 _struct_conf.end_auth_comp_id HIS _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 24 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 24 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 10 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 33 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 10 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 33 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.026 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id CYS _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 10 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 33 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id CYS _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 10 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 33 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom SG _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id . _pdbx_modification_feature.ref_pcm_id . _pdbx_modification_feature.ref_comp_id . _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Disulfide bridge' # _pdbx_entry_details.entry_id 9X1F _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 23 ? ? -67.75 -76.53 2 1 HIS A 24 ? ? -134.18 -41.10 3 1 LYS A 25 ? ? -45.17 104.00 4 1 LYS A 28 ? ? -69.88 -74.94 5 2 LYS A 23 ? ? -67.64 -75.80 6 2 HIS A 24 ? ? -135.10 -41.58 7 3 LYS A 23 ? ? -72.14 -75.65 8 3 HIS A 24 ? ? -131.40 -45.04 9 4 LYS A 23 ? ? -66.88 -76.49 10 4 HIS A 24 ? ? -135.08 -44.35 11 5 GLU A 3 ? ? -77.31 -71.80 12 5 LYS A 23 ? ? -68.40 -76.09 13 5 HIS A 24 ? ? -133.49 -43.18 14 6 GLU A 3 ? ? -77.50 -73.63 15 6 LYS A 23 ? ? -68.24 -76.14 16 6 HIS A 24 ? ? -132.71 -43.42 17 7 LYS A 23 ? ? -67.67 -75.48 18 7 HIS A 24 ? ? -134.55 -41.27 19 7 LYS A 25 ? ? -44.60 106.37 20 7 LEU A 30 ? ? -154.82 43.24 21 8 LYS A 23 ? ? -73.13 -75.93 22 8 HIS A 24 ? ? -130.35 -44.28 23 8 LYS A 28 ? ? -67.23 -167.72 24 8 LEU A 30 ? ? -147.45 33.45 25 9 LYS A 23 ? ? -68.99 -75.47 26 9 HIS A 24 ? ? -132.69 -42.46 27 9 LYS A 25 ? ? -44.00 106.72 28 10 LYS A 23 ? ? -77.98 -75.35 29 10 LYS A 25 ? ? -40.88 150.62 30 11 LYS A 23 ? ? -67.49 -75.31 31 11 HIS A 24 ? ? -133.72 -40.89 32 11 LYS A 25 ? ? -45.41 108.84 33 11 VAL A 26 ? ? -99.71 31.70 34 11 LYS A 28 ? ? -70.73 -74.25 35 11 LEU A 30 ? ? -142.77 34.15 36 12 LYS A 23 ? ? -67.65 -76.11 37 12 HIS A 24 ? ? -133.99 -44.01 38 12 LYS A 25 ? ? -43.17 108.80 39 12 HIS A 29 ? ? -148.52 34.98 40 13 LYS A 23 ? ? -67.10 -75.40 41 13 HIS A 24 ? ? -132.88 -42.27 42 13 LYS A 25 ? ? -44.35 106.63 43 13 LYS A 28 ? ? -100.14 42.34 44 14 LYS A 23 ? ? -68.34 -76.04 45 14 HIS A 24 ? ? -133.51 -42.79 46 15 LYS A 23 ? ? -67.39 -76.40 47 15 HIS A 24 ? ? -132.87 -41.21 48 15 LYS A 25 ? ? -48.20 105.55 49 15 HIS A 29 ? ? -164.17 -167.50 50 15 LEU A 30 ? ? 