data_9YAK # _entry.id 9YAK # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.415 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9YAK pdb_00009yak 10.2210/pdb9yak/pdb WWPDB D_1000299631 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-07-01 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9YAK _pdbx_database_status.recvd_initial_deposition_date 2025-09-16 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email natalia.jura@ucsf.edu _pdbx_contact_author.name_first Natalia _pdbx_contact_author.name_last Jura _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-5129-641X # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Liu, Y.' 1 ? 'Jura, N.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_id_ASTM PNASA6 _citation.journal_id_CSD 0040 _citation.journal_id_ISSN 1091-6490 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 123 _citation.language ? _citation.page_first e2526598123 _citation.page_last e2526598123 _citation.title 'Structural basis for pseudokinase-mediated regulation of GCN2 in the integrated stress response.' _citation.year 2026 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1073/pnas.2526598123 _citation.pdbx_database_id_PubMed 41615758 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Liu, Y.' 1 ? primary 'Misra, J.' 2 ? primary 'Bhowmik, D.R.' 3 ? primary ;O'Boyle, B. ; 4 0000-0002-5191-3577 primary 'Staschke, K.A.' 5 0000-0001-8722-9585 primary 'Kannan, N.' 6 0000-0002-2833-8375 primary 'Wek, R.C.' 7 0000-0002-2087-5504 primary 'Jura, N.' 8 0000-0001-5129-641X # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'eIF-2-alpha kinase GCN2' _entity.formula_weight 30991.562 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 2.7.11.1 _entity.pdbx_mutation ? _entity.pdbx_fragment 'pseudokinase domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Eukaryotic translation initiation factor 2-alpha kinase 4,GCN2-like protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GEILYFNMGSPDQLMVHKGKCIGSDEQLGKLVYNALETATGGFVLLYEWVLQWQKKMGPFLTSQEKEKIDKCKKQIQGTE TEFNSLVKLSHPNVVRYLAMNLKEQDDSIVVDILVEHISGVSLAAHLSHSGPIPVHQLRRYTAQLLSGLDYLHSNSVVHK VLSASNVLVDAEGTVKITDYSISKRLADICKEDVFEQTRVRFSDNALPYKTGKKGDVWRLGLLLLSLSQGQECGEYPVTI PSDLPADFQDFLKKCVCLDDKERWSPQQLLKHSFI ; _entity_poly.pdbx_seq_one_letter_code_can ;GEILYFNMGSPDQLMVHKGKCIGSDEQLGKLVYNALETATGGFVLLYEWVLQWQKKMGPFLTSQEKEKIDKCKKQIQGTE TEFNSLVKLSHPNVVRYLAMNLKEQDDSIVVDILVEHISGVSLAAHLSHSGPIPVHQLRRYTAQLLSGLDYLHSNSVVHK VLSASNVLVDAEGTVKITDYSISKRLADICKEDVFEQTRVRFSDNALPYKTGKKGDVWRLGLLLLSLSQGQECGEYPVTI PSDLPADFQDFLKKCVCLDDKERWSPQQLLKHSFI ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 GLU n 1 3 ILE n 1 4 LEU n 1 5 TYR n 1 6 PHE n 1 7 ASN n 1 8 MET n 1 9 GLY n 1 10 SER n 1 11 PRO n 1 12 ASP n 1 13 GLN n 1 14 LEU n 1 15 MET n 1 16 VAL n 1 17 HIS n 1 18 LYS n 1 19 GLY n 1 20 LYS n 1 21 CYS n 1 22 ILE n 1 23 GLY n 1 24 SER n 1 25 ASP n 1 26 GLU n 1 27 GLN n 1 28 LEU n 1 29 GLY n 1 30 LYS n 1 31 LEU n 1 32 VAL n 1 33 TYR n 1 34 ASN n 1 35 ALA n 1 36 LEU n 1 37 GLU n 1 38 THR n 1 39 ALA n 1 40 THR n 1 41 GLY n 1 42 GLY n 1 43 PHE n 1 44 VAL n 1 45 LEU n 1 46 LEU n 1 47 TYR n 1 48 GLU n 1 49 TRP n 1 50 VAL n 1 51 LEU n 1 52 GLN n 1 53 TRP n 1 54 GLN n 1 55 LYS n 1 56 LYS n 1 57 MET n 1 58 GLY n 1 59 PRO n 1 60 PHE n 1 61 LEU n 1 62 THR n 1 63 SER n 1 64 GLN n 1 65 GLU n 1 66 LYS n 1 67 GLU n 1 68 LYS n 1 69 ILE n 1 70 ASP n 1 71 LYS n 1 72 CYS n 1 73 LYS n 1 74 LYS n 1 75 GLN n 1 76 ILE n 1 77 GLN n 1 78 GLY n 1 79 THR n 1 80 GLU n 