data_9XH1 # _entry.id 9XH1 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.417 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9XH1 pdb_00009xh1 10.2210/pdb9xh1/pdb WWPDB D_1300064349 ? ? BMRB 36807 ? 10.13018/BMR36807 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-11-04 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr . _pdbx_database_status.entry_id 9XH1 _pdbx_database_status.recvd_initial_deposition_date 2025-10-31 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs . _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Cup s 7 NMR structure' _pdbx_database_related.db_id 36807 _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email kumeta@pharm.hokudai.ac.jp _pdbx_contact_author.name_first Hiroyuki _pdbx_contact_author.name_last Kumeta _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-3713-2122 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Kumeta, H.' 1 0000-0003-3713-2122 'Yoshikawa, I.' 2 0009-0002-4785-9085 'Arai, T.' 3 0000-0002-2328-9519 'Aizawa, T.' 4 0000-0001-9134-7576 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Analysis of gibberellin-regulated proteins and potential allergens in Cupressus sempervirens pollen' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Iizuka, T.' 1 0000-0002-1946-277X primary 'Yoshikawa, I.' 2 0009-0002-4785-9085 primary 'Kumeta, H.' 3 0000-0003-3713-2122 primary 'Arai, T.' 4 0000-0002-2328-9519 primary 'Aizawa, T.' 5 0000-0001-9134-7576 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Cypmaclein _entity.formula_weight 6846.926 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Cup s 7' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code AQIDCDKECNRRCSKASAHDRCIKYCGICCEKCHCVPPGTAGNEDVCPCYANLKNSKGGHKCP _entity_poly.pdbx_seq_one_letter_code_can AQIDCDKECNRRCSKASAHDRCIKYCGICCEKCHCVPPGTAGNEDVCPCYANLKNSKGGHKCP _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 GLN n 1 3 ILE n 1 4 ASP n 1 5 CYS n 1 6 ASP n 1 7 LYS n 1 8 GLU n 1 9 CYS n 1 10 ASN n 1 11 ARG n 1 12 ARG n 1 13 CYS n 1 14 SER n 1 15 LYS n 1 16 ALA n 1 17 SER n 1 18 ALA n 1 19 HIS n 1 20 ASP n 1 21 ARG n 1 22 CYS n 1 23 ILE n 1 24 LYS n 1 25 TYR n 1 26 CYS n 1 27 GLY n 1 28 ILE n 1 29 CYS n 1 30 CYS n 1 31 GLU n 1 32 LYS n 1 33 CYS n 1 34 HIS n 1 35 CYS n 1 36 VAL n 1 37 PRO n 1 38 PRO n 1 39 GLY n 1 40 THR n 1 41 ALA n 1 42 GLY n 1 43 ASN n 1 44 GLU n 1 45 ASP n 1 46 VAL n 1 47 CYS n 1 48 PRO n 1 49 CYS n 1 50 TYR n 1 51 ALA n 1 52 ASN n 1 53 LEU n 1 54 LYS n 1 55 ASN n 1 56 SER n 1 57 LYS n 1 58 GLY n 1 59 GLY n 1 60 HIS n 1 61 LYS n 1 62 CYS n 1 63 PRO n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 63 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Cupressus sempervirens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 13469 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Komagataella pastoris' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 4922 