48.50 27.86 51 16 LYS A 23 ? ? -72.25 -76.56 52 16 LYS A 25 ? ? -41.53 107.50 53 16 LYS A 28 ? ? -100.54 45.81 54 17 THR A 15 ? ? -98.01 -60.66 55 17 LYS A 23 ? ? -68.21 -74.85 56 17 HIS A 24 ? ? -134.88 -41.02 57 18 GLU A 3 ? ? -76.01 -74.43 58 18 LYS A 23 ? ? -77.81 -75.96 59 18 HIS A 24 ? ? -126.39 -50.40 60 18 LYS A 25 ? ? -40.82 106.22 61 18 VAL A 26 ? ? -101.03 -74.12 62 18 LYS A 28 ? ? -68.23 89.27 63 18 LEU A 30 ? ? -175.77 33.41 64 18 PHE A 31 ? ? -108.52 76.92 65 19 LYS A 23 ? ? -73.25 -75.08 66 19 HIS A 24 ? ? -130.93 -44.45 67 19 LYS A 25 ? ? -43.64 105.60 68 19 VAL A 26 ? ? -100.95 -64.55 69 19 HIS A 29 ? ? 178.68 -32.74 70 19 LEU A 30 ? ? -89.74 43.81 71 19 PHE A 31 ? ? -142.63 35.66 72 20 LYS A 23 ? ? -64.49 -75.65 73 20 HIS A 24 ? ? -135.12 -40.51 74 20 LYS A 25 ? ? -46.56 108.41 # _pdbx_nmr_ensemble.entry_id 9X1F _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 9X1F _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'target function' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.15 mM U11-MYRTX-Tb1a, 24 mM d-38 DPC, 5 % [U-99% 2H] D2O, 95% H2O/5% D2O' _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' _pdbx_nmr_sample_details.label cold _pdbx_nmr_sample_details.type micelle _pdbx_nmr_sample_details.details ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 U11-MYRTX-Tb1a 0.15 ? mM 'natural abundance' 1 DPC 24 ? mM d-38 1 D2O 5 ? % '[U-99% 2H]' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 323 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure AMBIENT _pdbx_nmr_exptl_sample_conditions.pH 5.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.005 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label default _pdbx_nmr_exptl_sample_conditions.pH_err 0.05 _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_exptl.experiment_id 1 _pdbx_nmr_exptl.conditions_id 1 _pdbx_nmr_exptl.solution_id 1 _pdbx_nmr_exptl.type NOESY _pdbx_nmr_exptl.spectrometer_id 1 _pdbx_nmr_exptl.sample_state isotropic # _pdbx_nmr_refine.entry_id 9X1F _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'structure calculation' CYANA 3.98.13 'Guntert, Mumenthaler and Wuthrich' 2 'peak picking' CARA ? 'Keller and Wuthrich' 3 processing TopSpin ? 'Bruker Biospin' 4 'chemical shift assignment' CARA ? 'Keller and Wuthrich' 5 refinement CYANA ? 