1 81 THR n 1 82 GLU n 1 83 PHE n 1 84 ASN n 1 85 SER n 1 86 LEU n 1 87 VAL n 1 88 LYS n 1 89 LEU n 1 90 SER n 1 91 HIS n 1 92 PRO n 1 93 ASN n 1 94 VAL n 1 95 VAL n 1 96 ARG n 1 97 TYR n 1 98 LEU n 1 99 ALA n 1 100 MET n 1 101 ASN n 1 102 LEU n 1 103 LYS n 1 104 GLU n 1 105 GLN n 1 106 ASP n 1 107 ASP n 1 108 SER n 1 109 ILE n 1 110 VAL n 1 111 VAL n 1 112 ASP n 1 113 ILE n 1 114 LEU n 1 115 VAL n 1 116 GLU n 1 117 HIS n 1 118 ILE n 1 119 SER n 1 120 GLY n 1 121 VAL n 1 122 SER n 1 123 LEU n 1 124 ALA n 1 125 ALA n 1 126 HIS n 1 127 LEU n 1 128 SER n 1 129 HIS n 1 130 SER n 1 131 GLY n 1 132 PRO n 1 133 ILE n 1 134 PRO n 1 135 VAL n 1 136 HIS n 1 137 GLN n 1 138 LEU n 1 139 ARG n 1 140 ARG n 1 141 TYR n 1 142 THR n 1 143 ALA n 1 144 GLN n 1 145 LEU n 1 146 LEU n 1 147 SER n 1 148 GLY n 1 149 LEU n 1 150 ASP n 1 151 TYR n 1 152 LEU n 1 153 HIS n 1 154 SER n 1 155 ASN n 1 156 SER n 1 157 VAL n 1 158 VAL n 1 159 HIS n 1 160 LYS n 1 161 VAL n 1 162 LEU n 1 163 SER n 1 164 ALA n 1 165 SER n 1 166 ASN n 1 167 VAL n 1 168 LEU n 1 169 VAL n 1 170 ASP n 1 171 ALA n 1 172 GLU n 1 173 GLY n 1 174 THR n 1 175 VAL n 1 176 LYS n 1 177 ILE n 1 178 THR n 1 179 ASP n 1 180 TYR n 1 181 SER n 1 182 ILE n 1 183 SER n 1 184 LYS n 1 185 ARG n 1 186 LEU n 1 187 ALA n 1 188 ASP n 1 189 ILE n 1 190 CYS n 1 191 LYS n 1 192 GLU n 1 193 ASP n 1 194 VAL n 1 195 PHE n 1 196 GLU n 1 197 GLN n 1 198 THR n 1 199 ARG n 1 200 VAL n 1 201 ARG n 1 202 PHE n 1 203 SER n 1 204 ASP n 1 205 ASN n 1 206 ALA n 1 207 LEU n 1 208 PRO n 1 209 TYR n 1 210 LYS n 1 211 THR n 1 212 GLY n 1 213 LYS n 1 214 LYS n 1 215 GLY n 1 216 ASP n 1 217 VAL n 1 218 TRP n 1 219 ARG n 1 220 LEU n 1 221 GLY n 1 222 LEU n 1 223 LEU n 1 224 LEU n 1 225 LEU n 1 226 SER n 1 227 LEU n 1 228 SER n 1 229 GLN n 1 230 GLY n 1 231 GLN n 1 232 GLU n 1 233 CYS n 1 234 GLY n 1 235 GLU n 1 236 TYR n 1 237 PRO n 1 238 VAL n 1 239 THR n 1 240 ILE n 1 241 PRO n 1 242 SER n 1 243 ASP n 1 244 LEU n 1 245 PRO n 1 246 ALA n 1 247 ASP n 1 248 PHE n 1 249 GLN n 1 250 ASP n 1 251 PHE n 1 252 LEU n 1 253 LYS n 1 254 LYS n 1 255 CYS n 1 256 VAL n 1 257 CYS n 1 258 LEU n 1 259 ASP n 1 260 ASP n 1 261 LYS n 1 262 GLU n 1 263 ARG n 1 264 TRP n 1 265 SER n 1 266 PRO n 1 267 GLN n 1 268 GLN n 1 269 LEU n 1 270 LEU n 1 271 LYS n 1 272 HIS n 1 273 SER n 1 274 PHE n 1 275 ILE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 275 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'EIF2AK4, GCN2, KIAA1338' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Spodoptera frugiperda' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 7108 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 265 ? ? ? A . n A 1 2 GLU 2 266 266 GLU GLU A . n A 1 3 ILE 3 267 267 ILE ILE A . n A 1 4 LEU 4 268 268 LEU LEU A . n A 1 5 TYR 5 269 269 TYR TYR A . n A 1 6 PHE 6 270 270 PHE PHE A . n A 1 7 ASN 7 271 271 ASN ASN A . n A 1 8 MET 8 272 272 MET MET A . n A 1 9 GLY 9 273 273 GLY GLY A . n A 1 10 SER 10 274 274 SER SER A . n A 1 11 PRO 11 275 275 PRO PRO A . n A 1 12 ASP 12 276 276 ASP ASP A . n A 1 13 GLN 13 277 277 GLN GLN A . n A 1 14 LEU 14 278 278 LEU LEU A . n A 1 15 MET 15 279 279 MET MET A . n A 1 16 VAL 16 280 280 VAL VAL A . n A 1 17 HIS 17 281 281 HIS HIS A . n A 1 18 LYS 18 282 282 LYS LYS A . n A 1 19 GLY 19 283 283 GLY GLY A . n A 1 20 LYS 20 284 284 LYS LYS A . n A 1 21 CYS 21 285 285 CYS CYS A . n A 1 22 ILE 22 286 286 ILE ILE A . n A 1 23 GLY 23 287 287 GLY GLY A . n A 1 24 SER 24 288 288 SER SER A . n A 