data_9XEA # _entry.id 9XEA # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.413 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9XEA pdb_00009xea 10.2210/pdb9xea/pdb WWPDB D_1300064930 ? ? BMRB 36805 ? 10.13018/BMR36805 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-04-22 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr . _pdbx_database_status.entry_id 9XEA _pdbx_database_status.recvd_initial_deposition_date 2025-10-27 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBC _pdbx_database_status.status_code_cs . _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB . 8DDC unspecified BMRB 'Structure of the transmembrane domain dimer of human IL-7R V253G mutant' 36805 unspecified # _pdbx_contact_author.id 3 _pdbx_contact_author.email james_chou@mail.sioc.ac.cn _pdbx_contact_author.name_first James _pdbx_contact_author.name_last Chou _pdbx_contact_author.name_mi J _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-4442-0344 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Wang, Q.' 1 0000-0003-3694-6300 'Cai, T.' 2 ? 'Chou, J.J.' 3 0000-0002-4442-0344 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Structure of the transmembrane domain dimer of the IL-7R V253G mutant' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wang, Q.' 1 0000-0003-3694-6300 primary 'Cai, T.' 2 ? primary 'Chou, J.J.' 3 0000-0002-4442-0344 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Interleukin-7 receptor subunit alpha' _entity.formula_weight 3427.169 _entity.pdbx_number_of_molecules 2 _entity.pdbx_ec ? _entity.pdbx_mutation V253G _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'IL-7 receptor subunit alpha,IL-7R subunit alpha,IL-7R-alpha,IL-7RA,CDw127' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GEKDPILLTISILSFFSGALLVILAHVLWKK _entity_poly.pdbx_seq_one_letter_code_can GEKDPILLTISILSFFSGALLVILAHVLWKK _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 GLU n 1 3 LYS n 1 4 ASP n 1 5 PRO n 1 6 ILE n 1 7 LEU n 1 8 LEU n 1 9 THR n 1 10 ILE n 1 11 SER n 1 12 ILE n 1 13 LEU n 1 14 SER n 1 15 PHE n 1 16 PHE n 1 17 SER n 1 18 GLY n 1 19 ALA n 1 20 LEU n 1 21 LEU n 1 22 VAL n 1 23 ILE n 1 24 LEU n 1 25 ALA n 1 26 HIS n 1 27 VAL n 1 28 LEU n 1 29 TRP n 1 30 LYS n 1 31 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 31 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene IL7R _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 236 236 GLY GLY A . n A 1 2 GLU 2 237 237 GLU GLU A . n A 1 3 LYS 3 238 238 LYS LYS A . n A 1 4 ASP 4 239 239 ASP ASP A . n A 1 5 PRO 5 240 240 PRO PRO A . n A 1 6 ILE 6 241 241 ILE ILE A . n A 1 7 LEU 7 242 242 LEU LEU A . n A 1 8 LEU 8 243 243 LEU LEU A . n A 1 9 THR 9 244 244 THR THR A . n A 1 10 ILE 10 245 245 ILE ILE A . n A 1 11 SER 11 246 246 SER SER A . n A 1 