data_9YT1 # _entry.id 9YT1 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.417 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9YT1 pdb_00009yt1 10.2210/pdb9yt1/pdb WWPDB D_1000297636 ? ? BMRB 31279 ? 10.13018/BMR31279 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-11-04 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr . _pdbx_database_status.entry_id 9YT1 _pdbx_database_status.recvd_initial_deposition_date 2025-10-20 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs . _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Model Structure of Liraglutide Monomer in Buffer' _pdbx_database_related.db_id 31279 _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 3 _pdbx_contact_author.email gliu@nexomics.com _pdbx_contact_author.name_first Gaohua _pdbx_contact_author.name_last Liu _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-4343-0356 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Nepomuceno, P.A.' 1 0000-0002-1499-6545 'Aramini, J.M.' 2 0000-0001-8926-4210 'Su, Y.' 3 0000-0001-5063-3218 'Liu, G.' 4 0000-0002-4343-0356 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Investigating the Molecular Mechanism of Liraglutide Oligomerization' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Schroder, R.' 1 ? primary 'Hamada, N.' 2 ? primary 'Nepomuceno, P.A.' 3 0000-0002-1499-6545 primary 'Li, M.' 4 ? primary 'Tucker, T.J.' 5 0000-0001-5616-0802 primary 'Templeton, A.C.' 6 ? primary 'Wuelfing, W.P.' 7 ? primary 'Liu, G.' 8 0000-0002-4343-0356 primary 'Su, Y.' 9 0000-0001-5063-3218 primary 'Ling, J.' 10 0000-0003-1749-3414 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer syn 'Glucagon-like peptide 1(7-37)' 3387.713 1 ? ? ? ? 2 non-polymer syn 'PALMITIC ACID' 256.424 1 ? ? ? ? 3 non-polymer syn 'GAMMA-L-GLUTAMIC ACID' 147.129 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'GLP-1(7-37)' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG _entity_poly.pdbx_seq_one_letter_code_can HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'PALMITIC ACID' PLM 3 'GAMMA-L-GLUTAMIC ACID' GGL # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 HIS n 1 2 ALA n 1 3 GLU n 1 4 GLY n 1 5 THR n 1 6 PHE n 1 7 THR n 1 8 SER n 1 9 ASP n 1 10 VAL n 1 11 SER n 1 12 SER n 1 13 TYR n 1 14 LEU n 1 15 GLU n 1 16 GLY n 1 17 GLN n 1 18 ALA n 1 19 ALA n 1 20 LYS n 1 21 GLU n 1 22 PHE n 1 23 ILE n 1 24 ALA n 1 25 TRP n 1 26 LEU n 1 27 VAL n 1 28 ARG n 1 29 GLY n 1 30 ARG n 1 31 GLY n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 31 _pdbx_entity_src_syn.organism_scientific 'Homo sapiens' _pdbx_entity_src_syn.organism_common_name human _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GGL 'L-gamma-peptide, C-delta linking' . 'GAMMA-L-GLUTAMIC ACID' 'L-GLUTAMIC ACID' 'C5 H9 N O4' 147.129 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PLM non-polymer . 'PALMITIC ACID' ? 