'Guntert, Mumenthaler and Wuthrich' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASP N N N N 14 ASP CA C N S 15 ASP C C N N 16 ASP O O N N 17 ASP CB C N N 18 ASP CG C N N 19 ASP OD1 O N N 20 ASP OD2 O N N 21 ASP OXT O N N 22 ASP H H N N 23 ASP H2 H N N 24 ASP HA H N N 25 ASP HB2 H N N 26 ASP HB3 H N N 27 ASP HD2 H N N 28 ASP HXT H N N 29 CYS N N N N 30 CYS CA C N R 31 CYS C C N N 32 CYS O O N N 33 CYS CB C N N 34 CYS SG S N N 35 CYS OXT O N N 36 CYS H H N N 37 CYS H2 H N N 38 CYS HA H N N 39 CYS HB2 H N N 40 CYS HB3 H N N 41 CYS HG H N N 42 CYS HXT H N N 43 GLN N N N N 44 GLN CA C N S 45 GLN C C N N 46 GLN O O N N 47 GLN CB C N N 48 GLN CG C N N 49 GLN CD C N N 50 GLN OE1 O N N 51 GLN NE2 N N N 52 GLN OXT O N N 53 GLN H H N N 54 GLN H2 H N N 55 GLN HA H N N 56 GLN HB2 H N N 57 GLN HB3 H N N 58 GLN HG2 H N N 59 GLN HG3 H N N 60 GLN HE21 H N N 61 GLN HE22 H N N 62 GLN HXT H N N 63 GLU N N N N 64 GLU CA C N S 65 GLU C C N N 66 GLU O O N N 67 GLU CB C N N 68 GLU CG C N N 69 GLU CD C N N 70 GLU OE1 O N N 71 GLU OE2 O N N 72 GLU OXT O N N 73 GLU H H N N 74 GLU H2 H N N 75 GLU HA H N N 76 GLU HB2 H N N 77 GLU HB3 H N N 78 GLU HG2 H N N 79 GLU HG3 H N N 80 GLU HE2 H N N 81 GLU HXT H N N 82 GLY N N N N 83 GLY CA C N N 84 GLY C C N N 85 GLY O O N N 86 GLY OXT O N N 87 GLY H H N N 88 GLY H2 H N N 89 GLY HA2 H N N 90 GLY HA3 H N N 91 GLY HXT H N N 92 HIS N N N N 93 HIS CA C N S 94 HIS C C N N 95 HIS O O N N 96 HIS CB C N N 97 HIS CG C Y N 98 HIS ND1 N Y N 99 HIS CD2 C Y N 100 HIS CE1 C Y N 101 HIS NE2 N Y N 102 HIS OXT O N N 103 HIS H H N N 104 HIS H2 H N N 105 HIS HA H N N 106 HIS HB2 H N N 107 HIS HB3 H N N 108 HIS HD1 H N N 109 HIS HD2 H N N 110 HIS HE1 H N N 111 HIS HE2 H N N 112 HIS HXT H N N 113 ILE N N N N 114 ILE CA C N S 115 ILE C C N N 116 ILE O O N N 117 ILE CB C N S 118 ILE CG1 C N N 119 ILE CG2 C N N 120 ILE CD1 C N N 121 ILE OXT O N N 122 ILE H H N N 123 ILE H2 H N N 124 ILE HA H N N 125 ILE HB H N N 126 ILE HG12 H N N 127 ILE HG13 H N N 128 ILE HG21 H N N 129 ILE HG22 H N N 130 ILE HG23 H N N 131 ILE HD11 H N N 132 ILE HD12 H N N 133 ILE HD13 H N N 134 ILE HXT H N N 135 LEU N N N N 136 LEU CA C N S 137 LEU C C N N 138 LEU O O N N 139 LEU CB C N N 140 LEU CG C N N 141 LEU CD1 C N N 142 LEU CD2 C N N 143 LEU OXT O N N 144 LEU H H N N 145 LEU H2 H N N 146 LEU HA H N N 147 LEU HB2 H N N 148 LEU HB3 H N N 149 LEU HG H N N 150 LEU HD11 H N N 151 LEU HD12 H N N 152 LEU HD13 H N N 153 LEU HD21 H N N 154 LEU HD22 H N N 155 LEU HD23 H N N 156 LEU HXT H N N 157 LYS N N N N 158 LYS CA C N S 159 LYS C C N N 160 LYS O O N N 161 LYS CB C N N 162 LYS CG C N N 163 LYS CD C N N 164 LYS CE C N N 165 LYS NZ N N N 166 LYS OXT O N N 167 LYS H H N N 168 LYS H2 H N N 169 LYS HA H N N 170 LYS HB2 H N N 171 LYS HB3 H N N 172 LYS HG2 H N N 173 LYS HG3 H N N 174 LYS HD2 H N N 175 LYS HD3 H N N 176 LYS HE2 H N N 177 LYS HE3 H N N 178 LYS HZ1 H N N 179 LYS HZ2 H N N 180 LYS HZ3 H N N 181 LYS HXT H N N 182 MET N N N N 183 MET CA C N S 184 MET C C N N 185 MET O O N N 186 MET CB C N N 187 MET CG C N N 188 MET SD S N N 189 MET CE C N N 190 MET OXT