12 ILE 12 247 247 ILE ILE A . n A 1 13 LEU 13 248 248 LEU LEU A . n A 1 14 SER 14 249 249 SER SER A . n A 1 15 PHE 15 250 250 PHE PHE A . n A 1 16 PHE 16 251 251 PHE PHE A . n A 1 17 SER 17 252 252 SER SER A . n A 1 18 GLY 18 253 253 GLY GLY A . n A 1 19 ALA 19 254 254 ALA ALA A . n A 1 20 LEU 20 255 255 LEU LEU A . n A 1 21 LEU 21 256 256 LEU LEU A . n A 1 22 VAL 22 257 257 VAL VAL A . n A 1 23 ILE 23 258 258 ILE ILE A . n A 1 24 LEU 24 259 259 LEU LEU A . n A 1 25 ALA 25 260 260 ALA ALA A . n A 1 26 HIS 26 261 261 HIS HIS A . n A 1 27 VAL 27 262 262 VAL VAL A . n A 1 28 LEU 28 263 263 LEU LEU A . n A 1 29 TRP 29 264 264 TRP TRP A . n A 1 30 LYS 30 265 265 LYS LYS A . n A 1 31 LYS 31 266 266 LYS LYS A . n B 1 1 GLY 1 236 236 GLY GLY B . n B 1 2 GLU 2 237 237 GLU GLU B . n B 1 3 LYS 3 238 238 LYS LYS B . n B 1 4 ASP 4 239 239 ASP ASP B . n B 1 5 PRO 5 240 240 PRO PRO B . n B 1 6 ILE 6 241 241 ILE ILE B . n B 1 7 LEU 7 242 242 LEU LEU B . n B 1 8 LEU 8 243 243 LEU LEU B . n B 1 9 THR 9 244 244 THR THR B . n B 1 10 ILE 10 245 245 ILE ILE B . n B 1 11 SER 11 246 246 SER SER B . n B 1 12 ILE 12 247 247 ILE ILE B . n B 1 13 LEU 13 248 248 LEU LEU B . n B 1 14 SER 14 249 249 SER SER B . n B 1 15 PHE 15 250 250 PHE PHE B . n B 1 16 PHE 16 251 251 PHE PHE B . n B 1 17 SER 17 252 252 SER SER B . n B 1 18 GLY 18 253 253 GLY GLY B . n B 1 19 ALA 19 254 254 ALA ALA B . n B 1 20 LEU 20 255 255 LEU LEU B . n B 1 21 LEU 21 256 256 LEU LEU B . n B 1 22 VAL 22 257 257 VAL VAL B . n B 1 23 ILE 23 258 258 ILE ILE B . n B 1 24 LEU 24 259 259 LEU LEU B . n B 1 25 ALA 25 260 260 ALA ALA B . n B 1 26 HIS 26 261 261 HIS HIS B . n B 1 27 VAL 27 262 262 VAL VAL B . n B 1 28 LEU 28 263 263 LEU LEU B . n B 1 29 TRP 29 264 264 TRP TRP B . n B 1 30 LYS 30 265 265 LYS LYS B . n B 1 31 LYS 31 266 266 LYS LYS B . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9XEA _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 9XEA _struct.title 'Structure of the transmembrane domain dimer of human IL-7R V253G mutant' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9XEA _struct_keywords.text 'IL-7R, V253G mutation, transmembrane domain dimer, IMMUNE SYSTEM' _struct_keywords.pdbx_keywords 'IMMUNE SYSTEM' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code IL7RA_HUMAN _struct_ref.pdbx_db_accession P16871 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code GEMDPILLTISILSFFSVALLVILACVLWKK _struct_ref.pdbx_align_begin 236 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 9XEA A 1 ? 31 ? P16871 236 ? 266 ? 236 266 2 1 9XEA B 1 ? 31 ? P16871 236 ? 266 ? 