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 GLN 2 2 2 GLN GLN A . n A 1 3 ILE 3 3 3 ILE ILE A . n A 1 4 ASP 4 4 4 ASP ASP A . n A 1 5 CYS 5 5 5 CYS CYS A . n A 1 6 ASP 6 6 6 ASP ASP A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 CYS 9 9 9 CYS CYS A . n A 1 10 ASN 10 10 10 ASN ASN A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 ARG 12 12 12 ARG ARG A . n A 1 13 CYS 13 13 13 CYS CYS A . n A 1 14 SER 14 14 14 SER SER A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 HIS 19 19 19 HIS HIS A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 CYS 22 22 22 CYS CYS A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 TYR 25 25 25 TYR TYR A . n A 1 26 CYS 26 26 26 CYS CYS A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 ILE 28 28 28 ILE ILE A . n A 1 29 CYS 29 29 29 CYS CYS A . n A 1 30 CYS 30 30 30 CYS CYS A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 CYS 33 33 33 CYS CYS A . n A 1 34 HIS 34 34 34 HIS HIS A . n A 1 35 CYS 35 35 35 CYS CYS A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 PRO 37 37 37 PRO PRO A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 THR 40 40 40 THR THR A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 ASN 43 43 43 ASN ASN A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 ASP 45 45 45 ASP ASP A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 CYS 47 47 47 CYS CYS A . n A 1 48 PRO 48 48 48 PRO PRO A . n A 1 49 CYS 49 49 49 CYS CYS A . n A 1 50 TYR 50 50 50 TYR TYR A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 ASN 52 52 52 ASN ASN A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 ASN 55 55 55 ASN ASN A . n A 1 56 SER 56 56 56 SER SER A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 HIS 60 60 60 HIS HIS A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 CYS 62 62 62 CYS CYS A . n A 1 63 PRO 63 63 63 PRO PRO A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9XH1 _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 9XH1 _struct.title 'Cup s 7 NMR structure' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9XH1 _struct_keywords.text 'STRUCTURE FROM CYANA 2.1, ALLERGEN' _struct_keywords.pdbx_keywords ALLERGEN # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CMLN1_CUPSE _struct_ref.pdbx_db_accession C0HLQ2 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code AQIDCDKECNRRCSKASAHDRCLKYCGICCEKCHCVPPGTAGNEDVCPCYANLKNSKGGHKCP _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9XH1 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 63 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession C0HLQ2 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 63 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 63 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 9XH1 _struct_ref_seq_dif.mon_id ILE _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 23 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code C0HLQ2 _struct_ref_seq_dif.db_mon_id LEU _struct_ref_seq_dif.pdbx_seq_db_seq_num 23 _struct_ref_seq_dif.details conflict _struct_ref_seq_dif.pdbx_auth_seq_num 23 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'NMR Distance Restraints' _pdbx_struct_assembly_auth_evidence.details 'not applicable' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0 _pdbx_struct_oper_list.matrix[1][2] 0.0 _pdbx_struct_oper_list.matrix[1][3] 0.0 _pdbx_struct_oper_list.vector[1] 0.0 _pdbx_struct_oper_list.matrix[2][1] 0.0 _pdbx_struct_oper_list.matrix[2][2] 1.0 _pdbx_struct_oper_list.matrix[2][3] 0.0 _pdbx_struct_oper_list.vector[2] 0.0 _pdbx_struct_oper_list.matrix[3][1] 0.0 _pdbx_struct_oper_list.matrix[3][2] 0.0 _pdbx_struct_oper_list.matrix[3][3] 1.0 _pdbx_struct_oper_list.vector[3] 0.0 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ARG A 11 ? LYS A 15 ? ARG A 11 LYS A 15 5 ? 5 HELX_P HELX_P2 AA2 ALA A 18 ? CYS A 30 ? ALA A 18 CYS A 30 1 ? 13 HELX_P HELX_P3 AA3 CYS A 47 ? ASN A 52 ? CYS A 47 ASN A 52 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 5 SG ? ? ? 1_555 A CYS 30 SG ? ? A CYS 5 A CYS 30 1_555 ? ? ? ? ? ? ? 1.992 ? ? disulf2 disulf ? ? A CYS 9 SG ? ? ? 1_555 A CYS 26 SG ? ? A CYS 9 A CYS 26 1_555 ? ? ? ? ? ? ? 2.128 ? ? disulf3 disulf ? ? A CYS 13 SG ? ? ? 1_555 A CYS 22 SG ? ? A CYS 13 A CYS 22 1_555 ? ? ? ? ? ? ? 2.334 ? ? disulf4 disulf ? ? A CYS 29 SG ? ? ? 1_555 A CYS 62 SG ? ? A CYS 29 A CYS 62 1_555 ? ? ? ? ? ? ? 1.981 ? ? disulf5 disulf ? ? A CYS 33 SG ? ? ? 1_555 A CYS 49 SG ? ? A CYS 33 A CYS 49 1_555 ? ? ? ? ? ? ? 2.012 ? ? disulf6 disulf ? ? A CYS 35 SG ? ? ? 1_555 A CYS 47 SG ? ? A CYS 35 A CYS 47 1_555 ? ? ? ? ? ? ? 1.994 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 5 ? CYS A 30 ? CYS A 5 ? 1_555 CYS A 30 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 9 ? CYS A 26 ? CYS A 9 ? 1_555 CYS A 26 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 13 ? CYS A 22 ? CYS A 13 ? 1_555 CYS A 22 ? 1_555 SG SG . . . None 'Disulfide bridge' 4 CYS A 29 ? CYS A 62 ? CYS A 29 ? 1_555 CYS A 62 ? 1_555 SG SG . . . None 'Disulfide bridge' 5 CYS A 33 ? CYS A 49 ? CYS A 33 ? 1_555 CYS A 49 ? 1_555 SG SG . . . None 'Disulfide bridge' 6 CYS A 35 ? CYS A 47 ? CYS A 35 ? 1_555 CYS A 47 ? 1_555 SG SG . . . None 'Disulfide bridge' # _pdbx_entry_details.entry_id 9XH1 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 16 _pdbx_validate_close_contact.auth_atom_id_1 SG _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 CYS _pdbx_validate_close_contact.auth_seq_id_1 33 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 SG _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 CYS _pdbx_validate_close_contact.auth_seq_id_2 62 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.85 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 11 ? ? -74.92 -78.36 2 1 CYS A 22 ? ? -72.26 -81.02 3 1 LYS A 32 ? ? -131.53 -64.75 4 1 HIS A 34 ? ? 