1 25 ASP 25 289 289 ASP ASP A . n A 1 26 GLU 26 290 290 GLU GLU A . n A 1 27 GLN 27 291 291 GLN GLN A . n A 1 28 LEU 28 292 292 LEU LEU A . n A 1 29 GLY 29 293 293 GLY GLY A . n A 1 30 LYS 30 294 294 LYS LYS A . n A 1 31 LEU 31 295 295 LEU LEU A . n A 1 32 VAL 32 296 296 VAL VAL A . n A 1 33 TYR 33 297 297 TYR TYR A . n A 1 34 ASN 34 298 298 ASN ASN A . n A 1 35 ALA 35 299 299 ALA ALA A . n A 1 36 LEU 36 300 300 LEU LEU A . n A 1 37 GLU 37 301 301 GLU GLU A . n A 1 38 THR 38 302 302 THR THR A . n A 1 39 ALA 39 303 303 ALA ALA A . n A 1 40 THR 40 304 304 THR THR A . n A 1 41 GLY 41 305 305 GLY GLY A . n A 1 42 GLY 42 306 306 GLY GLY A . n A 1 43 PHE 43 307 307 PHE PHE A . n A 1 44 VAL 44 308 308 VAL VAL A . n A 1 45 LEU 45 309 309 LEU LEU A . n A 1 46 LEU 46 310 310 LEU LEU A . n A 1 47 TYR 47 311 311 TYR TYR A . n A 1 48 GLU 48 312 312 GLU GLU A . n A 1 49 TRP 49 313 313 TRP TRP A . n A 1 50 VAL 50 314 314 VAL VAL A . n A 1 51 LEU 51 315 315 LEU LEU A . n A 1 52 GLN 52 316 316 GLN GLN A . n A 1 53 TRP 53 317 317 TRP TRP A . n A 1 54 GLN 54 318 318 GLN GLN A . n A 1 55 LYS 55 319 319 LYS LYS A . n A 1 56 LYS 56 320 320 LYS LYS A . n A 1 57 MET 57 321 ? ? ? A . n A 1 58 GLY 58 322 ? ? ? A . n A 1 59 PRO 59 323 ? ? ? A . n A 1 60 PHE 60 324 ? ? ? A . n A 1 61 LEU 61 325 325 LEU LEU A . n A 1 62 THR 62 326 326 THR THR A . n A 1 63 SER 63 327 327 SER SER A . n A 1 64 GLN 64 328 328 GLN GLN A . n A 1 65 GLU 65 329 329 GLU GLU A . n A 1 66 LYS 66 330 330 LYS LYS A . n A 1 67 GLU 67 331 331 GLU GLU A . n A 1 68 LYS 68 332 332 LYS LYS A . n A 1 69 ILE 69 333 333 ILE ILE A . n A 1 70 ASP 70 334 334 ASP ASP A . n A 1 71 LYS 71 335 335 LYS LYS A . n A 1 72 CYS 72 336 336 CYS CYS A . n A 1 73 LYS 73 337 337 LYS LYS A . n A 1 74 LYS 74 338 338 LYS LYS A . n A 1 75 GLN 75 339 339 GLN GLN A . n A 1 76 ILE 76 340 340 ILE ILE A . n A 1 77 GLN 77 341 341 GLN GLN A . n A 1 78 GLY 78 342 342 GLY GLY A . n A 1 79 THR 79 343 343 THR THR A . n A 1 80 GLU 80 344 344 GLU GLU A . n A 1 81 THR 81 345 345 THR THR A . n A 1 82 GLU 82 346 346 GLU GLU A . n A 1 83 PHE 83 347 347 PHE PHE A . n A 1 84 ASN 84 348 348 ASN ASN A . n A 1 85 SER 85 349 349 SER SER A . n A 1 86 LEU 86 350 350 LEU LEU A . n A 1 87 VAL 87 351 351 VAL VAL A . n A 1 88 LYS 88 352 352 LYS LYS A . n A 1 89 LEU 89 353 353 LEU LEU A . n A 1 90 SER 90 354 354 SER SER A . n A 1 91 HIS 91 355 355 HIS HIS A . n A 1 92 PRO 92 356 356 PRO PRO A . n A 1 93 ASN 93 357 357 ASN ASN A . n A 1 94 VAL 94 358 358 VAL VAL A . n A 1 95 VAL 95 359 359 VAL VAL A . n A 1 96 ARG 96 360 360 ARG ARG A . n A 1 97 TYR 97 361 361 TYR TYR A . n A 1 98 LEU 98 362 362 LEU LEU A . n A 1 99 ALA 99 363 363 ALA ALA A . n A 1 100 MET 100 364 364 MET MET A . n A 1 101 ASN 101 365 365 ASN ASN A . n A 1 102 LEU 102 366 366 LEU LEU A . n A 1 103 LYS 103 367 367 LYS LYS A . n A 1 104 GLU 104 368 368 GLU GLU A . n A 1 105 GLN 105 369 369 GLN GLN A . n A 1 106 ASP 106 370 370 ASP ASP A . n A 1 107 ASP 107 371 371 ASP ASP A . n A 1 108 SER 108 372 372 SER SER A . n A 1 109 ILE 109 373 373 ILE ILE A . n A 1 110 VAL 110 374 374 VAL VAL A . n A 1 111 VAL 111 375 375 VAL VAL A . n A 1 112 ASP 112 376 376 ASP ASP A . n A 1 113 ILE 113 377 377 ILE ILE A . n A 1 114 LEU 114 378 378 LEU LEU A . n A 1 115 VAL 115 379 379 VAL VAL A . n A 1 116 GLU 116 380 380 GLU GLU A . n A 1 117 HIS 117 381 381 HIS HIS A . n A 1 118 ILE 118 382 382 ILE ILE A . n A 1 119 SER 119 383 383 SER SER A . n A 1 120 GLY 120 384 384 GLY GLY A . n A 