236 266 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9XEA LYS A 3 ? UNP P16871 MET 238 conflict 238 1 1 9XEA GLY A 18 ? UNP P16871 VAL 253 'engineered mutation' 253 2 1 9XEA HIS A 26 ? UNP P16871 CYS 261 conflict 261 3 2 9XEA LYS B 3 ? UNP P16871 MET 238 conflict 238 4 2 9XEA GLY B 18 ? UNP P16871 VAL 253 'engineered mutation' 253 5 2 9XEA HIS B 26 ? UNP P16871 CYS 261 conflict 261 6 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'NMR Distance Restraints' _pdbx_struct_assembly_auth_evidence.details 'not applicable' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0 _pdbx_struct_oper_list.matrix[1][2] 0.0 _pdbx_struct_oper_list.matrix[1][3] 0.0 _pdbx_struct_oper_list.vector[1] 0.0 _pdbx_struct_oper_list.matrix[2][1] 0.0 _pdbx_struct_oper_list.matrix[2][2] 1.0 _pdbx_struct_oper_list.matrix[2][3] 0.0 _pdbx_struct_oper_list.vector[2] 0.0 _pdbx_struct_oper_list.matrix[3][1] 0.0 _pdbx_struct_oper_list.matrix[3][2] 0.0 _pdbx_struct_oper_list.matrix[3][3] 1.0 _pdbx_struct_oper_list.vector[3] 0.0 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 5 ? TRP A 29 ? PRO A 240 TRP A 264 1 ? 25 HELX_P HELX_P2 AA2 PRO B 5 ? TRP B 29 ? PRO B 240 TRP B 264 1 ? 25 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _pdbx_entry_details.entry_id 9XEA _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 238 ? ? 56.00 101.66 2 2 GLU A 237 ? ? -155.52 -35.80 3 2 PRO A 240 ? ? -79.19 46.70 4 3 GLU A 237 ? ? -169.22 117.65 5 3 PRO A 240 ? ? -28.99 89.09 6 3 GLU B 237 ? ? 55.10 97.05 7 3 ASP B 239 ? ? -166.00 -53.06 8 3 PRO B 240 ? ? -90.40 42.28 9 5 GLU A 237 ? ? 54.36 96.51 10 5 LYS A 238 ? ? -135.18 -46.70 11 5 LYS B 238 ? ? 54.61 96.65 12 5 PRO B 240 ? ? -50.75 85.33 13 6 PRO A 240 ? ? -80.14 49.39 14 6 LYS B 238 ? ? -91.52 44.13 15 7 LYS A 238 ? ? 57.20 94.34 16 7 PRO A 240 ? ? -81.24 45.69 17 7 LYS B 238 ? ? -164.77 -39.23 18 7 ASP B 239 ? ? 54.75 91.00 19 8 ASP A 239 ? ? -175.02 -49.12 20 8 GLU B 237 ? ? 68.83 -69.23 21 9 ASP A 239 ? ? -150.94 80.69 22 10 GLU B 237 ? ? 74.88 -51.65 23 11 GLU A 237 ? ? 53.57 85.61 24 11 LYS B 238 ? ? -173.41 -48.26 25 12 GLU A 237 ? ? 54.79 92.47 26 12 ASP A 239 ? ? -48.26 155.15 27 12 PRO A 240 ? ? -87.07 49.68 28 12 PRO B 240 ? ? -87.08 37.89 29 13 GLU A 237 ? ? -134.86 -40.73 30 13 PRO A 240 ? ? -88.52 48.23 31 13 GLU B 237 ? ? -142.01 -45.96 32 13 LYS B 238 ? ? 55.09 101.19 33 14 PRO A 240 ? ? -39.57 93.24 34 14 ASP B 239 ? ? 59.53 157.72 35 15 LYS A 238 ? ? 57.83 165.18 36 15 PRO A 240 ? ? -80.11 35.33 # _pdbx_nmr_ensemble.entry_id 9XEA _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 15 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 9XEA _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 5 ;0.6 mM [U-100% 13C; U-100% 15N; U-85% 2H] The transmembrane domain of the IL-7R-V253G dimer, 60 mM POPC, 150 mM DHPC, 25 mM MES, 90% H2O/10% D2O ; '90% H2O/10% D2O' 15N_13C_85%2H bicelle 'Triple labeled protein in bicelle for sequence specific assignment' 6 ;0.6 mM [U-13C; U-15N] Transmembrane domain of the IL-7R V253G mutant, 60 mM deuterated Deuterated POPC, 150 mM deuterated Deuterated DHPC, 25 mM MES, 90% H2O/10% D2O ; '90% H2O/10% D2O' 15N_13C bicelle 'Double labeled protein in bicelle for NOE assignments' 7 ;0.4 mM [U-15N; U-2H] Transmembrane domain of the IL-7R V253G mutant, 0.4 mM [U-13C] Transmembrane domain of the IL-7R V253G mutant, 60 mM deuterated Deuterated POPC, 150 mM deuterated Deuterated DHPC, 25 mM MES, 90% H2O/10% D2O ; '90% H2O/10% D2O' 15N_2H/13C bicelle 'Mixed labeled protein in bicelle for assignment of inter-chain NOE' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 5 'The transmembrane domain of the IL-7R-V253G dimer' 0.6 ? mM '[U-100% 13C; U-100% 15N; U-85% 2H]' 5 POPC 60 ? mM 'natural abundance' 5 DHPC 150 ? mM 'natural abundance' 5 MES 25 ? mM 'natural abundance' 6 'Transmembrane domain of the IL-7R V253G mutant' 0.6 ? mM '[U-13C; U-15N]' 6 'Deuterated POPC' 60 ? mM deuterated 6 'Deuterated DHPC' 150 ? mM deuterated 6 MES 25 ? mM 'natural abundance' 7 'Transmembrane domain of the IL-7R V253G mutant' 0.4 ? mM '[U-13C; U-15N; U-2H]' 7 'Deuterated POPC' 60 ? mM deuterated 7 'Deuterated DHPC' 150 ? mM deuterated 7 MES 25 ? mM 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 3 _pdbx_nmr_exptl_sample_conditions.temperature 306 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength 25 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label condition_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err 0.1 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 3 5 '2D 1H-15N TROSY-HSQC' 1 isotropic 2 3 6 '2D 1H-13C HSQC' 2 isotropic 3 3 5 '3D TROSY HNCA' 1 isotropic 4 3 5 '3D TROSY HN(CO)CA' 1 isotropic 5 3 5 '3D TROSY HNCO' 1 isotropic 7 3 6 '3D 1H-15N NOESY-TROSY' 2 isotropic 6 3 6 '3D 1H-13C NOESY' 2 isotropic 8 3 7 '3D 1H-15N NOESY-TROSY' 2 isotropic # _pdbx_nmr_refine.entry_id 9XEA _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement 'X-PLOR NIH' ? 'Schwieters, Kuszewski, Tjandra and Clore' 2 'data analysis' TALOS+ ? 'Shen, Delaglio, Cornilescu, Bax' 3 'chemical shift assignment' XEASY ? 'Bartels et al.' 4 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASP N N N N 14 ASP CA C N S 15 ASP C C N N 16 ASP O O N N 17 ASP CB C N N 18 ASP CG C N N 19 ASP OD1 O N N 20 ASP OD2 O N N 21 ASP OXT O N N 22 ASP H H N N 23 ASP H2 H N N 24 ASP HA H N N 25 ASP HB2 H N N 26 ASP HB3 H N N 27 ASP HD2 H N N 28 ASP HXT H N N 29 CYS N N N N 30 CYS CA C N R 31 CYS C C N N 32 CYS O O N N 33 CYS CB C N N 34 CYS SG S N N 35 CYS OXT O N N 36 CYS H H N N 37 CYS H2 H N N 38 CYS HA H N N 39 CYS HB2 H N N 40 CYS HB3 H N N 41 CYS HG H N N 42 CYS HXT H N N 43 GLU N N N N 44 GLU CA C N S 45 GLU C C N N 46 GLU O O N N 47 GLU CB C N N 48 GLU CG C N N 49 GLU CD C N N 50 GLU OE1 