87.05 -4.21 5 1 CYS A 35 ? ? -118.20 -165.88 6 1 VAL A 36 ? ? -172.69 93.60 7 1 ALA A 41 ? ? -137.31 -159.49 8 1 ASN A 43 ? ? -112.39 -87.13 9 1 ASP A 45 ? ? -143.67 17.56 10 1 ASN A 55 ? ? -91.34 -156.06 11 2 ARG A 11 ? ? -74.25 -79.43 12 2 CYS A 22 ? ? -72.07 -81.25 13 2 LYS A 32 ? ? -121.34 -64.76 14 2 HIS A 34 ? ? 87.41 -1.12 15 2 VAL A 36 ? ? -172.90 92.58 16 2 ALA A 41 ? ? -137.41 -159.61 17 2 ASN A 43 ? ? -121.60 -86.46 18 3 ARG A 11 ? ? -71.14 -80.44 19 3 ALA A 18 ? ? -101.07 62.68 20 3 CYS A 22 ? ? -70.26 -80.68 21 3 LYS A 32 ? ? -126.65 -64.98 22 3 HIS A 34 ? ? 88.58 -3.70 23 3 CYS A 35 ? ? -111.61 -163.82 24 3 VAL A 36 ? ? -166.88 111.89 25 3 ALA A 41 ? ? -137.37 -159.51 26 3 ASN A 43 ? ? -72.65 -87.27 27 3 ASN A 52 ? ? -139.69 -59.27 28 3 ASN A 55 ? ? -101.20 -154.00 29 4 ARG A 11 ? ? -86.39 -73.17 30 4 CYS A 22 ? ? -71.07 -81.44 31 4 LYS A 32 ? ? -125.92 -58.81 32 4 CYS A 35 ? ? -122.00 -166.58 33 4 VAL A 36 ? ? -172.58 93.19 34 4 ALA A 41 ? ? -137.26 -159.57 35 4 ASN A 43 ? ? -138.74 -82.29 36 4 ASN A 55 ? ? -96.38 -153.86 37 5 ARG A 11 ? ? -61.77 -77.17 38 5 LYS A 32 ? ? -142.45 -65.20 39 5 HIS A 34 ? ? 81.31 -1.41 40 5 CYS A 35 ? ? -126.57 -156.89 41 5 ALA A 41 ? ? -137.85 -159.43 42 5 ASN A 43 ? ? -145.08 -87.17 43 5 ASN A 52 ? ? -132.65 -59.23 44 6 ASN A 10 ? ? -35.41 -30.53 45 6 CYS A 13 ? ? -93.34 31.44 46 6 SER A 14 ? ? -63.73 -81.33 47 6 LYS A 24 ? ? -62.88 -73.44 48 6 LYS A 32 ? ? -142.64 -64.82 49 6 HIS A 34 ? ? 80.14 -2.55 50 6 VAL A 36 ? ? -171.11 92.79 51 6 ALA A 41 ? ? -137.22 -159.77 52 6 ASN A 43 ? ? -142.60 -81.99 53 6 ASN A 55 ? ? -113.34 -153.46 54 7 ARG A 11 ? ? -69.15 -71.34 55 7 ALA A 18 ? ? -104.63 62.96 56 7 LYS A 24 ? ? -72.49 -70.58 57 7 LYS A 32 ? ? -122.42 -59.42 58 7 HIS A 34 ? ? 88.88 20.77 59 7 ALA A 41 ? ? -137.32 -159.39 60 7 ASN A 43 ? ? -140.35 -87.45 61 8 LYS A 24 ? ? -70.48 -75.51 62 8 ALA A 41 ? ? -137.98 -159.21 63 8 ASN A 43 ? ? -133.67 -68.63 64 8 ASN A 55 ? ? -101.31 -156.80 65 9 ARG A 11 ? ? -67.41 -71.20 66 9 ALA A 18 ? ? -101.25 62.76 67 9 LYS A 32 ? ? -139.19 -64.70 68 9 HIS A 34 ? ? 77.93 -0.20 69 9 VAL A 36 ? ? -162.39 92.60 70 9 ALA A 41 ? ? -137.52 -159.52 71 9 ASN A 43 ? ? -114.21 -87.13 72 9 GLU A 44 ? ? 56.11 17.95 73 9 ASN A 52 ? ? -145.32 -58.90 74 9 ASN A 55 ? ? -88.54 -157.28 75 10 ARG A 11 ? ? -70.73 -80.92 76 10 LYS A 32 ? ? -99.94 -64.44 77 10 HIS A 34 ? ? 90.84 8.44 78 10 VAL A 36 ? ? -172.96 100.88 79 10 ALA A 41 ? ? -137.30 -159.48 80 10 ASN A 43 ? ? -128.30 -88.22 81 10 ALA A 51 ? ? -45.64 -72.07 82 10 CYS A 62 ? ? -172.44 136.74 83 11 CYS A 13 ? ? -90.88 31.08 84 11 ALA A 18 ? ? -102.59 64.46 85 11 LYS A 32 ? ? -142.59 -61.87 86 11 HIS A 34 ? ? 56.68 17.96 87 11 VAL A 36 ? ? -172.98 92.55 88 11 ALA A 41 ? ? -137.70 -159.51 89 11 ASN A 43 ? ? -114.05 -88.03 90 11 CYS A 47 ? ? -164.25 107.57 91 11 LEU A 53 ? ? -57.89 102.28 92 11 ASN A 55 ? ? -73.56 -156.55 93 11 CYS A 62 ? ? -171.71 99.51 94 12 ARG A 11 ? ? -73.93 -71.80 95 12 CYS A 13 ? ? -89.64 31.05 96 12 ALA A 18 ? ? -102.10 64.01 97 12 LYS A 32 ? ? -94.67 -64.59 98 12 HIS A 34 ? ? 