'C16 H32 O2' 256.424 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 HIS 1 1 1 HIS HIS A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 PHE 6 6 6 PHE PHE A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 SER 11 11 11 SER SER A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 TYR 13 13 13 TYR TYR A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 TRP 25 25 25 TRP TRP A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 ARG 30 30 30 ARG ARG A . n A 1 31 GLY 31 31 31 GLY GLY A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 PLM 1 101 101 PLM PLM A . C 3 GGL 1 102 102 GGL GGL A . # _cell.entry_id 9YT1 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 9YT1 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9YT1 _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _database_PDB_matrix.entry_id 9YT1 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 9YT1 _struct.title 'Model Structure of Liraglutide Monomer in Buffer' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9YT1 _struct_keywords.text 'GLP-1 agonist, HORMONE' _struct_keywords.pdbx_keywords HORMONE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code GLUC_HUMAN _struct_ref.pdbx_db_accession P01275 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG _struct_ref.pdbx_align_begin 98 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9YT1 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 31 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P01275 _struct_ref_seq.db_align_beg 98 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 128 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 31 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 9YT1 _struct_ref_seq_dif.mon_id ARG _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 28 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P01275 _struct_ref_seq_dif.db_mon_id LYS _struct_ref_seq_dif.pdbx_seq_db_seq_num 125 _struct_ref_seq_dif.details conflict _struct_ref_seq_dif.pdbx_auth_seq_num 28 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details 'not applicable' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0 _pdbx_struct_oper_list.matrix[1][2] 0.0 _pdbx_struct_oper_list.matrix[1][3] 0.0 _pdbx_struct_oper_list.vector[1] 0.0 _pdbx_struct_oper_list.matrix[2][1] 0.0 _pdbx_struct_oper_list.matrix[2][2] 1.0 _pdbx_struct_oper_list.matrix[2][3] 0.0 _pdbx_struct_oper_list.vector[2] 0.0 _pdbx_struct_oper_list.matrix[3][1] 0.0 _pdbx_struct_oper_list.matrix[3][2] 0.0 _pdbx_struct_oper_list.matrix[3][3] 1.0 _pdbx_struct_oper_list.vector[3] 0.0 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 8 ? GLU A 15 ? SER A 8 GLU A 15 1 ? 8 HELX_P HELX_P2 AA2 ALA A 18 ? GLY A 29 ? ALA A 18 GLY A 29 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale one ? A LYS 20 NZ ? ? ? 1_555 C GGL . CD ? ? A LYS 20 A GGL 102 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale2 covale both ? B PLM . C1 ? ? ? 1_555 C GGL . N ? ? A PLM 101 A GGL 102 1_555 ? ? ? ? ? ? ? 