O N N 51 GLU OE2 O N N 52 GLU OXT O N N 53 GLU H H N N 54 GLU H2 H N N 55 GLU HA H N N 56 GLU HB2 H N N 57 GLU HB3 H N N 58 GLU HG2 H N N 59 GLU HG3 H N N 60 GLU HE2 H N N 61 GLU HXT H N N 62 GLY N N N N 63 GLY CA C N N 64 GLY C C N N 65 GLY O O N N 66 GLY OXT O N N 67 GLY H H N N 68 GLY H2 H N N 69 GLY HA2 H N N 70 GLY HA3 H N N 71 GLY HXT H N N 72 HIS N N N N 73 HIS CA C N S 74 HIS C C N N 75 HIS O O N N 76 HIS CB C N N 77 HIS CG C Y N 78 HIS ND1 N Y N 79 HIS CD2 C Y N 80 HIS CE1 C Y N 81 HIS NE2 N Y N 82 HIS OXT O N N 83 HIS H H N N 84 HIS H2 H N N 85 HIS HA H N N 86 HIS HB2 H N N 87 HIS HB3 H N N 88 HIS HD1 H N N 89 HIS HD2 H N N 90 HIS HE1 H N N 91 HIS HE2 H N N 92 HIS HXT H N N 93 ILE N N N N 94 ILE CA C N S 95 ILE C C N N 96 ILE O O N N 97 ILE CB C N S 98 ILE CG1 C N N 99 ILE CG2 C N N 100 ILE CD1 C N N 101 ILE OXT O N N 102 ILE H H N N 103 ILE H2 H N N 104 ILE HA H N N 105 ILE HB H N N 106 ILE HG12 H N N 107 ILE HG13 H N N 108 ILE HG21 H N N 109 ILE HG22 H N N 110 ILE HG23 H N N 111 ILE HD11 H N N 112 ILE HD12 H N N 113 ILE HD13 H N N 114 ILE HXT H N N 115 LEU N N N N 116 LEU CA C N S 117 LEU C C N N 118 LEU O O N N 119 LEU CB C N N 120 LEU CG C N N 121 LEU CD1 C N N 122 LEU CD2 C N N 123 LEU OXT O N N 124 LEU H H N N 125 LEU H2 H N N 126 LEU HA H N N 127 LEU HB2 H N N 128 LEU HB3 H N N 129 LEU HG H N N 130 LEU HD11 H N N 131 LEU HD12 H N N 132 LEU HD13 H N N 133 LEU HD21 H N N 134 LEU HD22 H N N 135 LEU HD23 H N N 136 LEU HXT H N N 137 LYS N N N N 138 LYS CA C N S 139 LYS C C N N 140 LYS O O N N 141 LYS CB C N N 142 LYS CG C N N 143 LYS CD C N N 144 LYS CE C N N 145 LYS NZ N N N 146 LYS OXT O N N 147 LYS H H N N 148 LYS H2 H N N 149 LYS HA H N N 150 LYS HB2 H N N 151 LYS HB3 H N N 152 LYS HG2 H N N 153 LYS HG3 H N N 154 LYS HD2 H N N 155 LYS HD3 H N N 156 LYS HE2 H N N 157 LYS HE3 H N N 158 LYS HZ1 H N N 159 LYS HZ2 H N N 160 LYS HZ3 H N N 161 LYS HXT H N N 162 MET N N N N 163 MET CA C N S 164 MET C C N N 165 MET O O N N 166 MET CB C N N 167 MET CG C N N 168 MET SD S N N 169 MET CE C N N 170 MET OXT O N N 171 MET H H N N 172 MET H2 H N N 173 MET HA H N N 174 MET HB2 H N N 175 MET HB3 H N N 176 MET HG2 H N N 177 MET HG3 H N N 178 MET HE1 H N N 179 MET HE2 H N N 180 MET HE3 H N N 181 MET HXT H N N 182 PHE N N N N 183 PHE CA C N S 184 PHE C C N N 185 PHE O O N N 186 PHE CB C N N 187 PHE CG C Y N 188 PHE CD1 C Y N 189 PHE CD2 C Y N 190 PHE CE1 C Y N 191 PHE CE2 C Y N 192 PHE CZ C Y N 193 PHE OXT O N N 194 PHE H H N N 195 PHE H2 H N N 196 PHE HA H N N 197 PHE HB2 H N N 198 PHE HB3 H N N 199 PHE HD1 H N N 200 PHE HD2 H N N 201 PHE HE1 H N N 202 PHE HE2 H N N 203 PHE HZ H N N 204 PHE HXT H N N 205 PRO N N N N 206 PRO CA C N S 207 PRO C C N N 208 PRO O O N N 209 PRO CB C N N 210 PRO CG C N N 211 PRO CD C N N 212 PRO OXT O N N 