90.51 6.54 99 12 VAL A 36 ? ? -173.04 94.74 100 12 ALA A 41 ? ? -137.57 -159.58 101 12 ASN A 43 ? ? -114.46 -87.47 102 12 GLU A 44 ? ? 49.30 28.92 103 12 CYS A 47 ? ? -164.07 97.92 104 13 ARG A 11 ? ? -65.98 -74.79 105 13 LYS A 32 ? ? -137.53 -64.45 106 13 HIS A 34 ? ? 85.61 -1.49 107 13 VAL A 36 ? ? -162.15 91.94 108 13 ALA A 41 ? ? -137.47 -159.52 109 13 ASN A 43 ? ? -84.90 -86.87 110 13 ASN A 55 ? ? -92.40 -154.39 111 14 ARG A 11 ? ? -70.44 -81.18 112 14 ALA A 18 ? ? -101.37 64.35 113 14 CYS A 22 ? ? -92.15 -82.64 114 14 HIS A 34 ? ? 89.67 -4.26 115 14 VAL A 36 ? ? -172.71 95.33 116 14 ALA A 41 ? ? -137.51 -159.35 117 14 ASN A 43 ? ? -130.25 -88.61 118 14 ASN A 55 ? ? -98.54 -156.74 119 15 ASP A 4 ? ? -101.61 76.10 120 15 ASN A 10 ? ? -35.35 -30.42 121 15 CYS A 13 ? ? -92.62 35.07 122 15 SER A 14 ? ? -86.40 -74.08 123 15 ALA A 18 ? ? -111.85 62.85 124 15 CYS A 22 ? ? -97.24 -60.90 125 15 LYS A 24 ? ? -61.86 -73.53 126 15 LYS A 32 ? ? -142.83 -64.95 127 15 CYS A 35 ? ? -110.35 -155.59 128 15 VAL A 36 ? ? -166.28 102.38 129 15 ASN A 43 ? ? -52.42 -86.27 130 15 GLU A 44 ? ? 47.10 24.34 131 15 ASN A 55 ? ? -96.00 -157.08 132 16 ASP A 4 ? ? -113.51 76.18 133 16 ASN A 10 ? ? -35.79 -29.45 134 16 CYS A 13 ? ? -92.76 31.04 135 16 SER A 14 ? ? -63.55 -80.92 136 16 CYS A 22 ? ? -97.50 -63.60 137 16 LYS A 24 ? ? -62.00 -73.68 138 16 LYS A 32 ? ? -138.39 -60.93 139 16 VAL A 36 ? ? -161.18 105.59 140 16 THR A 40 ? ? -38.53 -35.64 141 16 ALA A 41 ? ? -137.23 -159.48 142 16 ASN A 43 ? ? -91.35 -84.55 143 16 ASN A 52 ? ? -135.45 -59.06 144 16 LEU A 53 ? ? -52.96 100.48 145 16 ASN A 55 ? ? -98.17 -156.57 146 17 ASP A 4 ? ? -106.90 76.40 147 17 ASN A 10 ? ? -34.38 -31.51 148 17 CYS A 13 ? ? -89.17 33.09 149 17 LYS A 24 ? ? -69.94 -71.28 150 17 LYS A 32 ? ? -142.52 -64.66 151 17 HIS A 34 ? ? 43.76 27.22 152 17 ALA A 41 ? ? -138.01 -159.28 153 17 ASN A 43 ? ? -140.74 -86.12 154 17 LEU A 53 ? ? -39.62 111.96 155 17 ASN A 55 ? ? -105.14 -159.91 156 18 ALA A 18 ? ? -107.25 63.02 157 18 LYS A 24 ? ? -73.77 -70.61 158 18 LYS A 32 ? ? -140.44 -64.63 159 18 ALA A 41 ? ? -137.48 -159.46 160 18 ASN A 43 ? ? -141.98 -86.96 161 18 ASN A 55 ? ? -115.30 -159.44 162 18 HIS A 60 ? ? -39.91 121.87 163 19 CYS A 13 ? ? -90.93 30.45 164 19 ALA A 18 ? ? -102.56 64.07 165 19 LYS A 24 ? ? -76.99 -70.37 166 19 LYS A 32 ? ? -142.57 -64.73 167 19 HIS A 34 ? ? 79.18 -1.37 168 19 VAL A 36 ? ? -163.96 108.71 169 19 ALA A 41 ? ? -137.32 -159.64 170 19 ASN A 43 ? ? -58.95 -87.87 171 19 CYS A 47 ? ? -164.34 113.11 172 19 ASN A 52 ? ? -137.44 -58.97 173 19 ASN A 55 ? ? -89.48 -153.35 174 20 ASP A 4 ? ? -112.85 76.14 175 20 ASN A 10 ? ? -35.37 -29.91 176 20 CYS A 13 ? ? -94.57 32.24 177 20 SER A 14 ? ? -64.85 -80.96 178 20 LYS A 24 ? ? -67.51 -71.60 179 20 LYS A 32 ? ? -142.69 -62.11 180 20 VAL A 36 ? ? -161.17 102.69 181 20 ALA A 41 ? ? -137.14 -159.46 182 20 ASN A 43 ? ? -127.96 -65.92 183 20 CYS A 47 ? ? -162.95 113.23 184 20 ASN A 55 ? ? -101.33 -152.96 # _pdbx_nmr_ensemble.entry_id 9XH1 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 9XH1 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'target function' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.5 mM NA-13C; U-15N Cup s 7, 10 % D2O, 90 % H2O, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label CN_label _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'Cup s 7' 0.5 ? mM 'NA-13C; U-15N' 1 D2O 10 ? % 'natural abundance' 1 H2O 90 ? % 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298.15 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 3.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 'no salt' _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units 'Not defined' _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 1 '2D 1H-13C HSQC aliphatic' 2 isotropic 3 1 1 '2D 1H-1H TOCSY' 2 isotropic 4 1 1 '2D 1H-1H NOESY' 2 isotropic 5 1 1 '3D 1H-15N NOESY' 1 isotropic 6 1 1 '3D HNCA' 3 isotropic # _pdbx_nmr_refine.entry_id 9XH1 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 7 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 collection VNMR 6.1C Varian 2 collection TopSpin 3.2 'Bruker Biospin' 3 collection TopSpin 4.1.4 'Bruker Biospin' 4 processing NMRPipe 8.2 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 8 'chemical shift assignment' Sparky 3.1113 'T. D. Goddard and D. G. Kneller,' 7 'structure calculation' CYANA 2.1 'Guntert, Mumenthaler and Wuthrich' 6 'data analysis' TALOS+ 8.2 'Yang Shen, Frank Delaglio, Gabriel Cornilescu, and Ad Bax' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 PRO N N N N 227 PRO CA C N S 228 PRO C C N N 229 PRO O O N N 230 PRO CB C N N 231 PRO CG C N N 232 PRO CD C N N 233 PRO OXT O N N 234 PRO H H N N 235 PRO HA H N N 236 PRO HB2 H N N 237 PRO HB3 H N N 238 PRO HG2 H N N 239 PRO HG3 H N N 240 PRO HD2 H N N 241 PRO HD3 H N N 242 PRO HXT H N N 243 SER N N N N 244 SER CA C N S 245 SER C C N N 246 SER O O N N 247 SER CB C N N 248 SER OG O N N 249 SER OXT O N N 250 SER H H N N 251 SER H2 H N N 252 SER HA H N N 253 SER HB2 H N N 254 SER HB3 H N N 255 SER HG H N N 256 SER HXT H N N 257 THR N N N N 258 THR CA C N S 259 THR C C N N 260 THR O O N N 261 THR CB C N R 262 THR OG1 O N N 263 THR CG2 C N N 264 THR OXT O N N 265 THR H H N N 266 THR H2 H N N 267 THR HA H N N 268 THR HB H N N 269 THR HG1 H N N 270 THR HG21 H N N 271 THR HG22 H N N 272 THR HG23 H N N 273 THR HXT H N N 274 TYR N N N N 275 TYR CA C N S 276 TYR C C N N 277 TYR O O N N 278 TYR CB C N N 279 TYR CG C Y N 280 TYR CD1 C Y N 281 TYR CD2 C Y N 282 TYR CE1 C Y N 283 TYR CE2 C Y N 284 TYR CZ C Y N 285 TYR OH O N N 286 TYR OXT O N N 287 TYR H H N N 288 TYR H2 H N N 289 TYR HA H N N 290 TYR HB2 H N N 291 TYR HB3 H N N 292 TYR HD1 H N N 293 TYR HD2 H N N 294 TYR HE1 