O N N 191 MET H H N N 192 MET H2 H N N 193 MET HA H N N 194 MET HB2 H N N 195 MET HB3 H N N 196 MET HG2 H N N 197 MET HG3 H N N 198 MET HE1 H N N 199 MET HE2 H N N 200 MET HE3 H N N 201 MET HXT H N N 202 PHE N N N N 203 PHE CA C N S 204 PHE C C N N 205 PHE O O N N 206 PHE CB C N N 207 PHE CG C Y N 208 PHE CD1 C Y N 209 PHE CD2 C Y N 210 PHE CE1 C Y N 211 PHE CE2 C Y N 212 PHE CZ C Y N 213 PHE OXT O N N 214 PHE H H N N 215 PHE H2 H N N 216 PHE HA H N N 217 PHE HB2 H N N 218 PHE HB3 H N N 219 PHE HD1 H N N 220 PHE HD2 H N N 221 PHE HE1 H N N 222 PHE HE2 H N N 223 PHE HZ H N N 224 PHE HXT H N N 225 THR N N N N 226 THR CA C N S 227 THR C C N N 228 THR O O N N 229 THR CB C N R 230 THR OG1 O N N 231 THR CG2 C N N 232 THR OXT O N N 233 THR H H N N 234 THR H2 H N N 235 THR HA H N N 236 THR HB H N N 237 THR HG1 H N N 238 THR HG21 H N N 239 THR HG22 H N N 240 THR HG23 H N N 241 THR HXT H N N 242 TYR N N N N 243 TYR CA C N S 244 TYR C C N N 245 TYR O O N N 246 TYR CB C N N 247 TYR CG C Y N 248 TYR CD1 C Y N 249 TYR CD2 C Y N 250 TYR CE1 C Y N 251 TYR CE2 C Y N 252 TYR CZ C Y N 253 TYR OH O N N 254 TYR OXT O N N 255 TYR H H N N 256 TYR H2 H N N 257 TYR HA H N N 258 TYR HB2 H N N 259 TYR HB3 H N N 260 TYR HD1 H N N 261 TYR HD2 H N N 262 TYR HE1 H N N 263 TYR HE2 H N N 264 TYR HH H N N 265 TYR HXT H N N 266 VAL N N N N 267 VAL CA C N S 268 VAL C C N N 269 VAL O O N N 270 VAL CB C N N 271 VAL CG1 C N N 272 VAL CG2 C N N 273 VAL OXT O N N 274 VAL H H N N 275 VAL H2 H N N 276 VAL HA H N N 277 VAL HB H N N 278 VAL HG11 H N N 279 VAL HG12 H N N 280 VAL HG13 H N N 281 VAL HG21 H N N 282 VAL HG22 H N N 283 VAL HG23 H N N 284 VAL HXT H N N 285 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASP N CA sing N N 13 ASP N H sing N N 14 ASP N H2 sing N N 15 ASP CA C sing N N 16 ASP CA CB sing N N 17 ASP CA HA sing N N 18 ASP C O doub N N 19 ASP C OXT sing N N 20 ASP CB CG sing N N 21 ASP CB HB2 sing N N 22 ASP CB HB3 sing N N 23 ASP CG OD1 doub N N 24 ASP CG OD2 sing N N 25 ASP OD2 HD2 sing N N 26 ASP OXT HXT sing N N 27 CYS N CA sing N N 28 CYS N H sing N N 29 CYS N H2 sing N N 30 CYS CA C sing N N 31 CYS CA CB sing N N 32 CYS CA HA sing N N 33 CYS C O doub N N 34 CYS C OXT sing N N 35 CYS CB SG sing N N 36 CYS CB HB2 sing N N 37 CYS CB HB3 sing N N 38 CYS SG HG sing N N 39 CYS OXT HXT sing N N 40 GLN N CA sing N N 41 GLN N H sing N N 42 GLN N H2 sing N N 43 GLN CA C sing N N 44 GLN CA CB sing N N 45 GLN CA HA sing N N 46 GLN C O doub N N 47 GLN C OXT sing N N 48 GLN CB CG sing N N 49 GLN CB HB2 sing N N 50 GLN CB HB3 sing N N 51 GLN CG CD sing N N 52 GLN CG HG2 sing N N 53 GLN CG HG3 sing N N 54 GLN CD OE1 doub N N 55 GLN CD NE2 sing N N 56 GLN NE2 HE21 sing N N 57 GLN NE2 HE22 sing N N 58 GLN OXT HXT sing N N 59 GLU N CA sing N N 60 GLU N H sing N N 61 GLU N H2 sing N N 62 GLU CA C sing N N 63 GLU CA CB sing N N 64 GLU CA HA sing N N 65 GLU C O doub N N 66 GLU C OXT sing N N 67 GLU CB CG sing N N 68 GLU CB HB2 sing N N 69 GLU CB HB3 sing N N 70 GLU CG CD sing N N 71 GLU CG HG2 sing N N 72 GLU CG HG3 sing N N 73 GLU CD OE1 doub N N 74 GLU CD OE2 sing N N 75 GLU OE2 HE2 sing N N 76 GLU OXT HXT sing N N 77 GLY N CA sing N N 78 GLY N H sing N N 79 GLY N H2 sing N N 80 GLY CA C sing N N 81 GLY CA HA2 sing N N 82 GLY CA HA3 sing N N 83 GLY C O doub N N 84 GLY C OXT sing N N 85 GLY OXT HXT sing N N 86 HIS N CA sing N N 87 HIS N H sing N N 88 HIS N H2 sing N N 89 HIS CA C sing N N 90 HIS CA CB sing N N 91 HIS CA HA sing N N 92 HIS C O doub N N 93 HIS C OXT sing N N 94 HIS CB CG sing N N 95 HIS CB HB2 sing N N 96 HIS CB HB3 sing N N 97 HIS CG ND1 sing Y N 98 HIS CG CD2 doub Y N 99 HIS ND1 CE1 doub Y N 100 HIS ND1 HD1 sing N N 101 HIS CD2 NE2 sing Y N 102 HIS CD2 HD2 sing N N 103 HIS CE1 NE2 sing Y N 104 HIS CE1 HE1 sing N N 105 HIS NE2 HE2 sing N N 106 HIS OXT HXT sing N N 107 ILE N CA sing N N 108 ILE N H sing N N 109 ILE N H2 sing N N 110 ILE CA C sing N N 111 ILE CA CB sing N N 112 ILE CA HA sing N N 113 ILE C O doub N N 114 ILE C OXT sing N N 115 ILE CB CG1 sing N N 116 ILE CB CG2 sing N N 117 ILE CB HB sing N N 118 ILE CG1 CD1 sing N N 119 ILE CG1 HG12 sing N N 120 ILE CG1 HG13 sing N N 121 ILE CG2 HG21 sing N N 122 ILE CG2 HG22 sing N N 123 ILE CG2 HG23 sing N N 124 ILE CD1 HD11 sing N N 125 ILE CD1 HD12 sing N N 126 ILE CD1 HD13 sing N N 127 ILE OXT HXT sing N N 128 LEU N CA sing N N 129 LEU N H sing N N 130 LEU N H2 sing N N 131 LEU CA C sing N N 132 LEU CA CB sing N N 133 LEU CA HA sing N N 134 LEU C O doub N N 135 LEU C OXT sing N N 136 LEU CB CG sing N N 137 LEU CB HB2 sing N N 138 LEU CB HB3 sing N N 139 LEU CG CD1 sing N N 140 LEU CG CD2 sing N N 141 LEU CG HG sing N N 142 LEU CD1 HD11 sing N N 143 LEU CD1 HD12 sing N N 144 LEU CD1 HD13 sing N N 145 LEU CD2 HD21 sing N N 146 LEU CD2 HD22 sing N N 147 LEU CD2 HD23 sing N N 148 LEU OXT HXT sing N N 149 LYS N CA sing N N 150 LYS N H sing N N 151 LYS N H2 sing N N 152 LYS CA C sing N N 153 LYS CA CB sing N N 154 LYS CA HA sing N N 155 LYS C O doub N N 156 LYS C OXT sing N N 157 LYS CB CG sing N N 158 LYS CB HB2 sing N N 159 LYS CB HB3 sing N N 160 LYS CG CD sing N N 161 LYS CG HG2 sing N N 162 LYS CG HG3 sing N N 163 LYS CD CE sing N N 164 LYS CD HD2 sing N N 165 LYS CD HD3 sing N N 166 LYS CE NZ sing N N 167 LYS CE HE2 sing N N 168 LYS CE HE3 sing N N 169 LYS NZ HZ1 sing N N 170 LYS NZ HZ2 sing N N 171 LYS NZ HZ3 sing N N 172 LYS OXT HXT sing N N 173 MET N CA sing N N 174 MET N H sing N N 175 