213 PRO H H N N 214 PRO HA H N N 215 PRO HB2 H N N 216 PRO HB3 H N N 217 PRO HG2 H N N 218 PRO HG3 H N N 219 PRO HD2 H N N 220 PRO HD3 H N N 221 PRO HXT H N N 222 SER N N N N 223 SER CA C N S 224 SER C C N N 225 SER O O N N 226 SER CB C N N 227 SER OG O N N 228 SER OXT O N N 229 SER H H N N 230 SER H2 H N N 231 SER HA H N N 232 SER HB2 H N N 233 SER HB3 H N N 234 SER HG H N N 235 SER HXT H N N 236 THR N N N N 237 THR CA C N S 238 THR C C N N 239 THR O O N N 240 THR CB C N R 241 THR OG1 O N N 242 THR CG2 C N N 243 THR OXT O N N 244 THR H H N N 245 THR H2 H N N 246 THR HA H N N 247 THR HB H N N 248 THR HG1 H N N 249 THR HG21 H N N 250 THR HG22 H N N 251 THR HG23 H N N 252 THR HXT H N N 253 TRP N N N N 254 TRP CA C N S 255 TRP C C N N 256 TRP O O N N 257 TRP CB C N N 258 TRP CG C Y N 259 TRP CD1 C Y N 260 TRP CD2 C Y N 261 TRP NE1 N Y N 262 TRP CE2 C Y N 263 TRP CE3 C Y N 264 TRP CZ2 C Y N 265 TRP CZ3 C Y N 266 TRP CH2 C Y N 267 TRP OXT O N N 268 TRP H H N N 269 TRP H2 H N N 270 TRP HA H N N 271 TRP HB2 H N N 272 TRP HB3 H N N 273 TRP HD1 H N N 274 TRP HE1 H N N 275 TRP HE3 H N N 276 TRP HZ2 H N N 277 TRP HZ3 H N N 278 TRP HH2 H N N 279 TRP HXT H N N 280 VAL N N N N 281 VAL CA C N S 282 VAL C C N N 283 VAL O O N N 284 VAL CB C N N 285 VAL CG1 C N N 286 VAL CG2 C N N 287 VAL OXT O N N 288 VAL H H N N 289 VAL H2 H N N 290 VAL HA H N N 291 VAL HB H N N 292 VAL HG11 H N N 293 VAL HG12 H N N 294 VAL HG13 H N N 295 VAL HG21 H N N 296 VAL HG22 H N N 297 VAL HG23 H N N 298 VAL HXT H N N 299 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASP N CA sing N N 13 ASP N H sing N N 14 ASP N H2 sing N N 15 ASP CA C sing N N 16 ASP CA CB sing N N 17 ASP CA HA sing N N 18 ASP C O doub N N 19 ASP C OXT sing N N 20 ASP CB CG sing N N 21 ASP CB HB2 sing N N 22 ASP CB HB3 sing N N 23 ASP CG OD1 doub N N 24 ASP CG OD2 sing N N 25 ASP OD2 HD2 sing N N 26 ASP OXT HXT sing N N 27 CYS N CA sing N N 28 CYS N H sing N N 29 CYS N H2 sing N N 30 CYS CA C sing N N 31 CYS CA CB sing N N 32 CYS CA HA sing N N 33 CYS C O doub N N 34 CYS C OXT sing N N 35 CYS CB SG sing N N 36 CYS CB HB2 sing N N 37 CYS CB HB3 sing N N 38 CYS SG HG sing N N 39 CYS OXT HXT sing N N 40 GLU N CA sing N N 41 GLU N H sing N N 42 GLU N H2 sing N N 43 GLU CA C sing N N 44 GLU CA CB sing N N 45 GLU CA HA sing N N 46 GLU C O doub N N 47 GLU C OXT sing N N 48 GLU CB CG sing N N 49 GLU CB HB2 sing N N 50 GLU CB HB3 sing N N 51 GLU CG CD sing N N 52 GLU CG HG2 sing N N 53 GLU CG HG3 sing N N 54 GLU CD OE1 doub N N 55 GLU CD OE2 sing N N 56 GLU OE2 HE2 sing N N 57 GLU OXT HXT sing N N 58 GLY N CA sing N N 59 GLY N H sing N N 60 GLY N H2 sing N N 61 GLY CA C sing N N 62 GLY CA HA2 sing N N 63 GLY CA HA3 sing N N 64 GLY C O doub N N 65 GLY C OXT sing N N 66 GLY OXT HXT sing N N 67 HIS N CA