1.333 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id GGL _pdbx_modification_feature.label_asym_id C _pdbx_modification_feature.label_seq_id . _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id LYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 20 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id GGL _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 102 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id LYS _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 20 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom CD _pdbx_modification_feature.modified_residue_id_linking_atom NZ _pdbx_modification_feature.modified_residue_id LYS _pdbx_modification_feature.ref_pcm_id 2 _pdbx_modification_feature.ref_comp_id GGL _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Covalent chemical modification' # _pdbx_entry_details.entry_id 9YT1 _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 2 ? ? -121.37 -75.51 2 1 GLU A 3 ? ? -143.90 -42.66 3 1 THR A 5 ? ? -144.13 42.54 4 1 PHE A 6 ? ? -119.39 -169.71 5 1 SER A 8 ? ? 67.79 -166.50 6 2 ALA A 2 ? ? 60.68 99.63 7 2 THR A 7 ? ? -98.49 45.56 8 2 SER A 8 ? ? -121.95 -169.81 9 3 GLU A 3 ? ? -90.86 -70.88 10 3 SER A 8 ? ? -118.64 -169.40 11 4 THR A 7 ? ? -98.90 45.66 12 4 SER A 8 ? ? -122.62 -169.79 13 5 ALA A 2 ? ? -154.00 59.55 14 5 GLU A 3 ? ? 55.97 70.17 15 5 THR A 7 ? ? -179.45 67.87 16 5 SER A 8 ? ? -169.19 -78.84 17 5 GLU A 15 ? ? -67.47 -71.42 18 6 GLU A 3 ? ? -135.95 -47.14 19 6 THR A 7 ? ? -176.87 67.76 20 6 SER A 8 ? ? -169.14 -78.86 21 7 THR A 7 ? ? -93.84 46.56 22 7 SER A 8 ? ? -123.53 -169.48 23 8 THR A 5 ? ? -143.73 40.85 24 8 THR A 7 ? ? -94.23 38.98 25 8 SER A 8 ? ? -110.61 -169.78 26 9 GLU A 3 ? ? -170.41 88.73 27 9 THR A 5 ? ? -143.35 39.09 28 9 THR A 7 ? ? -56.71 99.02 29 9 SER A 8 ? ? 179.87 -169.28 30 10 THR A 5 ? ? -143.43 39.88 31 10 THR A 7 ? ? -170.13 70.45 32 10 SER A 8 ? ? -158.67 -78.75 33 11 ALA A 2 ? ? 61.37 -178.29 34 11 THR A 5 ? ? -110.31 70.91 35 11 THR A 7 ? ? -168.70 71.54 36 11 SER A 8 ? ? -162.06 -78.79 37 12 ALA A 2 ? ? -175.20 141.84 38 12 THR A 5 ? ? -146.59 -76.02 39 12 PHE A 6 ? ? 54.91 -175.81 40 12 THR A 7 ? ? -145.36 35.68 41 12 SER A 8 ? ? -129.73 -165.68 42 13 ALA A 2 ? ? -151.88 -75.06 43 13 GLU A 3 ? ? 62.36 -169.50 44 13 THR A 5 ? ? -93.36 41.53 45 13 THR A 7 ? ? -176.68 42.37 46 13 SER A 8 ? ? -139.02 -78.22 47 14 GLU A 3 ? ? -176.86 -35.95 48 15 ALA A 2 ? ? -59.25 170.80 49 15 THR A 5 ? ? -144.49 43.24 50 15 SER A 8 ? ? 68.09 -165.40 51 16 ALA A 2 ? ? 59.21 84.11 52 16 GLU A 3 ? ? -125.98 -67.22 53 16 THR A 7 ? ? 37.48 43.36 54 17 ALA A 2 ? ? -55.45 176.23 55 17 THR A 7 ? ? 37.48 43.35 56 17 GLU A 15 ? ? -67.64 -70.59 57 18 ALA A 2 ? ? -107.00 -63.49 58 18 GLU A 3 ? ? -132.51 -53.25 59 18 THR A 5 ? ? -143.01 -79.45 60 18 PHE A 6 ? ? 50.73 -169.17 61 18 THR A 7 ? ? 179.02 74.59 62 18 SER A 8 ? ? -158.85 -79.12 63 19 ALA A 2 ? ? 56.42 79.85 64 19 GLU A 3 ? ? 56.41 -174.77 65 19 THR A 7 ? ? -175.69 -166.93 66 19 SER A 8 ? ? 