MET N H2 sing N N 176 MET CA C sing N N 177 MET CA CB sing N N 178 MET CA HA sing N N 179 MET C O doub N N 180 MET C OXT sing N N 181 MET CB CG sing N N 182 MET CB HB2 sing N N 183 MET CB HB3 sing N N 184 MET CG SD sing N N 185 MET CG HG2 sing N N 186 MET CG HG3 sing N N 187 MET SD CE sing N N 188 MET CE HE1 sing N N 189 MET CE HE2 sing N N 190 MET CE HE3 sing N N 191 MET OXT HXT sing N N 192 PHE N CA sing N N 193 PHE N H sing N N 194 PHE N H2 sing N N 195 PHE CA C sing N N 196 PHE CA CB sing N N 197 PHE CA HA sing N N 198 PHE C O doub N N 199 PHE C OXT sing N N 200 PHE CB CG sing N N 201 PHE CB HB2 sing N N 202 PHE CB HB3 sing N N 203 PHE CG CD1 doub Y N 204 PHE CG CD2 sing Y N 205 PHE CD1 CE1 sing Y N 206 PHE CD1 HD1 sing N N 207 PHE CD2 CE2 doub Y N 208 PHE CD2 HD2 sing N N 209 PHE CE1 CZ doub Y N 210 PHE CE1 HE1 sing N N 211 PHE CE2 CZ sing Y N 212 PHE CE2 HE2 sing N N 213 PHE CZ HZ sing N N 214 PHE OXT HXT sing N N 215 THR N CA sing N N 216 THR N H sing N N 217 THR N H2 sing N N 218 THR CA C sing N N 219 THR CA CB sing N N 220 THR CA HA sing N N 221 THR C O doub N N 222 THR C OXT sing N N 223 THR CB OG1 sing N N 224 THR CB CG2 sing N N 225 THR CB HB sing N N 226 THR OG1 HG1 sing N N 227 THR CG2 HG21 sing N N 228 THR CG2 HG22 sing N N 229 THR CG2 HG23 sing N N 230 THR OXT HXT sing N N 231 TYR N CA sing N N 232 TYR N H sing N N 233 TYR N H2 sing N N 234 TYR CA C sing N N 235 TYR CA CB sing N N 236 TYR CA HA sing N N 237 TYR C O doub N N 238 TYR C OXT sing N N 239 TYR CB CG sing N N 240 TYR CB HB2 sing N N 241 TYR CB HB3 sing N N 242 TYR CG CD1 doub Y N 243 TYR CG CD2 sing Y N 244 TYR CD1 CE1 sing Y N 245 TYR CD1 HD1 sing N N 246 TYR CD2 CE2 doub Y N 247 TYR CD2 HD2 sing N N 248 TYR CE1 CZ doub Y N 249 TYR CE1 HE1 sing N N 250 TYR CE2 CZ sing Y N 251 TYR CE2 HE2 sing N N 252 TYR CZ OH sing N N 253 TYR OH HH sing N N 254 TYR OXT HXT sing N N 255 VAL N CA sing N N 256 VAL N H sing N N 257 VAL N H2 sing N N 258 VAL CA C sing N N 259 VAL CA CB sing N N 260 VAL CA HA sing N N 261 VAL C O doub N N 262 VAL C OXT sing N N 263 VAL CB CG1 sing N N 264 VAL CB CG2 sing N N 265 VAL CB HB sing N N 266 VAL CG1 HG11 sing N N 267 VAL CG1 HG12 sing N N 268 VAL CG1 HG13 sing N N 269 VAL CG2 HG21 sing N N 270 VAL CG2 HG22 sing N N 271 VAL CG2 HG23 sing N N 272 VAL OXT HXT sing N N 273 # _pdbx_audit_support.funding_organization 'Russian Science Foundation' _pdbx_audit_support.country 'Russian Federation' _pdbx_audit_support.grant_number 24-25-00160 _pdbx_audit_support.ordinal 1 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE III' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.details ? # _atom_sites.entry_id 9X1F _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ #