data_9ZPQ # _entry.id 9ZPQ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.415 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9ZPQ pdb_00009zpq 10.2210/pdb9zpq/pdb WWPDB D_1000303249 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-06-17 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9ZPQ _pdbx_database_status.recvd_initial_deposition_date 2025-12-17 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 3 _pdbx_contact_author.email osnat@umd.edu _pdbx_contact_author.name_first Osnat _pdbx_contact_author.name_last Herzberg _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-2823-7627 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Shakya, A.K.' 1 ? 'Herzberg, O.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Mol.Biol. _citation.journal_id_ASTM JMOBAK _citation.journal_id_CSD 0070 _citation.journal_id_ISSN 1089-8638 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 438 _citation.language ? _citation.page_first 169813 _citation.page_last 169813 _citation.title 'Assembly and Flexibility of Borrelia burgdorferi Periplasmic HtrA Hexamers.' _citation.year 2026 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.jmb.2026.169813 _citation.pdbx_database_id_PubMed 41999937 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Shakya, A.K.' 1 ? primary 'Gallager, D.T.' 2 ? primary 'Rana, V.S.' 3 ? primary 'Singh, S.' 4 ? primary 'Hasan, S.S.' 5 ? primary 'Pal, U.' 6 ? primary 'Herzberg, O.' 7 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Periplasmic serine protease DO' 25282.684 1 ? S226A ? ;mutated catalytic serine residue S226A; fusion protein that was cleaved with precision protease leaving a GPLGS pentapeptide at the N-terminus. ; 2 non-polymer syn 'CALCIUM ION' 40.078 1 ? ? ? ? 3 non-polymer syn GLYCEROL 92.094 3 ? ? ? ? 4 water nat water 18.015 76 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GPLGSALQDSFREVSKKILPSSVEVHATGVIKQSFPIPFFFFDMPEFDSERKSNWAGSGVIIGRDSQKKSLFYVVTNSHV VDKATELEVVSYDKKKHKAKLIGKDEKKDIALISFESDDATIKVADLGDSDKLEIGDWVMAVGSPFQFSFTVTAGIVSGL QRSANPNLQSRNLFIQTDAAINRGNAGGPLVNIKGEVIGINAWIASNSGGNIGLGFAIPVNNIKSTVDFFLKGK ; _entity_poly.pdbx_seq_one_letter_code_can ;GPLGSALQDSFREVSKKILPSSVEVHATGVIKQSFPIPFFFFDMPEFDSERKSNWAGSGVIIGRDSQKKSLFYVVTNSHV VDKATELEVVSYDKKKHKAKLIGKDEKKDIALISFESDDATIKVADLGDSDKLEIGDWVMAVGSPFQFSFTVTAGIVSGL QRSANPNLQSRNLFIQTDAAINRGNAGGPLVNIKGEVIGINAWIASNSGGNIGLGFAIPVNNIKSTVDFFLKGK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CALCIUM ION' CA 3 GLYCEROL GOL 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 LEU n 1 4 GLY n 1 5 SER n 1 6 ALA n 1 7 LEU n 1 8 GLN n 1 9 ASP n 1 10 SER n 1 11 PHE n 1 12 ARG n 1 13 GLU n 1 14 VAL n 1 15 SER n 1 16 LYS n 1 17 LYS n 1 18 ILE n 1 19 LEU n 1 20 PRO n 1 21 SER n 1 22 SER n 1 23 VAL n 1 24 GLU n 1 25 VAL n 1 26 HIS n 1 27 ALA n 1 28 THR n 1 29 GLY n 1 30 VAL n 1 31 ILE n 1 32 LYS n 1 33 GLN n 1 34 SER n 1 35 PHE n 1 36 PRO n 1 37 ILE n 1 38 PRO n 1 39 PHE n 1 40 PHE n 1 41 PHE n 1 42 PHE n 1 43 ASP n 1 44 MET n 1 45 PRO n 1 46 GLU n 1 47 PHE n 1 48 ASP n 1 49 SER n 1 50 GLU n 1 51 ARG n 1 52 LYS n 1 53 SER n 1 54 ASN n 1 55 TRP n 1 56 ALA n 1 57 GLY n 1 58 SER n 1 59 GLY n 1 60 VAL n 1 61 ILE n 1 62 ILE n 1 63 GLY n 1 64 ARG n 1 65 ASP n 1 66 SER n 1 67 GLN n 1 68 LYS n 1 69 LYS n 1 70 SER n 1 71 LEU n 1 72 PHE n 1 73 TYR n 1 74 VAL n 1 75 VAL n 1 76 THR n 1 77 ASN n 1 78 SER n 1 79 HIS n 1 80 VAL n 1 81 VAL n 1 82 ASP n 1 83 LYS n 1 84 ALA n 1 85 THR n 1 86 GLU n 1 87 LEU n 1 88 GLU n 1 89 VAL n 1 90 VAL n 1 91 SER n 1 92 TYR n 1 93 ASP n 1 94 LYS n 1 95 LYS n 1 96 LYS n 1 97 HIS n 1 98 LYS n 1 99 ALA n 1 100 LYS n 1 101 LEU n 1 102 ILE n 1 103 GLY n 1 104 LYS n 1 105 ASP n 1 106 GLU n 1 107 LYS n 1 108 LYS n 1 109 ASP n 1 110 ILE n 1 111 ALA n 1 112 LEU n 1 113 ILE n 1 114 SER n 1 115 PHE n 1 116 GLU n 1 117 SER n 1 118 ASP n 1 119 ASP n 1 120 ALA n 1 121 THR n 1 122 ILE n 1 123 LYS n 1 124 VAL n 1 125 ALA n 1 126 ASP n 1 127 LEU n 1 128 GLY n 1 129 ASP n 1 130 SER n 1 131 ASP n 1 132 LYS n 1 133 LEU n 1 134 GLU n 1 135 ILE n 1 136 GLY n 1 137 ASP n 1 138 TRP n 1 139 VAL n 1 140 MET n 1 141 ALA n 1 142 VAL n 1 143 GLY n 1 144 SER n 1 145 PRO n 1 146 PHE n 1 147 GLN n 1 148 PHE n 1 149 SER n 1 150 PHE n 1 151 THR n 1 152 VAL n 1 153 THR n 1 154 ALA n 1 155 GLY n 1 156 ILE n 1 157 VAL n 1 158 SER n 1 159 GLY n 1 160 LEU n 1 161 GLN n 1 162 ARG n 1 163 SER n 1 164 ALA n 1 165 ASN n 1 166 PRO n 1 167 ASN n 1 168 LEU n 1 169 GLN n 1 170 SER n 1 171 ARG n 1 172 ASN n 1 173 LEU n 1 174 PHE n 1 175 ILE n 1 176 GLN n 1 177 THR n 1 178 ASP n 1 179 ALA n 1 180 ALA n 1 181 ILE n 1 182 ASN n 1 183 ARG n 1 184 GLY n 1 185 ASN n 1 186 ALA n 1 187 GLY n 1 188 GLY n 1 189 PRO n 1 190 LEU n 1 191 VAL n 1 192 ASN n 1 193 ILE n 1 194 LYS n 1 195 GLY n 1 196 GLU n 1 197 VAL n 1 198 ILE n 1 199 GLY n 1 200 ILE n 1 201 ASN n 1 202 ALA n 1 203 TRP n 1 204 ILE n 1 205 ALA n 1 206 SER n 1 207 ASN n 1 208 SER n 1 209 GLY n 1 210 GLY n 1 211 ASN n 1 212 ILE n 1 213 GLY n 1 214 LEU n 1 215 GLY n 1 216 PHE n 1 217 ALA n 1 218 ILE n 1 219 PRO n 1 220 VAL n 1 221 ASN n 1 222 ASN n 1 223 ILE n 1 224 LYS n 1 225 SER n 1 226 THR n 1 227 VAL n 1 228 ASP n 1 229 PHE n 1 230 PHE n 1 231 LEU n 1 232 LYS n 1 233 GLY n 1 234 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 234 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene BB_0104 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain B31 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Borreliella burgdorferi B31' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 224326 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc 'ATCC 35210' _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 41 ? ? ? A . n A 1 2 PRO 2 42 ? ? ? A . n A 1 3 LEU 3 43 ? ? ? A . n A 1 4 GLY 4 44 ? ? ? A . n A 1 5 SER 5 45 ? ? ? A . n A 1 6 ALA 6 46 46 ALA ALA A . n A 1 7 LEU 7 47 47 LEU LEU A . n A 1 8 GLN 8 48 48 GLN GLN A . n A 1 9 ASP 9 49 49 ASP ASP A . n A 1 10 SER 10 50 50 SER SER A . n A 1 11 PHE 11 51 51 PHE PHE A . n A 1 12 ARG 12 52 52 ARG ARG A . n A 1 13 GLU 13 53 53 GLU GLU A . n A 1 14 VAL 14 54 54 VAL VAL A . n A 1 15 SER 15 55 55 SER SER A . n A 1 16 LYS 16 56 56 LYS LYS A . n A 1 17 LYS 17 57 57 LYS LYS A . n A 1 18 ILE 18 58 58 ILE ILE A . n A 1 19 LEU 19 59 59 LEU LEU A . n A 1 20 PRO 20 60 60 PRO PRO A . n A 1 21 SER 21 61 61 SER SER A . n A 1 22 SER 22 62 62 SER SER A . n A 1 23 VAL 23 63 63 VAL VAL A . n A 1 24 GLU 24 64 64 GLU GLU A . n A 1 25 VAL 25 65 65 VAL VAL A . n A 1 26 HIS 26 66 66 HIS HIS A . n A 1 27 ALA 27 67 67 ALA ALA A . n A 1 28 THR 28 68 68 THR THR A . n A 1 29 GLY 29 69 69 GLY GLY A . n A 1 30 VAL 30 70 70 VAL VAL A . n A 1 31 ILE 31 71 ? ? ? A . n A 1 32 LYS 32 72 ? ? ? A . n A 1 33 GLN 33 73 ? ? ? A . n A 1 34 SER 34 74 ? ? ? A . n A 1 35 PHE 35 75 ? ? ? A . n A 1 36 PRO 36 76 ? ? ? A . n A 1 37 ILE 37 77 ? ? ? A . n A 1 38 PRO 38 78 ? ? ? A . n A 1 39 PHE 39 79 ? ? ? A . n A 1 40 PHE 40 80 ? ? ? A . n A 1 41 PHE 41 81 ? ? ? A . n A 1 42 PHE 42 82 ? ? ? A . n A 1 43 ASP 43 83 ? ? ? A . n A 1 44 MET 44 84 ? ? ? A . n A 1 45 PRO 45 85 ? ? ? A . n A 1 46 GLU 46 86 ? ? ? A . n A 1 47 PHE 47 87 ? ? ? A . n A 1 48 ASP 48 88 ? ? ? A . n A 1 49 SER 49 89 ? ? ? A . n A 1 50 GLU 50 90 ? ? ? A . n A 1 51 ARG 51 91 ? ? ? A . n A 1 52 LYS 52 92 92 LYS LYS A . n A 1 53 SER 53 93 93 SER SER A . n A 1 54 ASN 54 94 94 ASN ASN A . n A 1 55 TRP 55 95 95 TRP TRP A . n A 1 56 ALA 56 96 96 ALA ALA A . n A 1 57 GLY 57 97 97 GLY GLY A . n A 1 58 SER 58 98 98 SER SER A . n A 1 59 GLY 59 99 99 GLY GLY A . n A 1 60 VAL 60 100 100 VAL VAL A . n A 1 61 ILE 61 101 101 ILE ILE A . n A 1 62 ILE 62 102 102 ILE ILE A . n A 1 63 GLY 63 103 103 GLY GLY A . n A 1 64 ARG 64 104 104 ARG ARG A . n A 1 65 ASP 65 105 105 ASP ASP A . n A 1 66 SER 66 106 106 SER SER A . n A 1 67 GLN 67 107 107 GLN GLN A . n A 1 68 LYS 68 108 108 LYS LYS A . n A 1 69 LYS 69 109 109 LYS LYS A . n A 1 70 SER 70 110 110 SER SER A . n A 1 71 LEU 71 111 111 LEU LEU A . n A 1 72 PHE 72 112 112 PHE PHE A . n A 1 73 TYR 73 113 113 TYR TYR A . n A 1 74 VAL 74 114 114 VAL VAL A . n A 1 75 VAL 75 115 115 VAL VAL A . n A 1 76 THR 76 116 116 THR THR A . n A 1 77 ASN 77 117 117 ASN ASN A . n A 1 78 SER 78 118 118 SER SER A . n A 1 79 HIS 79 119 119 HIS HIS A . n A 1 80 VAL 80 120 120 VAL VAL A . n A 1 81 VAL 81 121 121 VAL VAL A . n A 1 82 ASP 82 122 122 ASP ASP A . n A 1 83 LYS 83 123 123 LYS LYS A . n A 1 84 ALA 84 124 124 ALA ALA A . n A 1 85 THR 85 125 125 THR THR A . n A 1 86 GLU 86 126 126 GLU GLU A . n A 1 87 LEU 87 127 127 LEU LEU A . n A 1 88 GLU 88 128 128 GLU GLU A . n A 1 89 VAL 89 129 129 VAL VAL A . n A 1 90 VAL 90 130 130 VAL VAL A . n A 1 91 SER 91 131 131 SER SER A . n A 1 92 TYR 92 132 132 TYR TYR A . n A 1 93 ASP 93 133 133 ASP ASP A . n A 1 94 LYS 94 134 134 LYS LYS A . n A 1 95 LYS 95 135 135 LYS LYS A . n A 1 96 LYS 96 136 136 LYS LYS A . n A 1 97 HIS 97 137 137 HIS HIS A . n A 1 98 LYS 98 138 138 LYS LYS A . n A 1 99 ALA 99 139 139 ALA ALA A . n A 1 100 LYS 100 140 140 LYS LYS A . n A 1 101 LEU 101 141 141 LEU LEU A . n A 1 102 ILE 102 142 142 ILE ILE A . n A 1 103 GLY 103 143 143 GLY GLY A . n A 1 104 LYS 104 144 144 LYS LYS A . n A 1 105 ASP 105 145 145 ASP ASP A . n A 1 106 GLU 106 146 146 GLU GLU A . n A 1 107 LYS 107 147 147 LYS LYS A . n A 1 108 LYS 108 148 148 LYS LYS A . n A 1 109 ASP 109 149 149 ASP ASP A . n A 1 110 ILE 110 150 150 ILE ILE A . n A 1 111 ALA 111 151 151 ALA ALA A . n A 1 112 LEU 112 152 152 LEU LEU A . n A 1 113 ILE 113 153 153 ILE ILE A . n A 1 114 SER 114 154 154 SER SER A . n A 1 115 PHE 115 155 155 PHE PHE A . n A 1 116 GLU 116 156 156 GLU GLU A . n A 1 117 SER 117 157 157 SER SER A . n A 1 118 ASP 118 158 158 ASP ASP A . n A 1 119 ASP 119 159 159 ASP ASP A . n A 1 120 ALA 120 160 160 ALA ALA A . n A 1 121 THR 121 161 161 THR THR A . n A 1 122 ILE 122 162 162 ILE ILE A . n A 1 123 LYS 123 163 163 LYS LYS A . n A 1 124 VAL 124 164 164 VAL VAL A . n A 1 125 ALA 125 165 165 ALA ALA A . n A 1 126 ASP 126 166 166 ASP ASP A . n A 1 127 LEU 127 167 167 LEU LEU A . n A 1 128 GLY 128 168 168 GLY GLY A . n A 1 129 ASP 129 169 169 ASP ASP A . n A 1 130 SER 130 170 170 SER SER A . n A 1 131 ASP 131 171 171 ASP ASP A . n A 1 132 LYS 132 172 172 LYS LYS A . n A 1 133 LEU 133 173 173 LEU LEU A . n A 1 134 GLU 134 174 174 GLU GLU A . n A 1 135 ILE 135 175 175 ILE ILE A . n A 1 136 GLY 136 176 176 GLY GLY A . n A 1 137 ASP 137 177 177 ASP ASP A . n A 1 138 TRP 138 178 178 TRP TRP A . n A 1 139 VAL 139 179 179 VAL VAL A . n A 1 140 MET 140 180 180 MET MET A . n A 1 141 ALA 141 181 181 ALA ALA A . n A 1 142 VAL 142 182 182 VAL VAL A . n A 1 143 GLY 143 183 183 GLY GLY A . n A 1 144 SER 144 184 184 SER SER A . n A 1 145 PRO 145 185 185 PRO PRO A . n A 1 146 PHE 146 186 186 PHE PHE A . n A 1 147 GLN 147 187 187 GLN GLN A . n A 1 148 PHE 148 188 188 PHE PHE A . n A 1 149 SER 149 189 189 SER SER A . n A 1 150 PHE 150 190 190 PHE PHE A . n A 1 151 THR 151 191 191 THR THR A . n A 1 152 VAL 152 192 192 VAL VAL A . n A 1 153 THR 153 193 193 THR THR A . n A 1 154 ALA 154 194 194 ALA ALA A . n A 1 155 GLY 155 195 195 GLY GLY A . n A 1 156 ILE 156 196 196 ILE ILE A . n A 1 157 VAL 157 197 197 VAL VAL A . n A 1 158 SER 158 198 198 SER SER A . n A 1 159 GLY 159 199 199 GLY GLY A . n A 1 160 LEU 160 200 200 LEU LEU A . n A 1 161 GLN 161 201 201 GLN GLN A . n A 1 162 ARG 162 202 202 ARG ARG A . n A 1 163 SER 163 203 203 SER SER A . n A 1 164 ALA 164 204 ? ? ? A . n A 1 165 ASN 165 205 ? ? ? A . n A 1 166 PRO 166 206 ? ? ? A . n A 1 167 ASN 167 207 ? ? ? A . n A 1 168 LEU 168 208 ? ? ? A . n A 1 169 GLN 169 209 ? ? ? A . n A 1 170 SER 170 210 210 SER SER A . n A 1 171 ARG 171 211 211 ARG ARG A . n A 1 172 ASN 172 212 212 ASN ASN A . n A 1 173 LEU 173 213 213 LEU LEU A . n A 1 174 PHE 174 214 214 PHE PHE A . n A 1 175 ILE 175 215 215 ILE ILE A . n A 1 176 GLN 176 216 216 GLN GLN A . n A 1 177 THR 177 217 217 THR THR A . n A 1 178 ASP 178 218 218 ASP ASP A . n A 1 179 ALA 179 219 219 ALA ALA A . n A 1 180 ALA 180 220 220 ALA ALA A . n A 1 181 ILE 181 221 221 ILE ILE A . n A 1 182 ASN 182 222 222 ASN ASN A . n A 1 183 ARG 183 223 223 ARG ARG A . n A 1 184 GLY 184 224 224 GLY GLY A . n A 1 185 ASN 185 225 225 ASN ASN A . n A 1 186 ALA 186 226 226 ALA ALA A . n A 1 187 GLY 187 227 227 GLY GLY A . n A 1 188 GLY 188 228 228 GLY GLY A . n A 1 189 PRO 189 229 229 PRO PRO A . n A 1 190 LEU 190 230 230 LEU LEU A . n A 1 191 VAL 191 231 231 VAL VAL A . n A 1 192 ASN 192 232 232 ASN ASN A . n A 1 193 ILE 193 233 233 ILE ILE A . n A 1 194 LYS 194 234 234 LYS LYS A . n A 1 195 GLY 195 235 235 GLY GLY A . n A 1 196 GLU 196 236 236 GLU GLU A . n A 1 197 VAL 197 237 237 VAL VAL A . n A 1 198 ILE 198 238 238 ILE ILE A . n A 1 199 GLY 199 239 239 GLY GLY A . n A 1 200 ILE 200 240 240 ILE ILE A . n A 1 201 ASN 201 241 241 ASN ASN A . n A 1 202 ALA 202 242 242 ALA ALA A . n A 1 203 TRP 203 243 243 TRP TRP A . n A 1 204 ILE 204 244 244 ILE ILE A . n A 1 205 ALA 205 245 ? ? ? A . n A 1 206 SER 206 246 ? ? ? A . n A 1 207 ASN 207 247 ? ? ? A . n A 1 208 SER 208 248 ? ? ? A . n A 1 209 GLY 209 249 ? ? ? A . n A 1 210 GLY 210 250 ? ? ? A . n A 1 211 ASN 211 251 ? ? ? A . n A 1 212 ILE 212 252 252 ILE ILE A . n A 1 213 GLY 213 253 253 GLY GLY A . n A 1 214 LEU 214 254 254 LEU LEU A . n A 1 215 GLY 215 255 255 GLY GLY A . n A 1 216 PHE 216 256 256 PHE PHE A . n A 1 217 ALA 217 257 257 ALA ALA A . n A 1 218 ILE 218 258 258 ILE ILE A . n A 1 219 PRO 219 259 259 PRO PRO A . n A 1 220 VAL 220 260 260 VAL VAL A . n A 1 221 ASN 221 261 261 ASN ASN A . n A 1 222 ASN 222 262 262 ASN ASN A . n A 1 223 ILE 223 263 263 ILE ILE A . n A 1 224 LYS 224 264 264 LYS LYS A . n A 1 225 SER 225 265 265 SER SER A . n A 1 226 THR 226 266 266 THR THR A . n A 1 227 VAL 227 267 267 VAL VAL A . n A 1 228 ASP 228 268 268 ASP ASP A . n A 1 229 PHE 229 269 269 PHE PHE A . n A 1 230 PHE 230 270 270 PHE PHE A . n A 1 231 LEU 231 271 271 LEU LEU A . n A 1 232 LYS 232 272 ? ? ? A . n A 1 233 GLY 233 273 ? ? ? A . n A 1 234 LYS 234 274 ? ? ? A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id CA _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id CA _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CA 1 301 1 CA CA A . C 3 GOL 1 302 2 GOL GOL A . D 3 GOL 1 303 3 GOL GOL A . E 3 GOL 1 304 4 GOL GOL A . F 4 HOH 1 401 54 HOH HOH A . F 4 HOH 2 402 64 HOH HOH A . F 4 HOH 3 403 57 HOH HOH A . F 4 HOH 4 404 78 HOH HOH A . F 4 HOH 5 405 36 HOH HOH A . F 4 HOH 6 406 40 HOH HOH A . F 4 HOH 7 407 49 HOH HOH A . F 4 HOH 8 408 11 HOH HOH A . F 4 HOH 9 409 70 HOH HOH A . F 4 HOH 10 410 22 HOH HOH A . F 4 HOH 11 411 38 HOH HOH A . F 4 HOH 12 412 80 HOH HOH A . F 4 HOH 13 413 7 HOH HOH A . F 4 HOH 14 414 62 HOH HOH A . F 4 HOH 15 415 23 HOH HOH A . F 4 HOH 16 416 60 HOH HOH A . F 4 HOH 17 417 5 HOH HOH A . F 4 HOH 18 418 6 HOH HOH A . F 4 HOH 19 419 14 HOH HOH A . F 4 HOH 20 420 15 HOH HOH A . F 4 HOH 21 421 12 HOH HOH A . F 4 HOH 22 422 50 HOH HOH A . F 4 HOH 23 423 65 HOH HOH A . F 4 HOH 24 424 17 HOH HOH A . F 4 HOH 25 425 45 HOH HOH A . F 4 HOH 26 426 25 HOH HOH A . F 4 HOH 27 427 31 HOH HOH A . F 4 HOH 28 428 69 HOH HOH A . F 4 HOH 29 429 13 HOH HOH A . F 4 HOH 30 430 27 HOH HOH A . F 4 HOH 31 431 8 HOH HOH A . F 4 HOH 32 432 10 HOH HOH A . F 4 HOH 33 433 32 HOH HOH A . F 4 HOH 34 434 16 HOH HOH A . F 4 HOH 35 435 21 HOH HOH A . F 4 HOH 36 436 33 HOH HOH A . F 4 HOH 37 437 66 HOH HOH A . F 4 HOH 38 438 19 HOH HOH A . F 4 HOH 39 439 28 HOH HOH A . F 4 HOH 40 440 51 HOH HOH A . F 4 HOH 41 441 37 HOH HOH A . F 4 HOH 42 442 39 HOH HOH A . F 4 HOH 43 443 56 HOH HOH A . F 4 HOH 44 444 24 HOH HOH A . F 4 HOH 45 445 34 HOH HOH A . F 4 HOH 46 446 9 HOH HOH A . F 4 HOH 47 447 35 HOH HOH A . F 4 HOH 48 448 75 HOH HOH A . F 4 HOH 49 449 52 HOH HOH A . F 4 HOH 50 450 79 HOH HOH A . F 4 HOH 51 451 43 HOH HOH A . F 4 HOH 52 452 41 HOH HOH A . F 4 HOH 53 453 26 HOH HOH A . F 4 HOH 54 454 29 HOH HOH A . F 4 HOH 55 455 63 HOH HOH A . F 4 HOH 56 456 58 HOH HOH A . F 4 HOH 57 457 74 HOH HOH A . F 4 HOH 58 458 30 HOH HOH A . F 4 HOH 59 459 48 HOH HOH A . F 4 HOH 60 460 73 HOH HOH A . F 4 HOH 61 461 20 HOH HOH A . F 4 HOH 62 462 61 HOH HOH A . F 4 HOH 63 463 44 HOH HOH A . F 4 HOH 64 464 46 HOH HOH A . F 4 HOH 65 465 53 HOH HOH A . F 4 HOH 66 466 71 HOH HOH A . F 4 HOH 67 467 67 HOH HOH A . F 4 HOH 68 468 77 HOH HOH A . F 4 HOH 69 469 72 HOH HOH A . F 4 HOH 70 470 59 HOH HOH A . F 4 HOH 71 471 42 HOH HOH A . F 4 HOH 72 472 47 HOH HOH A . F 4 HOH 73 473 68 HOH HOH A . F 4 HOH 74 474 55 HOH HOH A . F 4 HOH 75 475 18 HOH HOH A . F 4 HOH 76 476 76 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 92 ? CG ? A LYS 52 CG 2 1 Y 1 A LYS 92 ? CD ? A LYS 52 CD 3 1 Y 1 A LYS 92 ? CE ? A LYS 52 CE 4 1 Y 1 A LYS 92 ? NZ ? A LYS 52 NZ 5 1 Y 1 A LYS 109 ? CE ? A LYS 69 CE 6 1 Y 1 A LYS 109 ? NZ ? A LYS 69 NZ 7 1 Y 1 A LYS 138 ? CD ? A LYS 98 CD 8 1 Y 1 A LYS 138 ? CE ? A LYS 98 CE 9 1 Y 1 A LYS 138 ? NZ ? A LYS 98 NZ 10 1 Y 1 A LYS 147 ? CG ? A LYS 107 CG 11 1 Y 1 A LYS 147 ? CD ? A LYS 107 CD 12 1 Y 1 A LYS 147 ? CE ? A LYS 107 CE 13 1 Y 1 A LYS 147 ? NZ ? A LYS 107 NZ 14 1 Y 1 A ARG 223 ? CG ? A ARG 183 CG 15 1 Y 1 A ARG 223 ? CD ? A ARG 183 CD 16 1 Y 1 A ARG 223 ? NE ? A ARG 183 NE 17 1 Y 1 A ARG 223 ? CZ ? A ARG 183 CZ 18 1 Y 1 A ARG 223 ? NH1 ? A ARG 183 NH1 19 1 Y 1 A ARG 223 ? NH2 ? A ARG 183 NH2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.20.1_4487: ???)' ? 1 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? . ? 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . ? 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . ? 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . ? 5 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 9ZPQ _cell.details ? _cell.formula_units_Z ? _cell.length_a 114.537 _cell.length_a_esd ? _cell.length_b 114.537 _cell.length_b_esd ? _cell.length_c 101.504 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 18 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9ZPQ _symmetry.cell_setting ? _symmetry.Int_Tables_number 155 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'H 3 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9ZPQ _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.45 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 49.89 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '2 M sodium chloride and 10% Polyethylene glycol 6000' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2024-06-23 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'double crystal Si(111)' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.92010 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'NSLS BEAMLINE X17B1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.92010 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline X17B1 _diffrn_source.pdbx_synchrotron_site NSLS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 9ZPQ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.1 _reflns.d_resolution_low 30.2 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 14557 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 96.6 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 2.0 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 10.6 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.1 _reflns_shell.d_res_low 2.2 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1469 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.416 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9ZPQ _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.10 _refine.ls_d_res_low 30.16 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 14552 _refine.ls_number_reflns_R_free 681 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 96.61 _refine.ls_percent_reflns_R_free 4.68 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1803 _refine.ls_R_factor_R_free 0.2186 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1785 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.10 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 28.12 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.24 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.10 _refine_hist.d_res_low 30.16 _refine_hist.number_atoms_solvent 76 _refine_hist.number_atoms_total 1537 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1442 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 19 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.008 ? 1508 ? f_bond_d ? ? ? 'X-RAY DIFFRACTION' ? 0.924 ? 2037 ? f_angle_d ? ? ? 'X-RAY DIFFRACTION' ? 7.381 ? 206 ? f_dihedral_angle_d ? ? ? 'X-RAY DIFFRACTION' ? 0.064 ? 239 ? f_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.007 ? 257 ? f_plane_restr ? ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.10 2.26 . . 122 2420 86.00 . . . . 0.3006 . . . . . . . . . . . . . . . 0.3605 'X-RAY DIFFRACTION' 2.26 2.49 . . 130 2850 100.00 . . . . 0.2436 . . . . . . . . . . . . . . . 0.2975 'X-RAY DIFFRACTION' 2.49 2.85 . . 133 2857 100.00 . . . . 0.2117 . . . . . . . . . . . . . . . 0.2869 'X-RAY DIFFRACTION' 2.85 3.59 . . 142 2870 100.00 . . . . 0.1887 . . . . . . . . . . . . . . . 0.2210 'X-RAY DIFFRACTION' 3.59 30.16 . . 154 2874 98.00 . . . . 0.1484 . . . . . . . . . . . . . . . 0.1824 # _struct.entry_id 9ZPQ _struct.title 'Crystal structure of B. burgdorferi HtrA protease domain Ser226Ala mutant' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9ZPQ _struct_keywords.text 'HtrA, serine protease domain, chaperone, calcium binding, trimer, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 3 ? F N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code O51131_BORBU _struct_ref.pdbx_db_accession O51131 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;ALQDSFREVSKKILPSSVEVHATGVIKQSFPIPFFFFDMPEFDSERKSNWAGSGVIIGRDSQKKSLFYVVTNSHVVDKAT ELEVVSYDKKKHKAKLIGKDEKKDIALISFESDDATIKVADLGDSDKLEIGDWVMAVGSPFQFSFTVTAGIVSGLQRSAN PNLQSRNLFIQTDAAINRGNSGGPLVNIKGEVIGINAWIASNSGGNIGLGFAIPVNNIKSTVDFFLKGK ; _struct_ref.pdbx_align_begin 46 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9ZPQ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 6 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 234 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O51131 _struct_ref_seq.db_align_beg 46 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 274 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 46 _struct_ref_seq.pdbx_auth_seq_align_end 274 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9ZPQ GLY A 1 ? UNP O51131 ? ? 'expression tag' 41 1 1 9ZPQ PRO A 2 ? UNP O51131 ? ? 'expression tag' 42 2 1 9ZPQ LEU A 3 ? UNP O51131 ? ? 'expression tag' 43 3 1 9ZPQ GLY A 4 ? UNP O51131 ? ? 'expression tag' 44 4 1 9ZPQ SER A 5 ? UNP O51131 ? ? 'expression tag' 45 5 1 9ZPQ ALA A 186 ? UNP O51131 SER 226 'engineered mutation' 226 6 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 6170 ? 1 MORE -32 ? 1 'SSA (A^2)' 24010 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_555 -y,x-y,z -0.5000000000 -0.8660254038 0.0000000000 0.0000000000 0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_555 -x+y,-x,z -0.5000000000 0.8660254038 0.0000000000 0.0000000000 -0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ALA A 6 ? LEU A 19 ? ALA A 46 LEU A 59 1 ? 14 HELX_P HELX_P2 AA2 ASN A 77 ? ASP A 82 ? ASN A 117 ASP A 122 1 ? 6 HELX_P HELX_P3 AA3 ASP A 129 ? LEU A 133 ? ASP A 169 LEU A 173 5 ? 5 HELX_P HELX_P4 AA4 VAL A 220 ? ASP A 228 ? VAL A 260 ASP A 268 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? B CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 301 A HOH 405 1_555 ? ? ? ? ? ? ? 2.477 ? ? metalc2 metalc ? ? B CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 301 A HOH 405 2_555 ? ? ? ? ? ? ? 2.477 ? ? metalc3 metalc ? ? B CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 301 A HOH 458 1_555 ? ? ? ? ? ? ? 2.525 ? ? metalc4 metalc ? ? B CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 301 A HOH 458 2_555 ? ? ? ? ? ? ? 2.525 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? F HOH . ? A HOH 405 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 O ? F HOH . ? A HOH 405 ? 2_555 103.6 ? 2 O ? F HOH . ? A HOH 405 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 O ? F HOH . ? A HOH 458 ? 1_555 81.3 ? 3 O ? F HOH . ? A HOH 405 ? 2_555 CA ? B CA . ? A CA 301 ? 1_555 O ? F HOH . ? A HOH 458 ? 1_555 165.8 ? 4 O ? F HOH . ? A HOH 405 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 O ? F HOH . ? A HOH 458 ? 2_555 87.9 ? 5 O ? F HOH . ? A HOH 405 ? 2_555 CA ? B CA . ? A CA 301 ? 1_555 O ? F HOH . ? A HOH 458 ? 2_555 81.3 ? 6 O ? F HOH . ? A HOH 458 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 O ? F HOH . ? A HOH 458 ? 2_555 85.6 ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 7 ? AA2 ? 7 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel AA2 6 7 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 SER A 22 ? THR A 28 ? SER A 62 THR A 68 AA1 2 TRP A 55 ? ARG A 64 ? TRP A 95 ARG A 104 AA1 3 LEU A 71 ? THR A 76 ? LEU A 111 THR A 116 AA1 4 ILE A 110 ? GLU A 116 ? ILE A 150 GLU A 156 AA1 5 LYS A 96 ? ASP A 105 ? LYS A 136 ASP A 145 AA1 6 GLU A 86 ? VAL A 90 ? GLU A 126 VAL A 130 AA1 7 SER A 22 ? THR A 28 ? SER A 62 THR A 68 AA2 1 TRP A 138 ? GLY A 143 ? TRP A 178 GLY A 183 AA2 2 THR A 151 ? GLN A 161 ? THR A 191 GLN A 201 AA2 3 PHE A 174 ? THR A 177 ? PHE A 214 THR A 217 AA2 4 GLY A 215 ? PRO A 219 ? GLY A 255 PRO A 259 AA2 5 VAL A 197 ? ALA A 202 ? VAL A 237 ALA A 242 AA2 6 PRO A 189 ? ASN A 192 ? PRO A 229 ASN A 232 AA2 7 TRP A 138 ? GLY A 143 ? TRP A 178 GLY A 183 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N VAL A 25 ? N VAL A 65 O GLY A 57 ? O GLY A 97 AA1 2 3 N GLY A 63 ? N GLY A 103 O TYR A 73 ? O TYR A 113 AA1 3 4 N PHE A 72 ? N PHE A 112 O PHE A 115 ? O PHE A 155 AA1 4 5 O ILE A 110 ? O ILE A 150 N ASP A 105 ? N ASP A 145 AA1 5 6 O HIS A 97 ? O HIS A 137 N VAL A 89 ? N VAL A 129 AA1 6 7 O GLU A 88 ? O GLU A 128 N HIS A 26 ? N HIS A 66 AA2 1 2 N VAL A 139 ? N VAL A 179 O GLY A 155 ? O GLY A 195 AA2 2 3 N SER A 158 ? N SER A 198 O GLN A 176 ? O GLN A 216 AA2 3 4 N THR A 177 ? N THR A 217 O GLY A 215 ? O GLY A 255 AA2 4 5 O PHE A 216 ? O PHE A 256 N ALA A 202 ? N ALA A 242 AA2 5 6 O ILE A 198 ? O ILE A 238 N LEU A 190 ? N LEU A 230 AA2 6 7 O PRO A 189 ? O PRO A 229 N VAL A 142 ? N VAL A 182 # _pdbx_entry_details.entry_id 9ZPQ _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 423 ? ? O A HOH 463 ? ? 2.18 2 1 O A ASP 169 ? ? O2 A GOL 303 ? ? 2.19 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id SER _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 189 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi 71.27 _pdbx_validate_torsion.psi -42.75 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A CA 301 ? B CA . 2 1 A HOH 443 ? F HOH . 3 1 A HOH 471 ? F HOH . 4 1 A HOH 474 ? F HOH . 5 1 A HOH 475 ? F HOH . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 41 ? A GLY 1 2 1 Y 1 A PRO 42 ? A PRO 2 3 1 Y 1 A LEU 43 ? A LEU 3 4 1 Y 1 A GLY 44 ? A GLY 4 5 1 Y 1 A SER 45 ? A SER 5 6 1 Y 1 A ILE 71 ? A ILE 31 7 1 Y 1 A LYS 72 ? A LYS 32 8 1 Y 1 A GLN 73 ? A GLN 33 9 1 Y 1 A SER 74 ? A SER 34 10 1 Y 1 A PHE 75 ? A PHE 35 11 1 Y 1 A PRO 76 ? A PRO 36 12 1 Y 1 A ILE 77 ? A ILE 37 13 1 Y 1 A PRO 78 ? A PRO 38 14 1 Y 1 A PHE 79 ? A PHE 39 15 1 Y 1 A PHE 80 ? A PHE 40 16 1 Y 1 A PHE 81 ? A PHE 41 17 1 Y 1 A PHE 82 ? A PHE 42 18 1 Y 1 A ASP 83 ? A ASP 43 19 1 Y 1 A MET 84 ? A MET 44 20 1 Y 1 A PRO 85 ? A PRO 45 21 1 Y 1 A GLU 86 ? A GLU 46 22 1 Y 1 A PHE 87 ? A PHE 47 23 1 Y 1 A ASP 88 ? A ASP 48 24 1 Y 1 A SER 89 ? A SER 49 25 1 Y 1 A GLU 90 ? A GLU 50 26 1 Y 1 A ARG 91 ? A ARG 51 27 1 Y 1 A ALA 204 ? A ALA 164 28 1 Y 1 A ASN 205 ? A ASN 165 29 1 Y 1 A PRO 206 ? A PRO 166 30 1 Y 1 A ASN 207 ? A ASN 167 31 1 Y 1 A LEU 208 ? A LEU 168 32 1 Y 1 A GLN 209 ? A GLN 169 33 1 Y 1 A ALA 245 ? A ALA 205 34 1 Y 1 A SER 246 ? A SER 206 35 1 Y 1 A ASN 247 ? A ASN 207 36 1 Y 1 A SER 248 ? A SER 208 37 1 Y 1 A GLY 249 ? A GLY 209 38 1 Y 1 A GLY 250 ? A GLY 210 39 1 Y 1 A ASN 251 ? A ASN 211 40 1 Y 1 A LYS 272 ? A LYS 232 41 1 Y 1 A GLY 273 ? A GLY 233 42 1 Y 1 A LYS 274 ? A LYS 234 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CA CA CA N N 74 GLN N N N N 75 GLN CA C N S 76 GLN C C N N 77 GLN O O N N 78 GLN CB C N N 79 GLN CG C N N 80 GLN CD C N N 81 GLN OE1 O N N 82 GLN NE2 N N N 83 GLN OXT O N N 84 GLN H H N N 85 GLN H2 H N N 86 GLN HA H N N 87 GLN HB2 H N N 88 GLN HB3 H N N 89 GLN HG2 H N N 90 GLN HG3 H N N 91 GLN HE21 H N N 92 GLN HE22 H N N 93 GLN HXT H N N 94 GLU N N N N 95 GLU CA C N S 96 GLU C C N N 97 GLU O O N N 98 GLU CB C N N 99 GLU CG C N N 100 GLU CD C N N 101 GLU OE1 O N N 102 GLU OE2 O N N 103 GLU OXT O N N 104 GLU H H N N 105 GLU H2 H N N 106 GLU HA H N N 107 GLU HB2 H N N 108 GLU HB3 H N N 109 GLU HG2 H N N 110 GLU HG3 H N N 111 GLU HE2 H N N 112 GLU HXT H N N 113 GLY N N N N 114 GLY CA C N N 115 GLY C C N N 116 GLY O O N N 117 GLY OXT O N N 118 GLY H H N N 119 GLY H2 H N N 120 GLY HA2 H N N 121 GLY HA3 H N N 122 GLY HXT H N N 123 GOL C1 C N N 124 GOL O1 O N N 125 GOL C2 C N N 126 GOL O2 O N N 127 GOL C3 C N N 128 GOL O3 O N N 129 GOL H11 H N N 130 GOL H12 H N N 131 GOL HO1 H N N 132 GOL H2 H N N 133 GOL HO2 H N N 134 GOL H31 H N N 135 GOL H32 H N N 136 GOL HO3 H N N 137 HIS N N N N 138 HIS CA C N S 139 HIS C C N N 140 HIS O O N N 141 HIS CB C N N 142 HIS CG C Y N 143 HIS ND1 N Y N 144 HIS CD2 C Y N 145 HIS CE1 C Y N 146 HIS NE2 N Y N 147 HIS OXT O N N 148 HIS H H N N 149 HIS H2 H N N 150 HIS HA H N N 151 HIS HB2 H N N 152 HIS HB3 H N N 153 HIS HD1 H N N 154 HIS HD2 H N N 155 HIS HE1 H N N 156 HIS HE2 H N N 157 HIS HXT H N N 158 HOH O O N N 159 HOH H1 H N N 160 HOH H2 H N N 161 ILE N N N N 162 ILE CA C N S 163 ILE C C N N 164 ILE O O N N 165 ILE CB C N S 166 ILE CG1 C N N 167 ILE CG2 C N N 168 ILE CD1 C N N 169 ILE OXT O N N 170 ILE H H N N 171 ILE H2 H N N 172 ILE HA H N N 173 ILE HB H N N 174 ILE HG12 H N N 175 ILE HG13 H N N 176 ILE HG21 H N N 177 ILE HG22 H N N 178 ILE HG23 H N N 179 ILE HD11 H N N 180 ILE HD12 H N N 181 ILE HD13 H N N 182 ILE HXT H N N 183 LEU N N N N 184 LEU CA C N S 185 LEU C C N N 186 LEU O O N N 187 LEU CB C N N 188 LEU CG C N N 189 LEU CD1 C N N 190 LEU CD2 C N N 191 LEU OXT O N N 192 LEU H H N N 193 LEU H2 H N N 194 LEU HA H N N 195 LEU HB2 H N N 196 LEU HB3 H N N 197 LEU HG H N N 198 LEU HD11 H N N 199 LEU HD12 H N N 200 LEU HD13 H N N 201 LEU HD21 H N N 202 LEU HD22 H N N 203 LEU HD23 H N N 204 LEU HXT H N N 205 LYS N N N N 206 LYS CA C N S 207 LYS C C N N 208 LYS O O N N 209 LYS CB C N N 210 LYS CG C N N 211 LYS CD C N N 212 LYS CE C N N 213 LYS NZ N N N 214 LYS OXT O N N 215 LYS H H N N 216 LYS H2 H N N 217 LYS HA H N N 218 LYS HB2 H N N 219 LYS HB3 H N N 220 LYS HG2 H N N 221 LYS HG3 H N N 222 LYS HD2 H N N 223 LYS HD3 H N N 224 LYS HE2 H N N 225 LYS HE3 H N N 226 LYS HZ1 H N N 227 LYS HZ2 H N N 228 LYS HZ3 H N N 229 LYS HXT H N N 230 MET N N N N 231 MET CA C N S 232 MET C C N N 233 MET O O N N 234 MET CB C N N 235 MET CG C N N 236 MET SD S N N 237 MET CE C N N 238 MET OXT O N N 239 MET H H N N 240 MET H2 H N N 241 MET HA H N N 242 MET HB2 H N N 243 MET HB3 H N N 244 MET HG2 H N N 245 MET HG3 H N N 246 MET HE1 H N N 247 MET HE2 H N N 248 MET HE3 H N N 249 MET HXT H N N 250 PHE N N N N 251 PHE CA C N S 252 PHE C C N N 253 PHE O O N N 254 PHE CB C N N 255 PHE CG C Y N 256 PHE CD1 C Y N 257 PHE CD2 C Y N 258 PHE CE1 C Y N 259 PHE CE2 C Y N 260 PHE CZ C Y N 261 PHE OXT O N N 262 PHE H H N N 263 PHE H2 H N N 264 PHE HA H N N 265 PHE HB2 H N N 266 PHE HB3 H N N 267 PHE HD1 H N N 268 PHE HD2 H N N 269 PHE HE1 H N N 270 PHE HE2 H N N 271 PHE HZ H N N 272 PHE HXT H N N 273 PRO N N N N 274 PRO CA C N S 275 PRO C C N N 276 PRO O O N N 277 PRO CB C N N 278 PRO CG C N N 279 PRO CD C N N 280 PRO OXT O N N 281 PRO H H N N 282 PRO HA H N N 283 PRO HB2 H N N 284 PRO HB3 H N N 285 PRO HG2 H N N 286 PRO HG3 H N N 287 PRO HD2 H N N 288 PRO HD3 H N N 289 PRO HXT H N N 290 SER N N N N 291 SER CA C N S 292 SER C C N N 293 SER O O N N 294 SER CB C N N 295 SER OG O N N 296 SER OXT O N N 297 SER H H N N 298 SER H2 H N N 299 SER HA H N N 300 SER HB2 H N N 301 SER HB3 H N N 302 SER HG H N N 303 SER HXT H N N 304 THR N N N N 305 THR CA C N S 306 THR C C N N 307 THR O O N N 308 THR CB C N R 309 THR OG1 O N N 310 THR CG2 C N N 311 THR OXT O N N 312 THR H H N N 313 THR H2 H N N 314 THR HA H N N 315 THR HB H N N 316 THR HG1 H N N 317 THR HG21 H N N 318 THR HG22 H N N 319 THR HG23 H N N 320 THR HXT H N N 321 TRP N N N N 322 TRP CA C N S 323 TRP C C N N 324 TRP O O N N 325 TRP CB C N N 326 TRP CG C Y N 327 TRP CD1 C Y N 328 TRP CD2 C Y N 329 TRP NE1 N Y N 330 TRP CE2 C Y N 331 TRP CE3 C Y N 332 TRP CZ2 C Y N 333 TRP CZ3 C Y N 334 TRP CH2 C Y N 335 TRP OXT O N N 336 TRP H H N N 337 TRP H2 H N N 338 TRP HA H N N 339 TRP HB2 H N N 340 TRP HB3 H N N 341 TRP HD1 H N N 342 TRP HE1 H N N 343 TRP HE3 H N N 344 TRP HZ2 H N N 345 TRP HZ3 H N N 346 TRP HH2 H N N 347 TRP HXT H N N 348 TYR N N N N 349 TYR CA C N S 350 TYR C C N N 351 TYR O O N N 352 TYR CB C N N 353 TYR CG C Y N 354 TYR CD1 C Y N 355 TYR CD2 C Y N 356 TYR CE1 C Y N 357 TYR CE2 C Y N 358 TYR CZ C Y N 359 TYR OH O N N 360 TYR OXT O N N 361 TYR H H N N 362 TYR H2 H N N 363 TYR HA H N N 364 TYR HB2 H N N 365 TYR HB3 H N N 366 TYR HD1 H N N 367 TYR HD2 H N N 368 TYR HE1 H N N 369 TYR HE2 H N N 370 TYR HH H N N 371 TYR HXT H N N 372 VAL N N N N 373 VAL CA C N S 374 VAL C C N N 375 VAL O O N N 376 VAL CB C N N 377 VAL CG1 C N N 378 VAL CG2 C N N 379 VAL OXT O N N 380 VAL H H N N 381 VAL H2 H N N 382 VAL HA H N N 383 VAL HB H N N 384 VAL HG11 H N N 385 VAL HG12 H N N 386 VAL HG13 H N N 387 VAL HG21 H N N 388 VAL HG22 H N N 389 VAL HG23 H N N 390 VAL HXT H N N 391 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 GOL C1 O1 sing N N 116 GOL C1 C2 sing N N 117 GOL C1 H11 sing N N 118 GOL C1 H12 sing N N 119 GOL O1 HO1 sing N N 120 GOL C2 O2 sing N N 121 GOL C2 C3 sing N N 122 GOL C2 H2 sing N N 123 GOL O2 HO2 sing N N 124 GOL C3 O3 sing N N 125 GOL C3 H31 sing N N 126 GOL C3 H32 sing N N 127 GOL O3 HO3 sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number AI080615 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name Other _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.details 'cryoEM structure that was determined using AlphaFold' # _atom_sites.entry_id 9ZPQ _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.008731 _atom_sites.fract_transf_matrix[1][2] 0.005041 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010081 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009852 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C CA N O S # loop_ #