1 121 VAL 121 385 385 VAL VAL A . n A 1 122 SER 122 386 386 SER SER A . n A 1 123 LEU 123 387 387 LEU LEU A . n A 1 124 ALA 124 388 388 ALA ALA A . n A 1 125 ALA 125 389 389 ALA ALA A . n A 1 126 HIS 126 390 390 HIS HIS A . n A 1 127 LEU 127 391 391 LEU LEU A . n A 1 128 SER 128 392 392 SER SER A . n A 1 129 HIS 129 393 393 HIS HIS A . n A 1 130 SER 130 394 394 SER SER A . n A 1 131 GLY 131 395 395 GLY GLY A . n A 1 132 PRO 132 396 396 PRO PRO A . n A 1 133 ILE 133 397 397 ILE ILE A . n A 1 134 PRO 134 398 398 PRO PRO A . n A 1 135 VAL 135 399 399 VAL VAL A . n A 1 136 HIS 136 400 400 HIS HIS A . n A 1 137 GLN 137 401 401 GLN GLN A . n A 1 138 LEU 138 402 402 LEU LEU A . n A 1 139 ARG 139 403 403 ARG ARG A . n A 1 140 ARG 140 404 404 ARG ARG A . n A 1 141 TYR 141 405 405 TYR TYR A . n A 1 142 THR 142 406 406 THR THR A . n A 1 143 ALA 143 407 407 ALA ALA A . n A 1 144 GLN 144 408 408 GLN GLN A . n A 1 145 LEU 145 409 409 LEU LEU A . n A 1 146 LEU 146 410 410 LEU LEU A . n A 1 147 SER 147 411 411 SER SER A . n A 1 148 GLY 148 412 412 GLY GLY A . n A 1 149 LEU 149 413 413 LEU LEU A . n A 1 150 ASP 150 414 414 ASP ASP A . n A 1 151 TYR 151 415 415 TYR TYR A . n A 1 152 LEU 152 416 416 LEU LEU A . n A 1 153 HIS 153 417 417 HIS HIS A . n A 1 154 SER 154 418 418 SER SER A . n A 1 155 ASN 155 419 419 ASN ASN A . n A 1 156 SER 156 420 420 SER SER A . n A 1 157 VAL 157 421 421 VAL VAL A . n A 1 158 VAL 158 422 422 VAL VAL A . n A 1 159 HIS 159 423 423 HIS HIS A . n A 1 160 LYS 160 424 424 LYS LYS A . n A 1 161 VAL 161 425 425 VAL VAL A . n A 1 162 LEU 162 426 426 LEU LEU A . n A 1 163 SER 163 427 427 SER SER A . n A 1 164 ALA 164 428 428 ALA ALA A . n A 1 165 SER 165 429 429 SER SER A . n A 1 166 ASN 166 430 430 ASN ASN A . n A 1 167 VAL 167 431 431 VAL VAL A . n A 1 168 LEU 168 432 432 LEU LEU A . n A 1 169 VAL 169 433 433 VAL VAL A . n A 1 170 ASP 170 434 434 ASP ASP A . n A 1 171 ALA 171 435 435 ALA ALA A . n A 1 172 GLU 172 436 436 GLU GLU A . n A 1 173 GLY 173 437 437 GLY GLY A . n A 1 174 THR 174 438 438 THR THR A . n A 1 175 VAL 175 439 439 VAL VAL A . n A 1 176 LYS 176 440 440 LYS LYS A . n A 1 177 ILE 177 441 441 ILE ILE A . n A 1 178 THR 178 442 442 THR THR A . n A 1 179 ASP 179 443 443 ASP ASP A . n A 1 180 TYR 180 444 444 TYR TYR A . n A 1 181 SER 181 445 445 SER SER A . n A 1 182 ILE 182 446 446 ILE ILE A . n A 1 183 SER 183 447 447 SER SER A . n A 1 184 LYS 184 448 448 LYS LYS A . n A 1 185 ARG 185 449 449 ARG ARG A . n A 1 186 LEU 186 450 450 LEU LEU A . n A 1 187 ALA 187 451 451 ALA ALA A . n A 1 188 ASP 188 452 452 ASP ASP A . n A 1 189 ILE 189 453 453 ILE ILE A . n A 1 190 CYS 190 454 454 CYS CYS A . n A 1 191 LYS 191 455 455 LYS LYS A . n A 1 192 GLU 192 456 456 GLU GLU A . n A 1 193 ASP 193 457 457 ASP ASP A . n A 1 194 VAL 194 458 458 VAL VAL A . n A 1 195 PHE 195 459 459 PHE PHE A . n A 1 196 GLU 196 460 460 GLU GLU A . n A 1 197 GLN 197 461 461 GLN GLN A . n A 1 198 THR 198 462 462 THR THR A . n A 1 199 ARG 199 463 ? ? ? A . n A 1 200 VAL 200 464 ? ? ? A . n A 1 201 ARG 201 465 ? ? ? A . n A 1 202 PHE 202 466 ? ? ? A . n A 1 203 SER 203 467 ? ? ? A . n A 1 204 ASP 204 468 ? ? ? A . n A 1 205 ASN 205 469 ? ? ? A . n A 1 206 ALA 206 470 ? ? ? A . n A 1 207 LEU 207 471 ? ? ? A . n A 1 208 PRO 208 472 472 PRO PRO A . n A 1 209 TYR 209 473 473 TYR TYR A . n A 1 210 LYS 210 474 474 LYS LYS A . n A 1 211 THR 211 475 475 THR THR A . n A 1 212 GLY 212 476 476 GLY GLY A . n A 1 213 LYS 213 477 477 LYS LYS A . n A 1 214 LYS 214 478 478 LYS LYS A . n A 1 215 GLY 215 479 479 GLY GLY A . n A 1 216 ASP 216 480 480 ASP ASP A . n A 1 217 VAL 217 481 481 VAL VAL A . n A 1 218 TRP 218 482 482 TRP TRP A . n A 1 219 ARG 219 483 483 ARG ARG A . n A 1 220 LEU 220 484 484 LEU LEU A . n A 1 221 GLY 221 485 485 GLY GLY A . n A 1 222 LEU 222 486 486 LEU LEU A . n A 1 223 LEU 223 487 487 LEU LEU A . n A 1 224 LEU 224 488 488 LEU LEU A . n A 1 225 LEU 225 489 489 LEU LEU A . n A 1 226 SER 226 490 490 SER SER A . n A 1 227 LEU 227 491 491 LEU LEU A . n A 1 228 SER 228 492 492 SER SER A . n A 1 229 GLN 229 493 493 GLN GLN A . n A 1 230 GLY 230 494 494 GLY GLY A . n A 1 231 GLN 231 495 495 GLN GLN A . n A 1 232 GLU 232 496 496 GLU GLU A . n A 1 233 CYS 233 497 497 CYS CYS A . n A 1 234 GLY 234 498 498 GLY GLY A . n A 1 235 GLU 235 499 499 GLU GLU A . n A 1 236 TYR 236 500 500 TYR TYR A . n A 1 237 PRO 237 501 501 PRO PRO A . n A 1 238 VAL 238 502 502 VAL VAL A . n A 1 239 THR 239 503 503 THR THR A . n A 1 240 ILE 240 504 504 ILE ILE A . n A 1 241 PRO 241 505 505 PRO PRO A . n A 1 242 SER 242 506 506 SER SER A . n A 1 243 ASP 243 507 507 ASP ASP A . n A 1 244 LEU 244 508 508 LEU LEU A . n A 1 245 PRO 245 509 509 PRO PRO A . n A 1 246 ALA 246 510 510 ALA ALA A . n A 1 247 ASP 247 511 511 ASP ASP A . n A 1 248 PHE 248 512 512 PHE PHE A . n A 1 249 GLN 249 513 513 GLN GLN A . n A 1 250 ASP 250 514 514 ASP ASP A . n A 1 251 PHE 251 515 515 PHE PHE A . n A 1 252 LEU 252 516 516 LEU LEU A . n A 1 253 LYS 253 517 517 LYS LYS A . n A 1 254 LYS 254 518 518 LYS LYS A . n A 1 255 CYS 255 519 519 CYS CYS A . n A 1 256 VAL 256 520 520 VAL VAL A . n A 1 257 CYS 257 521 521 CYS CYS A . n A 1 258 LEU 258 522 522 LEU LEU A . n A 1 259 ASP 259 523 523 ASP ASP A . n A 1 260 ASP 260 524 524 ASP ASP A . n A 1 261 LYS 261 525 525 LYS LYS A . n A 1 262 GLU 262 526 526 GLU GLU A . n A 1 263 ARG 263 527 527 ARG ARG A . n A 1 264 TRP 264 528 528 TRP TRP A . n A 1 265 SER 265 529 529 SER SER A . n A 1 266 PRO 266 530 530 PRO PRO A . n A 1 267 GLN 267 531 531 GLN GLN A . n A 1 268 GLN 268 532 532 GLN GLN A . n A 1 269 LEU 269 533 533 LEU LEU A . n A 1 270 LEU 270 534 534 LEU LEU A . n A 1 271 LYS 271 535 535 LYS LYS A . n A 1 272 HIS 272 536 536 HIS HIS A . n A 1 273 SER 273 537 537 SER SER A . n A 1 274 PHE 274 538 538 PHE PHE A . n A 1 275 ILE 275 539 539 ILE ILE A . n # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A HIS 400 ? CG ? A HIS 136 CG 2 1 Y 1 A HIS 400 ? ND1 ? A HIS 136 ND1 3 1 Y 1 A HIS 400 ? CD2 ? A HIS 136 CD2 4 1 Y 1 A HIS 400 ? CE1 ? A HIS 136 CE1 5 1 Y 1 A HIS 400 ? NE2 ? A HIS 136 NE2 6 1 Y 1 A ARG 403 ? CG ? A ARG 139 CG 7 1 Y 1 A ARG 403 ? CD ? A ARG 139 CD 8 1 Y 1 A ARG 403 ? NE ? A ARG 139 NE 9 1 Y 1 A ARG 403 ? CZ ? A ARG 139 CZ 10 1 Y 1 A ARG 403 ? NH1 ? A ARG 139 NH1 11 1 Y 1 A ARG 403 ? NH2 ? A ARG 139 NH2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.20.1_4487 ? 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . ? 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . ? 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . ? 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 9YAK _cell.details ? _cell.formula_units_Z ? _cell.length_a 118.975 _cell.length_a_esd ? _cell.length_b 118.975 _cell.length_b_esd ? _cell.length_c 62.673 _cell.length_c_esd ? _cell.volume 887139.488 _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9YAK _symmetry.cell_setting ? _symmetry.Int_Tables_number 89 _symmetry.space_group_name_Hall 'P 4 2' _symmetry.space_group_name_H-M 'P 4 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9YAK _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.58 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 65.62 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '100 mM MES pH 6.5 and 1.6 M magnesium sulfate' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 298 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2022-09-29 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0387 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ALS BEAMLINE 2.0.1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0387 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 2.0.1 _diffrn_source.pdbx_synchrotron_site ALS # _reflns.B_iso_Wilson_estimate 121.37 _reflns.entry_id 9YAK _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.98 _reflns.d_resolution_low 42.06 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 9609 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.22 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 12.8 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 15 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.98 _reflns_shell.d_res_low 3.086 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 922 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.283 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 152.02 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9YAK _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.98 _refine.ls_d_res_low 42.06 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 9596 _refine.ls_number_reflns_R_free 960 _refine.ls_number_reflns_R_work 8636 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.32 _refine.ls_percent_reflns_R_free 10.00 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2692 _refine.ls_R_factor_R_free 0.3040 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2652 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 39.0756 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.6267 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.98 _refine_hist.d_res_low 42.06 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 2057 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2057 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0055 ? 2095 ? f_bond_d ? ? ? 'X-RAY DIFFRACTION' ? 1.1352 ? 2831 ? f_angle_d ? ? ? 'X-RAY DIFFRACTION' ? 0.0581 ? 326 ? f_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.0080 ? 355 ? f_plane_restr ? ? ? 'X-RAY DIFFRACTION' ? 11.6946 ? 777 ? f_dihedral_angle_d ? ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.98 3.14 . . 133 1187 98.43 . . . . 0.4608 . . . . . . . . . . . . . . . 0.5373 'X-RAY DIFFRACTION' 3.14 3.33 . . 132 1200 99.48 . . . . 0.3581 . . . . . . . . . . . . . . . 0.3597 'X-RAY DIFFRACTION' 3.33 3.59 . . 135 1210 99.63 . . . . 0.3484 . . . . . . . . . . . . . . . 0.3997 'X-RAY DIFFRACTION' 3.59 3.95 . . 136 1216 99.34 . . . . 0.2861 . . . . . . . . . . . . . . . 0.3000 'X-RAY DIFFRACTION' 3.95 4.52 . . 136 1231 99.49 . . . . 0.2491 . . . . . . . . . . . . . . . 0.2660 'X-RAY DIFFRACTION' 4.52 5.70 . . 140 1257 99.86 . . . . 0.2385 . . . . . . . . . . . . . . . 0.2710 'X-RAY DIFFRACTION' 5.70 42.06 . . 148 1335 99.00 . . . . 0.2456 . . . . . . . . . . . . . . . 0.3007 # _struct.entry_id 9YAK _struct.title 'Structure of the GCN2 pseudokinase domain' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9YAK _struct_keywords.text 'Pseudokinase, complex, homeostasis, CYTOSOLIC PROTEIN' _struct_keywords.pdbx_keywords 'CYTOSOLIC PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code E2AK4_HUMAN _struct_ref.pdbx_db_accession Q9P2K8 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;EILYFNMGSPDQLMVHKGKCIGSDEQLGKLVYNALETATGGFVLLYEWVLQWQKKMGPFLTSQEKEKIDKCKKQIQGTET EFNSLVKLSHPNVVRYLAMNLKEQDDSIVVDILVEHISGVSLAAHLSHSGPIPVHQLRRYTAQLLSGLDYLHSNSVVHKV LSASNVLVDAEGTVKITDYSISKRLADICKEDVFEQTRVRFSDNALPYKTGKKGDVWRLGLLLLSLSQGQECGEYPVTIP SDLPADFQDFLKKCVCLDDKERWSPQQLLKHSFI ; _struct_ref.pdbx_align_begin 266 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9YAK _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 275 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9P2K8 _struct_ref_seq.db_align_beg 266 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 539 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 266 _struct_ref_seq.pdbx_auth_seq_align_end 539 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 9YAK _struct_ref_seq_dif.mon_id GLY _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q9P2K8 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'expression tag' _struct_ref_seq_dif.pdbx_auth_seq_num 265 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 62 ? VAL A 87 ? THR A 326 VAL A 351 1 ? 26 HELX_P HELX_P2 AA2 LEU A 123 ? SER A 130 ? LEU A 387 SER A 394 1 ? 8 HELX_P HELX_P3 AA3 PRO A 134 ? ASN A 155 ? PRO A 398 ASN A 419 1 ? 22 HELX_P HELX_P4 AA4 SER A 181 ? GLU A 192 ? SER A 445 GLU A 456 1 ? 12 HELX_P HELX_P5 AA5 LYS A 213 ? GLY A 230 ? LYS A 477 GLY A 494 1 ? 18 HELX_P HELX_P6 AA6 PRO A 245 ? VAL A 256 ? PRO A 509 VAL A 520 1 ? 12 HELX_P HELX_P7 AA7 SER A 265 ? LEU A 270 ? SER A 529 LEU A 534 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id TYR _struct_mon_prot_cis.label_seq_id 236 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id TYR _struct_mon_prot_cis.auth_seq_id 500 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 237 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 501 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -24.76 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 6 ? AA2 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 3 ? PHE A 6 ? ILE A 267 PHE A 270 AA1 2 LEU A 14 ? SER A 24 ? LEU A 278 SER A 288 AA1 3 LYS A 30 ? GLU A 37 ? LYS A 294 GLU A 301 AA1 4 PHE A 43 ? GLN A 52 ? PHE A 307 GLN A 316 AA1 5 SER A 108 ? GLU A 116 ? SER A 372 GLU A 380 AA1 6 TYR A 97 ? GLU A 104 ? TYR A 361 GLU A 368 AA2 1 GLY A 120 ? SER A 122 ? GLY A 384 SER A 386 AA2 2 VAL A 167 ? ASP A 170 ? VAL A 431 ASP A 434 AA2 3 VAL A 175 ? ILE A 177 ? VAL A 439 ILE A 441 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 4 ? N LEU A 268 O VAL A 16 ? O VAL A 280 AA1 2 3 N HIS A 17 ? N HIS A 281 O LEU A 36 ? O LEU A 300 AA1 3 4 N ALA A 35 ? N ALA A 299 O VAL A 44 ? O VAL A 308 AA1 4 5 N LEU A 45 ? N LEU A 309 O VAL A 115 ? O VAL A 379 AA1 5 6 O LEU A 114 ? O LEU A 378 N ALA A 99 ? N ALA A 363 AA2 1 2 N VAL A 121 ? N VAL A 385 O VAL A 169 ? O VAL A 433 AA2 2 3 N LEU A 168 ? N LEU A 432 O LYS A 176 ? O LYS A 440 # _pdbx_entry_details.entry_id 9YAK _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 274 ? ? 75.09 174.94 2 1 LYS A 424 ? ? 74.46 -47.48 3 1 VAL A 425 ? ? -117.94 74.89 4 1 SER A 445 ? ? 58.86 -44.31 5 1 LYS A 477 ? ? 44.56 -64.54 6 1 GLU A 499 ? ? 52.06 -119.18 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y,x,z 3 y,-x,z 4 x,-y,-z 5 -x,y,-z 6 -x,-y,z 7 y,x,-z 8 -y,-x,-z # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 25.7400181247 _pdbx_refine_tls.origin_y 46.9209094974 _pdbx_refine_tls.origin_z 16.8086452455 _pdbx_refine_tls.T[1][1] 0.746683071065 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] -0.087089288996 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] -0.0486324309001 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 1.09021701628 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] 0.156454165772 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.922987516449 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 1.37721329988 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] 0.244193999704 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] 0.120401984236 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 0.71095145195 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] 0.998470772332 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 2.38186918722 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] 0.127913042809 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] 0.117681387567 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] 0.370317066093 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] -0.0817486880271 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] -0.0748897269299 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] 0.0532074332768 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] -0.106747274397 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] -0.611246077525 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] -5.43946721988e-06 _pdbx_refine_tls.S[3][3]_esd ? # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_label_asym_id A _pdbx_refine_tls_group.beg_label_seq_id 1 _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 266 _pdbx_refine_tls_group.beg_PDB_ins_code ? _pdbx_refine_tls_group.end_label_asym_id A _pdbx_refine_tls_group.end_label_seq_id 261 _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 539 _pdbx_refine_tls_group.end_PDB_ins_code ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details all # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 265 ? A GLY 1 2 1 Y 1 A MET 321 ? A MET 57 3 1 Y 1 A GLY 322 ? A GLY 58 4 1 Y 1 A PRO 323 ? A PRO 59 5 1 Y 1 A PHE 324 ? A PHE 60 6 1 Y 1 A ARG 463 ? A ARG 199 7 1 Y 1 A VAL 464 ? A VAL 200 8 1 Y 1 A ARG 465 ? A ARG 201 9 1 Y 1 A PHE 466 ? A PHE 202 10 1 Y 1 A SER 467 ? A SER 203 11 1 Y 1 A ASP 468 ? A ASP 204 12 1 Y 1 A ASN 469 ? A ASN 205 13 1 Y 1 A ALA 470 ? A ALA 206 14 1 Y 1 A LEU 471 ? A LEU 207 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'in silico model' _pdbx_initial_refinement_model.source_name AlphaFold _pdbx_initial_refinement_model.accession_code AF-Q9P2K8-F1 _pdbx_initial_refinement_model.details 'The pseudokinase domain model is isolated from the full-length AlphaFold model' # _space_group.name_H-M_alt 'P 4 2 2' _space_group.name_Hall 'P 4 2' _space_group.IT_number 89 _space_group.crystal_system tetragonal _space_group.id 1 # _atom_sites.entry_id 9YAK _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.008405 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008405 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.015956 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? 0.99627 ? ? ? 14.84254 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 6.96715 ? ? ? 11.43723 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 7.96527 ? ? ? 9.05267 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ # loop_ #