68.51 -80.82 67 20 GLU A 3 ? ? 59.30 80.53 68 20 THR A 5 ? ? -143.32 -78.88 69 20 PHE A 6 ? ? 51.36 -170.40 70 20 THR A 7 ? ? 178.23 88.61 71 20 SER A 8 ? ? -179.48 -80.19 # _pdbx_nmr_ensemble.entry_id 9YT1 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 9YT1 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'target function' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '10 mM sodium phosphate, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label lira_buffer _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # _pdbx_nmr_exptl_sample.solution_id 1 _pdbx_nmr_exptl_sample.component 'sodium phosphate' _pdbx_nmr_exptl_sample.concentration 10 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 308 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.4 _pdbx_nmr_exptl_sample_conditions.ionic_strength 25 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label lira_buffer _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-1H TOCSY' 1 isotropic 2 1 1 '2D 1H-1H NOESY' 1 isotropic 3 1 1 '2D 1H-13C HSQC' 1 isotropic # _pdbx_nmr_refine.entry_id 9YT1 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 2 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 1 'structure calculation' CYANA 3.98 'GUNTERT, MUMENTHALER AND WUTHRICH' 3 'chemical shift assignment' NMRFAM-SPARKY ? 'Lee W., Tonelli M., Markley J.L.' 4 'geometry optimization' TALOS-N ? 'Shen, Y., Bax, A.' 6 'peak picking' NMRFAM-SPARKY ? 'Lee W., Tonelli M., Markley J.L.' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASP N N N N 41 ASP CA C N S 42 ASP C C N N 43 ASP O O N N 44 ASP CB C N N 45 ASP CG C N N 46 ASP OD1 O N N 47 ASP OD2 O N N 48 ASP OXT O N N 49 ASP H H N N 50 ASP H2 H N N 51 ASP HA H N N 52 ASP HB2 H N N 53 ASP HB3 H N N 54 ASP HD2 H N N 55 ASP HXT H N N 56 GGL N N N N 57 GGL CA C N S 58 GGL C C N N 59 GGL O O N N 60 GGL CB C N N 61 GGL CG C N N 62 GGL CD C N N 63 GGL OE1 O N N 64 GGL OE2 O N N 65 GGL OXT O N N 66 GGL H H N N 67 GGL H2 H N N 68 GGL HA H N N 69 GGL HB2 H N N 70 GGL HB3 H N N 71 GGL HG2 H N N 72 GGL HG3 H N N 73 GGL HE2 H N N 74 GGL HXT H N N 75 GLN N N N N 76 GLN CA C N S 77 GLN C C N N 78 GLN O O N N 79 GLN CB C N N 80 GLN CG C N N 81 GLN CD C N N 82 GLN OE1 O N N 83 GLN NE2 N N N 84 GLN OXT O N N 85 GLN H H N N 86 GLN H2 H N N 87 GLN HA H N N 88 GLN HB2 H N N 89 GLN HB3 H N N 90 GLN HG2 H N N 91 GLN HG3 H N N 92 GLN HE21 H N N 93 GLN HE22 H N N 94 GLN HXT H N N 95 GLU N N N N 96 GLU CA C N S 97 GLU C C N N 98 GLU O O N N 99 GLU CB C N N 100 GLU CG C N N 101 GLU CD C N N 102 GLU OE1 O N N 103 GLU OE2 O N N 104 GLU OXT O N N 105 GLU H H N N 106 GLU H2 H N N 107 GLU HA H N N 108 GLU HB2 H N N 109 GLU HB3 H N N 110 GLU HG2 H N N 111 GLU HG3 H N N 112 GLU HE2 H N N 113 GLU HXT H N N 114 GLY N N N N 115 GLY CA C N N 116 GLY C C N N 117 GLY O O N N 118 GLY OXT O N N 119 GLY H H N N 120 GLY H2 H N N 121 GLY HA2 H N N 122 GLY HA3 H N N 123 GLY HXT H N N 124 HIS N N N N 125 HIS CA C N S 126 HIS C C N N 127 HIS O O N N 128 HIS CB C N N 129 HIS CG C Y N 130 HIS ND1 N Y N 131 HIS CD2 C Y N 132 HIS CE1 C Y N 133 HIS NE2 N Y N 134 HIS OXT O N N 135 HIS H H N N 136 HIS H2 H N N 137 HIS HA H N N 138 HIS HB2 H N N 139 HIS HB3 H N N 140 HIS HD1 H N N 141 HIS HD2 H N N 142 HIS HE1 H N N 143 HIS HE2 H N N 144 HIS HXT H N N 145 ILE N N N N 146 ILE CA C N S 147 ILE C C N N 148 ILE O O N N 149 ILE CB C N S 150 ILE CG1 C N N 151 ILE CG2 C N N 152 ILE CD1 C N N 153 ILE OXT O N N 154 ILE H H N N 155 ILE H2 H N N 156 ILE HA H N N 157 ILE HB H N N 158 ILE HG12 H N N 159 ILE HG13 H N N 160 ILE HG21 H N N 161 ILE HG22 H N N 162 ILE HG23 H N N 163 ILE HD11 H N N 164 ILE HD12 H N N 165 ILE HD13 H N N 166 ILE HXT H N N 167 LEU N N N N 168 LEU CA C N S 169 LEU C C N N 170 LEU O O N N 171 LEU CB C N N 172 LEU CG C N N 173 LEU CD1 C N N 174 LEU CD2 C N N 175 LEU OXT O N N 176 LEU H H N N 177 LEU H2 H N N 178 LEU HA H N N 179 LEU HB2 H N N 180 LEU HB3 H N N 181 LEU HG H N N 182 LEU HD11 H N N 183 LEU HD12 H N N 184 LEU HD13 H N N 185 LEU HD21 H N N 186 LEU HD22 H N N 187 LEU HD23 H N N 188 LEU HXT H N N 189 LYS N N N N 190 LYS CA C N S 191 LYS C C N N 192 LYS O O N N 193 LYS CB C N N 194 LYS CG C N N 195 LYS CD C N N 196 LYS CE C N N 197 LYS NZ N N N 198 LYS OXT O N N 199 LYS H H N N 200 LYS H2 H N N 201 LYS HA H N N 202 LYS HB2 H N N 203 LYS HB3 H N N 204 LYS HG2 H N N 205 LYS HG3 H N N 206 LYS HD2 H N N 207 LYS HD3 H N N 208 LYS HE2 H N N 209 LYS HE3 H N N 210 LYS HZ1 H N N 211 LYS HZ2 H N N 212 LYS HZ3 H N N 213 LYS HXT H N N 214 PHE N N N N 215 PHE CA C N S 216 PHE C C N N 217 PHE O O N N 218 PHE CB C N N 219 PHE CG C Y N 220 PHE CD1 C Y N 221 PHE CD2 C Y N 222 PHE CE1 C Y N 223 PHE CE2 C Y N 224 PHE CZ C Y N 225 PHE OXT O N N 226 PHE H H N N 227 PHE H2 H N N 228 PHE HA H N N 229 PHE HB2 H N N 230 PHE HB3 H N N 231 PHE HD1 H N N 232 PHE HD2 H N N 233 PHE HE1 H N N 234 PHE HE2 H N N 235 PHE HZ H N N 236 PHE HXT H N N 237 PLM C1 C N N 238 PLM O1 O N N 239 PLM O2 O N N 240 PLM C2 C N N 241 PLM C3 C N N 242 PLM C4 C N N 243 PLM C5 C N N 244 PLM C6 C N N 245 PLM C7 C N N 246 PLM C8 C N N 247 PLM C9 C N N 248 PLM CA C N N 249 PLM CB C N N 250 PLM CC C N N 251 PLM CD C N N 252 PLM CE C N N 253 PLM CF C N N 254 PLM CG C N N 255 PLM H H N N 256 PLM H21 H N N 257 PLM H22 H N N 258 PLM H31 H N N 259 PLM H32 H N N 260 PLM H41 H N N 261 PLM H42 H N N 262 PLM H51 H N N 263 PLM H52 H N N 264 PLM H61 H N N 265 PLM H62 H N N 266 PLM H71 H N N 267 PLM H72 H N N 268 PLM H81 H N N 269 PLM H82 H N N 270 PLM H91 H N N 271 PLM H92 H N N 272 PLM HA1 H N N 273 PLM HA2 H N N 274 PLM HB1 H N N 275 PLM HB2 H N N 276 PLM HC1 H N N 277 PLM HC2 H N N 278 PLM HD1 H N N 279 PLM HD2 H N N 280 PLM HE1 H N N 281 PLM HE2 H N N 282 PLM HF1 H N N 283 PLM HF2 H N N 284 PLM HG1 H N N 285 PLM HG2 H N N 286 PLM HG3 H N N 287 SER N N N N 288 SER CA C N S 289 SER C C N N 290 SER O O N N 291 SER CB C N N 292 SER OG O N N 293 SER OXT O N N 294 SER H H N N 295 SER H2 H N N 296 SER HA H N N 297 SER HB2 H N N 298 SER HB3 H N N 299 SER HG H N N 300 SER HXT H N N 301 THR N N N N 302 THR CA C N S 303 THR C C N N 304 THR O O N N 305 THR CB C N R 306 THR OG1 O N N 307 THR CG2 C N N 308 THR OXT O N N 309 THR H H N N 310 THR H2 H N N 311 THR HA H N N 312 THR HB H N N 313 THR HG1 H N N 314 THR HG21 H N N 315 THR HG22 H N N 316 THR HG23 H N N 317 THR HXT H N N 318 TRP N N N N 319 TRP CA C N S 320 TRP C C N N 321 TRP O O N N 322 TRP CB C N N 323 TRP CG C Y N 324 TRP CD1 C Y N 325 TRP CD2 C Y N 326 TRP NE1 N Y N 327 TRP CE2 C Y N 328 TRP CE3 C Y N 329 TRP CZ2 C Y N 330 TRP CZ3 C Y N 331 TRP CH2 C Y N 332 TRP OXT O N N 333 TRP H H N N 334 TRP H2 H N N 335 TRP HA H N N 336 TRP HB2 H N N 337 TRP HB3 H N N 338 TRP HD1 H N N 339 TRP HE1 H N N 340 TRP HE3 H N N 341 TRP HZ2 H N N 342 TRP HZ3 H N N 343 TRP HH2 H N N 344 TRP HXT H N N 345 TYR N N N N 346 TYR CA C N S 347 TYR C C N N 348 TYR O O N N 349 TYR CB C N N 350 TYR CG C Y N 351 TYR CD1 C Y N 352 TYR CD2 C Y N 353 TYR CE1 C Y N 354 TYR CE2 C Y N 355 TYR CZ C Y N 356 TYR OH O N N 357 TYR OXT O N N 358 TYR H H N N 359 TYR H2 H N N 360 TYR HA H N N 361 TYR HB2 H N N 362 TYR HB3 H N N 363 TYR HD1 H N N 364 TYR HD2 H N N 365 TYR HE1 H N N 366 TYR HE2 H N N 367 TYR HH H N N 368 TYR HXT H N N 369 VAL N N N N 370 VAL CA C N S 371 VAL C C N N 372 VAL O O N N 373 VAL CB C N N 374 VAL CG1 C N N 375 VAL CG2 C N N 376 VAL OXT O N N 377 VAL H H N N 378 VAL H2 H N N 379 VAL HA H N N 380 VAL HB H N N 381 VAL HG11 H N N 382 VAL HG12 H N N 383 VAL HG13 H N N 384 VAL HG21 H N N 385 VAL HG22 H N N 386 VAL HG23 H N N 387 VAL HXT H N N 388 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASP N CA sing N N 39 ASP N H sing N N 40 ASP N H2 sing N N 41 ASP CA C sing N N 42 ASP CA CB sing N N 43 ASP CA HA sing N N 44 ASP C O doub N N 45 ASP C OXT sing N N 46 ASP CB CG sing N N 47 ASP CB HB2 sing N N 48 ASP CB HB3 sing N N 49 ASP CG OD1 doub N N 50 ASP CG OD2 sing N N 51 ASP OD2 HD2 sing N N 52 ASP OXT HXT sing N N 53 GGL N CA sing N N 54 GGL N H sing N N 55 GGL N H2 sing N N 56 GGL CA C sing N N 57 GGL CA CB sing N N 58 GGL CA HA sing N N 59 GGL C O doub N N 60 GGL C OXT sing N N 61 GGL CB CG sing N N 62 GGL CB HB2 sing N N 63 GGL CB HB3 sing N N 64 GGL CG CD sing N N 65 GGL CG HG2 sing N N 66 GGL CG HG3 sing N N 67 GGL CD OE1 doub N N 68 GGL CD OE2 sing N N 69 GGL OE2 HE2 sing N N 70 GGL OXT HXT sing N N 71 GLN N CA sing N N 72 GLN N H sing N N 73 GLN N H2 sing N N 74 GLN CA C sing N N 75 GLN CA CB sing N N 76 GLN CA HA sing N N 77 GLN C O doub N N 78 GLN C OXT sing N N 79 GLN CB CG sing N N 80 GLN CB HB2 sing N N 81 GLN CB HB3 sing N N 82 GLN CG CD sing N N 83 GLN CG HG2 sing N N 84 GLN CG HG3 sing N N 85 GLN CD OE1 doub N N 86 GLN CD NE2 sing N N 87 GLN NE2 HE21 sing N N 88 GLN NE2 HE22 sing N N 89 GLN OXT HXT sing N N 90 GLU N CA sing N N 91 GLU N H sing N N 92 GLU N H2 sing N N 93 GLU CA C sing N N 94 GLU CA CB sing N N 95 GLU CA HA sing N N 96 GLU C O doub N N 97 GLU C OXT sing N N 98 GLU CB CG sing N N 99 GLU CB HB2 sing N N 100 GLU CB HB3 sing N N 101 GLU CG CD sing N N 102 GLU CG HG2 sing N N 103 GLU CG HG3 sing N N 104 GLU CD OE1 doub N N 105 GLU CD OE2 sing N N 106 GLU OE2 HE2 sing N N 107 GLU OXT HXT sing N N 108 GLY N CA sing N N 109 GLY N H sing N N 110 GLY N H2 sing N N 111 GLY CA C sing N N 112 GLY CA HA2 sing N N 113 GLY CA HA3 sing N N 114 GLY C O doub N N 115 GLY C OXT sing N N 116 GLY OXT HXT sing N N 117 HIS N CA sing N N 118 HIS N H sing N N 119 HIS N H2 sing N N 120 HIS CA C sing N N 121 HIS CA CB sing N N 122 HIS CA HA sing N N 123 HIS C O doub N N 124 HIS C OXT sing N N 125 HIS CB CG sing N N 126 HIS CB HB2 sing N N 127 HIS CB HB3 sing N N 128 HIS CG ND1 sing Y N 129 HIS CG CD2 doub Y N 130 HIS ND1 CE1 doub Y N 131 HIS ND1 HD1 sing N N 132 HIS CD2 NE2 sing Y N 133 HIS CD2 HD2 sing N N 134 HIS CE1 NE2 sing Y N 135 HIS CE1 HE1 sing N N 136 HIS NE2 HE2 sing N N 137 HIS OXT HXT sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 PHE N CA sing N N 205 PHE N H sing N N 206 PHE N H2 sing N N 207 PHE CA C sing N N 208 PHE CA CB sing N N 209 PHE CA HA sing N N 210 PHE C O doub N N 211 PHE C OXT sing N N 212 PHE CB CG sing N N 213 PHE CB HB2 sing N N 214 PHE CB HB3 sing N N 215 PHE CG CD1 doub Y N 216 PHE CG CD2 sing Y N 217 PHE CD1 CE1 sing Y N 218 PHE CD1 HD1 sing N N 219 PHE CD2 CE2 doub Y N 220 PHE CD2 HD2 sing N N 221 PHE CE1 CZ doub Y N 222 PHE CE1 HE1 sing N N 223 PHE CE2 CZ sing Y N 224 PHE CE2 HE2 sing N N 225 PHE CZ HZ sing N N 226 PHE OXT HXT sing N N 227 PLM C1 O1 sing N N 228 PLM C1 O2 doub N N 229 PLM C1 C2 sing N N 230 PLM O1 H sing N N 231 PLM C2 C3 sing N N 232 PLM C2 H21 sing N N 233 PLM C2 H22 sing N N 234 PLM C3 C4 sing N N 235 PLM C3 H31 sing N N 236 PLM C3 H32 sing N N 237 PLM C4 C5 sing N N 238 PLM C4 H41 sing N N 239 PLM C4 H42 sing N N 240 PLM C5 C6 sing N N 241 PLM C5 H51 sing N N 242 PLM C5 H52 sing N N 243 PLM C6 C7 sing N N 244 PLM C6 H61 sing N N 245 PLM C6 H62 sing N N 246 PLM C7 C8 sing N N 247 PLM C7 H71 sing N N 248 PLM C7 H72 sing N N 249 PLM C8 C9 sing N N 250 PLM C8 H81 sing N N 251 PLM C8 H82 sing N N 252 PLM C9 CA sing N N 253 PLM C9 H91 sing N N 254 PLM C9 H92 sing N N 255 PLM CA CB sing N N 256 PLM CA HA1 sing N N 257 PLM CA HA2 sing N N 258 PLM CB CC sing N N 259 PLM CB HB1 sing N N 260 PLM CB HB2 sing N N 261 PLM CC CD sing N N 262 PLM CC HC1 sing N N 263 PLM CC HC2 sing N N 264 PLM CD CE sing N N 265 PLM CD HD1 sing N N 266 PLM CD HD2 sing N N 267 PLM CE CF sing N N 268 PLM CE HE1 sing N N 269 PLM CE HE2 sing N N 270 PLM CF CG sing N N 271 PLM CF HF1 sing N N 272 PLM CF HF2 sing N N 273 PLM CG HG1 sing N N 274 PLM CG HG2 sing N N 275 PLM CG HG3 sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE III' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.details ? # _atom_sites.entry_id 9YT1 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O # loop_ #