sing N N 68 HIS N H sing N N 69 HIS N H2 sing N N 70 HIS CA C sing N N 71 HIS CA CB sing N N 72 HIS CA HA sing N N 73 HIS C O doub N N 74 HIS C OXT sing N N 75 HIS CB CG sing N N 76 HIS CB HB2 sing N N 77 HIS CB HB3 sing N N 78 HIS CG ND1 sing Y N 79 HIS CG CD2 doub Y N 80 HIS ND1 CE1 doub Y N 81 HIS ND1 HD1 sing N N 82 HIS CD2 NE2 sing Y N 83 HIS CD2 HD2 sing N N 84 HIS CE1 NE2 sing Y N 85 HIS CE1 HE1 sing N N 86 HIS NE2 HE2 sing N N 87 HIS OXT HXT sing N N 88 ILE N CA sing N N 89 ILE N H sing N N 90 ILE N H2 sing N N 91 ILE CA C sing N N 92 ILE CA CB sing N N 93 ILE CA HA sing N N 94 ILE C O doub N N 95 ILE C OXT sing N N 96 ILE CB CG1 sing N N 97 ILE CB CG2 sing N N 98 ILE CB HB sing N N 99 ILE CG1 CD1 sing N N 100 ILE CG1 HG12 sing N N 101 ILE CG1 HG13 sing N N 102 ILE CG2 HG21 sing N N 103 ILE CG2 HG22 sing N N 104 ILE CG2 HG23 sing N N 105 ILE CD1 HD11 sing N N 106 ILE CD1 HD12 sing N N 107 ILE CD1 HD13 sing N N 108 ILE OXT HXT sing N N 109 LEU N CA sing N N 110 LEU N H sing N N 111 LEU N H2 sing N N 112 LEU CA C sing N N 113 LEU CA CB sing N N 114 LEU CA HA sing N N 115 LEU C O doub N N 116 LEU C OXT sing N N 117 LEU CB CG sing N N 118 LEU CB HB2 sing N N 119 LEU CB HB3 sing N N 120 LEU CG CD1 sing N N 121 LEU CG CD2 sing N N 122 LEU CG HG sing N N 123 LEU CD1 HD11 sing N N 124 LEU CD1 HD12 sing N N 125 LEU CD1 HD13 sing N N 126 LEU CD2 HD21 sing N N 127 LEU CD2 HD22 sing N N 128 LEU CD2 HD23 sing N N 129 LEU OXT HXT sing N N 130 LYS N CA sing N N 131 LYS N H sing N N 132 LYS N H2 sing N N 133 LYS CA C sing N N 134 LYS CA CB sing N N 135 LYS CA HA sing N N 136 LYS C O doub N N 137 LYS C OXT sing N N 138 LYS CB CG sing N N 139 LYS CB HB2 sing N N 140 LYS CB HB3 sing N N 141 LYS CG CD sing N N 142 LYS CG HG2 sing N N 143 LYS CG HG3 sing N N 144 LYS CD CE sing N N 145 LYS CD HD2 sing N N 146 LYS CD HD3 sing N N 147 LYS CE NZ sing N N 148 LYS CE HE2 sing N N 149 LYS CE HE3 sing N N 150 LYS NZ HZ1 sing N N 151 LYS NZ HZ2 sing N N 152 LYS NZ HZ3 sing N N 153 LYS OXT HXT sing N N 154 MET N CA sing N N 155 MET N H sing N N 156 MET N H2 sing N N 157 MET CA C sing N N 158 MET CA CB sing N N 159 MET CA HA sing N N 160 MET C O doub N N 161 MET C OXT sing N N 162 MET CB CG sing N N 163 MET CB HB2 sing N N 164 MET CB HB3 sing N N 165 MET CG SD sing N N 166 MET CG HG2 sing N N 167 MET CG HG3 sing N N 168 MET SD CE sing N N 169 MET CE HE1 sing N N 170 MET CE HE2 sing N N 171 MET CE HE3 sing N N 172 MET OXT HXT sing N N 173 PHE N CA sing N N 174 PHE N H sing N N 175 PHE N H2 sing N N 176 PHE CA C sing N N 177 PHE CA CB sing N N 178 PHE CA HA sing N N 179 PHE C O doub N N 180 PHE C OXT sing N N 181 PHE CB CG sing N N 182 PHE CB HB2 sing N N 183 PHE CB HB3 sing N N 184 PHE CG CD1 doub Y N 185 PHE CG CD2 sing Y N 186 PHE CD1 CE1 sing Y N 187 PHE CD1 HD1 sing N N 188 PHE CD2 CE2 doub Y N 189 PHE CD2 HD2 sing N N 190 PHE CE1 CZ doub Y N 191 PHE CE1 HE1 sing N N 192 PHE CE2 CZ sing Y N 193 PHE CE2 HE2 sing N N 194 PHE CZ HZ sing N N 195 PHE OXT HXT sing N N 196 PRO N CA sing N N 197 PRO N CD sing N N 198 PRO N H sing N N 199 PRO CA C sing N N 200 PRO CA CB sing N N 201 PRO CA HA sing N N 202 PRO C O doub N N 203 PRO C OXT sing N N 204 PRO CB CG sing N N 205 PRO CB HB2 sing N N 206 PRO CB HB3 sing N N 207 PRO CG CD sing N N 208 PRO CG HG2 sing N N 209 PRO CG HG3 sing N N 210 PRO CD HD2 sing N N 211 PRO CD HD3 sing N N 212 PRO OXT HXT sing N N 213 SER N CA sing N N 214 SER N H sing N N 215 SER N H2 sing N N 216 SER CA C sing N N 217 SER CA CB sing N N 218 SER CA HA sing N N 219 SER C O doub N N 220 SER C OXT sing N N 221 SER CB OG sing N N 222 SER CB HB2 sing N N 223 SER CB HB3 sing N N 224 SER OG HG sing N N 225 SER OXT HXT sing N N 226 THR N CA sing N N 227 THR N H sing N N 228 THR N H2 sing N N 229 THR CA C sing N N 230 THR CA CB sing N N 231 THR CA HA sing N N 232 THR C O doub N N 233 THR C OXT sing N N 234 THR CB OG1 sing N N 235 THR CB CG2 sing N N 236 THR CB HB sing N N 237 THR OG1 HG1 sing N N 238 THR CG2 HG21 sing N N 239 THR CG2 HG22 sing N N 240 THR CG2 HG23 sing N N 241 THR OXT HXT sing N N 242 TRP N CA sing N N 243 TRP N H sing N N 244 TRP N H2 sing N N 245 TRP CA C sing N N 246 TRP CA CB sing N N 247 TRP CA HA sing N N 248 TRP C O doub N N 249 TRP C OXT sing N N 250 TRP CB CG sing N N 251 TRP CB HB2 sing N N 252 TRP CB HB3 sing N N 253 TRP CG CD1 doub Y N 254 TRP CG CD2 sing Y N 255 TRP CD1 NE1 sing Y N 256 TRP CD1 HD1 sing N N 257 TRP CD2 CE2 doub Y N 258 TRP CD2 CE3 sing Y N 259 TRP NE1 CE2 sing Y N 260 TRP NE1 HE1 sing N N 261 TRP CE2 CZ2 sing Y N 262 TRP CE3 CZ3 doub Y N 263 TRP CE3 HE3 sing N N 264 TRP CZ2 CH2 doub Y N 265 TRP CZ2 HZ2 sing N N 266 TRP CZ3 CH2 sing Y N 267 TRP CZ3 HZ3 sing N N 268 TRP CH2 HH2 sing N N 269 TRP OXT HXT sing N N 270 VAL N CA sing N N 271 VAL N H sing N N 272 VAL N H2 sing N N 273 VAL CA C sing N N 274 VAL CA CB sing N N 275 VAL CA HA sing N N 276 VAL C O doub N N 277 VAL C OXT sing N N 278 VAL CB CG1 sing N N 279 VAL CB CG2 sing N N 280 VAL CB HB sing N N 281 VAL CG1 HG11 sing N N 282 VAL CG1 HG12 sing N N 283 VAL CG1 HG13 sing N N 284 VAL CG2 HG21 sing N N 285 VAL CG2 HG22 sing N N 286 VAL CG2 HG23 sing N N 287 VAL OXT HXT sing N N 288 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Natural Science Foundation of China (NSFC)' China 82350710799 1 'Chinese Academy of Sciences' China XDB1060000 2 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 'AVANCE III' ? Bruker 600 cryoprobe 2 'AVANCE III' ? Bruker 900 cryoprobe # _atom_sites.entry_id 9XEA _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O # loop_ #