H N N 295 TYR HE2 H N N 296 TYR HH H N N 297 TYR HXT H N N 298 VAL N N N N 299 VAL CA C N S 300 VAL C C N N 301 VAL O O N N 302 VAL CB C N N 303 VAL CG1 C N N 304 VAL CG2 C N N 305 VAL OXT O N N 306 VAL H H N N 307 VAL H2 H N N 308 VAL HA H N N 309 VAL HB H N N 310 VAL HG11 H N N 311 VAL HG12 H N N 312 VAL HG13 H N N 313 VAL HG21 H N N 314 VAL HG22 H N N 315 VAL HG23 H N N 316 VAL HXT H N N 317 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 PRO N CA sing N N 216 PRO N CD sing N N 217 PRO N H sing N N 218 PRO CA C sing N N 219 PRO CA CB sing N N 220 PRO CA HA sing N N 221 PRO C O doub N N 222 PRO C OXT sing N N 223 PRO CB CG sing N N 224 PRO CB HB2 sing N N 225 PRO CB HB3 sing N N 226 PRO CG CD sing N N 227 PRO CG HG2 sing N N 228 PRO CG HG3 sing N N 229 PRO CD HD2 sing N N 230 PRO CD HD3 sing N N 231 PRO OXT HXT sing N N 232 SER N CA sing N N 233 SER N H sing N N 234 SER N H2 sing N N 235 SER CA C sing N N 236 SER CA CB sing N N 237 SER CA HA sing N N 238 SER C O doub N N 239 SER C OXT sing N N 240 SER CB OG sing N N 241 SER CB HB2 sing N N 242 SER CB HB3 sing N N 243 SER OG HG sing N N 244 SER OXT HXT sing N N 245 THR N CA sing N N 246 THR N H sing N N 247 THR N H2 sing N N 248 THR CA C sing N N 249 THR CA CB sing N N 250 THR CA HA sing N N 251 THR C O doub N N 252 THR C OXT sing N N 253 THR CB OG1 sing N N 254 THR CB CG2 sing N N 255 THR CB HB sing N N 256 THR OG1 HG1 sing N N 257 THR CG2 HG21 sing N N 258 THR CG2 HG22 sing N N 259 THR CG2 HG23 sing N N 260 THR OXT HXT sing N N 261 TYR N CA sing N N 262 TYR N H sing N N 263 TYR N H2 sing N N 264 TYR CA C sing N N 265 TYR CA CB sing N N 266 TYR CA HA sing N N 267 TYR C O doub N N 268 TYR C OXT sing N N 269 TYR CB CG sing N N 270 TYR CB HB2 sing N N 271 TYR CB HB3 sing N N 272 TYR CG CD1 doub Y N 273 TYR CG CD2 sing Y N 274 TYR CD1 CE1 sing Y N 275 TYR CD1 HD1 sing N N 276 TYR CD2 CE2 doub Y N 277 TYR CD2 HD2 sing N N 278 TYR CE1 CZ doub Y N 279 TYR CE1 HE1 sing N N 280 TYR CE2 CZ sing Y N 281 TYR CE2 HE2 sing N N 282 TYR CZ OH sing N N 283 TYR OH HH sing N N 284 TYR OXT HXT sing N N 285 VAL N CA sing N N 286 VAL N H sing N N 287 VAL N H2 sing N N 288 VAL CA C sing N N 289 VAL CA CB sing N N 290 VAL CA HA sing N N 291 VAL C O doub N N 292 VAL C OXT sing N N 293 VAL CB CG1 sing N N 294 VAL CB CG2 sing N N 295 VAL CB HB sing N N 296 VAL CG1 HG11 sing N N 297 VAL CG1 HG12 sing N N 298 VAL CG1 HG13 sing N N 299 VAL CG2 HG21 sing N N 300 VAL CG2 HG22 sing N N 301 VAL CG2 HG23 sing N N 302 VAL OXT HXT sing N N 303 # _pdbx_audit_support.funding_organization 'Japan Society for the Promotion of Science (JSPS)' _pdbx_audit_support.country Japan _pdbx_audit_support.grant_number 25K02233 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 'UNITY INOVA' ? Varian 600 ? 2 'AVANCE III HD' ? Bruker 600 ? 3 'AVANCE NEO' ? Bruker 800 ? # _atom_sites.entry_id 9XH1 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ #