1.000000 0.000000 0.000000 0.000000 1.000000 0.000000 0.000000 0.000000 1.000000 0.00000 0.00000 0.00000 Fletcher, J.I. King, G.F. http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 1 90.00 90.00 90.00 1.000 1.000 1.000 C6 H15 N4 O2 1 175.209 y ARGININE L-peptide linking C4 H8 N2 O3 132.118 y ASPARAGINE L-peptide linking C4 H7 N O4 133.103 y ASPARTIC ACID L-peptide linking C3 H7 N O2 S 121.158 y CYSTEINE L-peptide linking C5 H10 N2 O3 146.144 y GLUTAMINE L-peptide linking C5 H9 N O4 147.129 y GLUTAMIC ACID L-peptide linking C2 H5 N O2 75.067 y GLYCINE peptide linking C6 H13 N O2 131.173 y ISOLEUCINE L-peptide linking C6 H15 N2 O2 1 147.195 y LYSINE L-peptide linking C9 H11 N O2 165.189 y PHENYLALANINE L-peptide linking C5 H9 N O2 115.130 y PROLINE L-peptide linking C3 H7 N O3 105.093 y SERINE L-peptide linking C4 H9 N O3 119.119 y THREONINE L-peptide linking C9 H11 N O3 181.189 y TYROSINE L-peptide linking C5 H11 N O2 117.146 y VALINE L-peptide linking US J.Biol.Chem. JBCHA3 0071 0021-9258 276 26568 26576 10.1074/jbc.M102199200 11313356 Functional significance of the beta hairpin in the insecticidal neurotoxin omega-atracotoxin-Hv1a. 2001 US Nat.Struct.Biol. NSBIEW 2024 1072-8368 4 559 566 The Structure of a Novel Insecticidal Neurotoxin, Omega-Atracotoxin-HV1, from the Venom of an Australian Funnel Web Spider 1997 IX Eur.J.Biochem. EJBCAI 0262 0014-2956 264 488 494 10.1046/j.1432-1327.1999.00646.x Structure-function Studies of Omega-atracotoxin, A Potent Antagonist of Insect Voltage-gated Calcium Channels 1999 10.2210/pdb1hvw/pdb pdb_00001hvw 1.000000 0.000000 0.000000 0.000000 1.000000 0.000000 0.000000 0.000000 1.000000 0.00000 0.00000 0.00000 2623.899 OMEGA-ATRACOTOXIN-HV1A 1 syn polymer OMEGA-ACTX-HV1A no no CIPSGQPCPYNENCCSQSCTGGRCD CIPSGQPCPYNENCCSQSCTGGRCD A polypeptide(L) n n n n n n n n n n n n n n n n n n n n n n n n n database_2 pdbx_nmr_software pdbx_struct_assembly pdbx_struct_oper_list repository Initial release Version format compliance Version format compliance Data collection Database references Derived calculations 1 0 2001-01-17 1 1 2008-04-27 1 2 2011-07-13 1 3 2022-02-23 _database_2.pdbx_DOI _database_2.pdbx_database_accession _pdbx_nmr_software.name Native omega-atracotoxin-Hv1a RCSB Y RCSB 2001-01-08 REL REL This peptide was chemically synthesized. The native peptide is naturally found in Hadronyche versuta (Blue mountain funnel-web spider).The mutant hairpinless toxin was synthesized by solid-phase peptide synthesis, oxidized/folded in a glutathione redox buffer, then purified using reverse-phase HPLC. sample This structure was determined using standard 2D homonuclear techniques. structures with the lowest energy 100 20 2D_NOESY 2D_TOCSY E-COSY 2D_NOESY E-COSY 2D_TOCSY 0.005 4.9 1 atm 298 K The structures are based on a total of 231 NOE-derived distance restraints, 19 dihedral-angle restraints, and 16 restraints defining 8 hydrogen bonds. Torsion angle dynamics followed by dynamical simulated annealing 1 lowest energy 3 mM hairpinless peptide, 0.1 mM TSP, 25 micromolar chloramphenicol 5% D2O, 95% H2O 3 mM hairpinless peptide, 0.1 mM TSP, 25 micromolar chloramphenicol 100% D2O Bruker data analysis XwinNMR 2.0 Tae-he Xia and Christian Bartels data analysis XEASY 1.3.13 Peter Guntert, Christian Mumenthaler, and Torsten Herrman structure solution DYANA 1.5 Axel Brunger refinement X-PLOR 3.1 600 Bruker DRX CYS 1 n 1 CYS 1 A ILE 2 n 2 ILE 2 A PRO 3 n 3 PRO 3 A SER 4 n 4 SER 4 A GLY 5 n 5 GLY 5 A GLN 6 n 6 GLN 6 A PRO 7 n 7 PRO 7 A CYS 8 n 8 CYS 8 A PRO 9 n 9 PRO 9 A TYR 10 n 10 TYR 10 A ASN 11 n 11 ASN 11 A GLU 12 n 12 GLU 12 A ASN 13 n 13 ASN 13 A CYS 14 n 14 CYS 14 A CYS 15 n 15 CYS 15 A SER 16 n 16 SER 16 A GLN 17 n 17 GLN 17 A SER 18 n 18 SER 18 A CYS 19 n 19 CYS 19 A THR 20 n 20 THR 20 A GLY 21 n 21 GLY 21 A GLY 22 n 22 GLY 22 A ARG 23 n 23 ARG 23 A CYS 24 n 24 CYS 24 A ASP 25 n 25 ASP 25 A author_defined_assembly 1 monomeric 1.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 1_555 x,y,z identity operation 0.0000000000 0.0000000000 0.0000000000 A N THR 20 A N THR 20 A O ARG 23 A O ARG 23 1 A GLU 12 -173.48 35.24 1 A ASN 13 -149.62 30.32 2 A GLU 12 -169.71 33.27 2 A ASN 13 -150.25 29.79 3 A GLU 12 -163.30 30.14 4 A GLU 12 -168.12 32.80 4 A ASN 13 -143.88 30.68 5 A GLU 12 -171.61 34.50 5 A ASN 13 -145.74 29.94 6 A GLU 12 -145.05 29.08 6 A SER 18 -107.05 62.09 7 A GLU 12 -171.82 34.64 7 A ASN 13 -148.52 33.99 8 A PRO 9 -84.45 -74.25 8 A ASN 11 -92.36 49.15 8 A GLU 12 -154.77 31.81 8 A SER 18 -102.89 62.00 9 A ASN 11 -104.13 40.49 9 A GLU 12 -148.00 28.30 9 A SER 18 -108.72 61.76 10 A PRO 9 -84.86 -73.59 10 A ASN 11 -99.53 36.02 10 A GLU 12 -147.63 32.39 10 A SER 18 -110.06 62.19 11 A PRO 9 -84.35 -74.11 11 A ASN 11 -106.35 40.27 11 A GLU 12 -148.41 32.43 12 A GLU 12 -168.78 33.44 12 A ASN 13 -142.32 36.24 13 A GLU 12 -144.50 29.22 13 A SER 18 -107.62 60.34 14 A PRO 9 -84.49 -74.78 14 A GLU 12 -146.39 29.80 14 A SER 18 -109.65 62.04 15 A PRO 9 -84.59 -76.80 15 A GLU 12 -174.59 35.80 15 A ASN 13 -149.91 26.00 15 A SER 18 -105.20 61.93 16 A PRO 9 -84.59 -75.01 16 A ASN 11 -109.63 42.15 16 A GLU 12 -149.91 27.66 16 A SER 18 -109.22 61.56 17 A PRO 9 -84.04 -76.05 17 A GLU 12 -176.23 36.43 17 A ASN 13 -146.43 27.06 17 A SER 18 -107.29 60.11 18 A ASN 11 -98.43 41.90 18 A GLU 12 -155.31 30.27 18 A SER 18 -106.17 66.88 19 A ASN 11 -106.73 48.84 19 A GLU 12 -152.27 22.09 19 A SER 18 -101.69 61.42 20 A PRO 9 -84.74 -76.29 20 A GLU 12 -149.74 29.71 HAIRPINLESS MUTANT OF OMEGA-ATRACOTOXIN-HV1A 1 N N disulf 2.021 A CYS 1 A SG CYS 1 1_555 A CYS 15 A SG CYS 15 1_555 disulf 2.022 A CYS 8 A SG CYS 8 1_555 A CYS 19 A SG CYS 19 1_555 disulf 2.021 A CYS 14 A SG CYS 14 1_555 A CYS 24 A SG CYS 24 1_555 TOXIN cystine knot, beta-hairpin, TOXIN TOT1A_HADVE UNP 1 4 P56207 CIPSGQPCPYNENCCSQSCTFKENENGNTVKRCD 4 37 1HVW 1 25 P56207 A 1 1 25 1 PHE SEE REMARK 999 1HVW A P56207 UNP 24 1 LYS SEE REMARK 999 1HVW A P56207 UNP 25 1 GLU SEE REMARK 999 1HVW A P56207 UNP 26 1 ASN SEE REMARK 999 1HVW A P56207 UNP 27 1 GLU SEE REMARK 999 1HVW A P56207 UNP 28 1 ASN SEE REMARK 999 1HVW A P56207 UNP 29 1 GLY SEE REMARK 999 1HVW A P56207 UNP 30 1 ASN SEE REMARK 999 1HVW A P56207 UNP 31 1 THR SEE REMARK 999 1HVW A P56207 UNP 32 1 VAL SEE REMARK 999 1HVW A P56207 UNP 33 1 LYS SEE REMARK 999 GLY 22 1HVW A P56207 UNP 34 22 2 anti-parallel A CYS 19 A CYS 19 A THR 20 A THR 20 A ARG 23 A ARG 23 A CYS 24 A CYS 24 1 P 1