1.000000 0.000000 0.000000 0.000000 1.000000 0.000000 0.000000 0.000000 1.000000 0.00000 0.00000 0.00000 Weber, T. Schaffhausen, B. Liu, Y. Guenther, U.L. http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 1 90.00 90.00 90.00 1.000 1.000 1.000 C3 H7 N O2 89.093 y ALANINE L-peptide linking C6 H15 N4 O2 1 175.209 y ARGININE L-peptide linking C4 H8 N2 O3 132.118 y ASPARAGINE L-peptide linking C4 H7 N O4 133.103 y ASPARTIC ACID L-peptide linking C5 H10 N2 O3 146.144 y GLUTAMINE L-peptide linking C5 H9 N O4 147.129 y GLUTAMIC ACID L-peptide linking C2 H5 N O2 75.067 y GLYCINE peptide linking C6 H10 N3 O2 1 156.162 y HISTIDINE L-peptide linking C6 H13 N O2 131.173 y ISOLEUCINE L-peptide linking C6 H13 N O2 131.173 y LEUCINE L-peptide linking C6 H15 N2 O2 1 147.195 y LYSINE L-peptide linking C5 H11 N O2 S 149.211 y METHIONINE L-peptide linking C9 H11 N O2 165.189 y PHENYLALANINE L-peptide linking C5 H9 N O2 115.130 y PROLINE L-peptide linking C3 H7 N O3 105.093 y SERINE L-peptide linking C4 H9 N O3 119.119 y THREONINE L-peptide linking C11 H12 N2 O2 204.225 y TRYPTOPHAN L-peptide linking C9 H11 N O3 181.189 y TYROSINE L-peptide linking C5 H11 N O2 117.146 y VALINE L-peptide linking US Biochemistry BICHAW 0033 0006-2960 39 15860 15869 10.1021/bi001474d 11123912 NMR structure of the N-SH2 of the p85 subunit of phosphoinositide 3-kinase complexed to a doubly phosphorylated peptide reveals a second phosphotyrosine binding site. 2000 10.2210/pdb1fu6/pdb pdb_00001fu6 1.000000 0.000000 0.000000 0.000000 1.000000 0.000000 0.000000 0.000000 1.000000 0.00000 0.00000 0.00000 12870.384 PHOSPHATIDYLINOSITOL 3-KINASE REGULATORY ALPHA SUBUNIT RESIDUES 321 TO 431 OF P85, N-SH2 (SRC HOMOLOGY 2) DOMAIN 1 man polymer N-SH2 (SRC HOMOLOGY 2) DOMAIN OF P85 SUBUNIT OF P13-KINASE (PHOSPHOINOSITOL 3-KINASE), PI3-KINASE P85-ALPHA SUBUNIT, PTDINS-3-KINASE P85-ALPHA, PI3K no no GMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKSIKIFHRDGKYGFSDPLTFNS VVELINHYRNESLAQYNPKLDVKLLYPVSKY GMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKSIKIFHRDGKYGFSDPLTFNS VVELINHYRNESLAQYNPKLDVKLLYPVSKY A polypeptide(L) n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n Norway rat Rattus Escherichia sample 10116 Rattus norvegicus 562 Escherichia coli database_2 pdbx_nmr_software pdbx_struct_assembly pdbx_struct_oper_list struct_ref_seq_dif repository Initial release Version format compliance Version format compliance Data collection Database references Derived calculations 1 0 2001-02-21 1 1 2008-04-27 1 2 2011-07-13 1 3 2022-02-23 _database_2.pdbx_DOI _database_2.pdbx_database_accession _pdbx_nmr_software.name _struct_ref_seq_dif.details 1FU5 is NMR Structure of the N-SH2 DOMAIN of the p85 Subunit of PI3-kinase Complexed to a Doubly Phosphorylated Peptide Derived from Polyomavirus Middle T Antigen RCSB Y RCSB 2000-09-14 REL NOESY assignments were obtained by a semi-automatic procedure employing a program from Pristovsek [Pristovsek, P. & Kidric, J. (1997) Biopol. 42, 671-679)]. structures with favorable non-bond energy 110 1 3D_13C-separated_NOESY 3D_15N-separated_NOESY 2D NOESY 0.1mM 6.8 1 bar 305 K The structure with the lowest energy is presented. The structures were energy minimized with MSI DISCOVER. 1 lowest energy 1.5mM N-SH2 15N, 13C; 0.1mM KCl; 95% H2O, 5% D2O 95% H2O/5% D2O Ulrich Guenther, Christian Ludwig and Heinz Rueterjans processing NMRLAB M. Kjaer data analysis Pronto P. Pristovsek data analysis nmr2st P. Guentert structure solution DYANA MSI refinement Discover 500 Bruker DMX 600 Bruker DMX GLY 1 n 1 GLY 1 A MET 2 n 2 MET 2 A ASN 3 n 3 ASN 3 A ASN 4 n 4 ASN 4 A ASN 5 n 5 ASN 5 A MET 6 n 6 MET 6 A SER 7 n 7 SER 7 A LEU 8 n 8 LEU 8 A GLN 9 n 9 GLN 9 A ASP 10 n 10 ASP 10 A ALA 11 n 11 ALA 11 A GLU 12 n 12 GLU 12 A TRP 13 n 13 TRP 13 A TYR 14 n 14 TYR 14 A TRP 15 n 15 TRP 15 A GLY 16 n 16 GLY 16 A ASP 17 n 17 ASP 17 A ILE 18 n 18 ILE 18 A SER 19 n 19 SER 19 A ARG 20 n 20 ARG 20 A GLU 21 n 21 GLU 21 A GLU 22 n 22 GLU 22 A VAL 23 n 23 VAL 23 A ASN 24 n 24 ASN 24 A GLU 25 n 25 GLU 25 A LYS 26 n 26 LYS 26 A LEU 27 n 27 LEU 27 A ARG 28 n 28 ARG 28 A ASP 29 n 29 ASP 29 A THR 30 n 30 THR 30 A ALA 31 n 31 ALA 31 A ASP 32 n 32 ASP 32 A GLY 33 n 33 GLY 33 A THR 34 n 34 THR 34 A PHE 35 n 35 PHE 35 A LEU 36 n 36 LEU 36 A VAL 37 n 37 VAL 37 A ARG 38 n 38 ARG 38 A ASP 39 n 39 ASP 39 A ALA 40 n 40 ALA 40 A SER 41 n 41 SER 41 A THR 42 n 42 THR 42 A LYS 43 n 43 LYS 43 A MET 44 n 44 MET 44 A HIS 45 n 45 HIS 45 A GLY 46 n 46 GLY 46 A ASP 47 n 47 ASP 47 A TYR 48 n 48 TYR 48 A THR 49 n 49 THR 49 A LEU 50 n 50 LEU 50 A THR 51 n 51 THR 51 A LEU 52 n 52 LEU 52 A ARG 53 n 53 ARG 53 A LYS 54 n 54 LYS 54 A GLY 55 n 55 GLY 55 A GLY 56 n 56 GLY 56 A ASN 57 n 57 ASN 57 A ASN 58 n 58 ASN 58 A LYS 59 n 59 LYS 59 A SER 60 n 60 SER 60 A ILE 61 n 61 ILE 61 A LYS 62 n 62 LYS 62 A ILE 63 n 63 ILE 63 A PHE 64 n 64 PHE 64 A HIS 65 n 65 HIS 65 A ARG 66 n 66 ARG 66 A ASP 67 n 67 ASP 67 A GLY 68 n 68 GLY 68 A LYS 69 n 69 LYS 69 A TYR 70 n 70 TYR 70 A GLY 71 n 71 GLY 71 A PHE 72 n 72 PHE 72 A SER 73 n 73 SER 73 A ASP 74 n 74 ASP 74 A PRO 75 n 75 PRO 75 A LEU 76 n 76 LEU 76 A THR 77 n 77 THR 77 A PHE 78 n 78 PHE 78 A ASN 79 n 79 ASN 79 A SER 80 n 80 SER 80 A VAL 81 n 81 VAL 81 A VAL 82 n 82 VAL 82 A GLU 83 n 83 GLU 83 A LEU 84 n 84 LEU 84 A ILE 85 n 85 ILE 85 A ASN 86 n 86 ASN 86 A HIS 87 n 87 HIS 87 A TYR 88 n 88 TYR 88 A ARG 89 n 89 ARG 89 A ASN 90 n 90 ASN 90 A GLU 91 n 91 GLU 91 A SER 92 n 92 SER 92 A LEU 93 n 93 LEU 93 A ALA 94 n 94 ALA 94 A GLN 95 n 95 GLN 95 A TYR 96 n 96 TYR 96 A ASN 97 n 97 ASN 97 A PRO 98 n 98 PRO 98 A LYS 99 n 99 LYS 99 A LEU 100 n 100 LEU 100 A ASP 101 n 101 ASP 101 A VAL 102 n 102 VAL 102 A LYS 103 n 103 LYS 103 A LEU 104 n 104 LEU 104 A LEU 105 n 105 LEU 105 A TYR 106 n 106 TYR 106 A PRO 107 n 107 PRO 107 A VAL 108 n 108 VAL 108 A SER 109 n 109 SER 109 A LYS 110 n 110 LYS 110 A TYR 111 n 111 TYR 111 A author_defined_assembly 1 monomeric 1.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 1_555 x,y,z identity operation 0.0000000000 0.0000000000 0.0000000000 A N LYS 54 A N LYS 54 A O ASN 57 A O ASN 57 1 A A HG1 OD1 THR ASP 42 47 1.34 1 A A OD2 HH ASP TYR 29 106 1.38 1 A A HG OD1 SER ASP 92 101 1.38 1 A A OD2 HH ASP TYR 47 48 1.42 1 A A OE2 HZ2 GLU LYS 22 110 1.51 1 A A O HG1 ASP THR 39 49 1.52 1 A A OD2 HZ2 ASP LYS 67 69 1.55 1 A A O HG GLU SER 12 109 1.56 1 A A O HG ALA SER 40 41 1.57 1 A A HG1 O THR TYR 34 106 1.59 1 A A TYR THR 48 49 -145.89 1 A A ASP VAL 101 102 146.40 1 A TYR 48 0.193 SIDE CHAIN 1 A ARG 66 0.163 SIDE CHAIN 1 A TYR 70 0.069 SIDE CHAIN 1 A TYR 96 0.079 SIDE CHAIN 1 3.36 0.50 120.30 123.66 A A A NE CZ NH1 ARG ARG ARG 20 20 20 N 1 3.51 0.50 120.30 123.81 A A A NE CZ NH1 ARG ARG ARG 28 28 28 N 1 3.17 0.50 120.30 123.47 A A A NE CZ NH1 ARG ARG ARG 38 38 38 N 1 8.33 1.30 111.50 119.83 A A A ND1 CE1 NE2 HIS HIS HIS 45 45 45 N 1 3.77 0.50 120.30 124.07 A A A NE CZ NH1 ARG ARG ARG 53 53 53 N 1 8.98 1.30 111.50 120.48 A A A ND1 CE1 NE2 HIS HIS HIS 65 65 65 N 1 8.55 1.30 111.50 120.05 A A A ND1 CE1 NE2 HIS HIS HIS 87 87 87 N 1 4.03 0.50 120.30 124.33 A A A NE CZ NH1 ARG ARG ARG 89 89 89 N 1 -3.61 0.60 121.00 117.39 A A A CB CG CD2 TYR TYR TYR 106 106 106 N 1 A A CG CD2 HIS HIS 65 65 0.055 0.009 1.354 1.409 N 1 A A C OXT TYR TYR 111 111 0.138 0.019 1.229 1.367 N 1 A GLN 9 -144.17 -28.46 1 A ASP 10 -162.19 70.04 1 A GLU 12 -70.08 36.56 1 A TRP 13 -166.12 -58.23 1 A TRP 15 -123.26 -56.56 1 A ILE 18 -131.33 -159.85 1 A SER 19 -120.52 -157.37 1 A ARG 28 -104.07 -79.64 1 A LEU 36 -152.16 -51.89 1 A VAL 37 99.21 95.00 1 A ASP 39 -91.95 -141.63 1 A SER 41 -156.97 55.07 1 A LYS 43 -157.24 -60.58 1 A MET 44 -91.03 -84.33 1 A ASP 47 -97.44 -68.56 1 A SER 60 -60.50 96.80 1 A ILE 61 -106.32 75.43 1 A ARG 66 59.55 -91.11 1 A LYS 69 -92.44 -152.90 1 A PHE 72 -95.28 -65.26 1 A SER 80 -161.36 114.45 1 A LEU 84 -75.52 42.67 1 A ILE 85 -167.39 -48.48 1 A ASN 90 -90.30 30.45 1 A GLU 91 -157.21 -77.57 1 A SER 92 -175.38 142.53 1 A TYR 96 -66.84 -70.46 1 A LEU 100 -155.74 -32.96 1 A ASP 101 -4.49 75.66 1 A VAL 102 -86.45 -152.38 1 A LYS 103 -171.25 54.83 1 A LEU 104 39.52 36.84 1 A TYR 106 -151.00 60.63 1 A SER 109 -170.22 77.96 1 A LYS 110 71.52 -63.37 NMR STRUCTURE OF THE N-SH2 DOMAIN OF THE P85 SUBUNIT OF PI3-KINASE 1 N N A ARG 20 A ARG 20 HELX_P A LEU 27 A LEU 27 1 1 8 A VAL 82 A VAL 82 HELX_P A ASN 90 A ASN 90 1 2 9 PROTEIN BINDING central beta-sheet with two flanking alpha-helices, PROTEIN BINDING P85A_RAT UNP 1 321 Q63787 GMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFNS VVELINHYRNESLAQYNPKLDVKLLYPVSKY 321 431 1FU6 1 111 Q63787 A 1 1 111 1 LEU conflict SER 60 1FU6 A Q63787 UNP 380 60 2 anti-parallel A THR 51 A THR 51 A LYS 54 A LYS 54 A ASN 57 A ASN 57 A SER 60 A SER 60 1 P 1