1.000000 0.000000 0.000000 0.000000 1.000000 0.000000 0.000000 0.000000 1.000000 0.00000 0.00000 0.00000 Jones, B.E. Rajagopal, P. Klevit, R.E. http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 1 90.00 90.00 90.00 1.000 1.000 1.000 C3 H7 N O2 89.093 y ALANINE L-peptide linking C6 H15 N4 O2 1 175.209 y ARGININE L-peptide linking C4 H8 N2 O3 132.118 y ASPARAGINE L-peptide linking C4 H7 N O4 133.103 y ASPARTIC ACID L-peptide linking C5 H10 N2 O3 146.144 y GLUTAMINE L-peptide linking C5 H9 N O4 147.129 y GLUTAMIC ACID L-peptide linking C2 H5 N O2 75.067 y GLYCINE peptide linking C6 H11 N3 O5 P 1 236.142 n ND1-PHOSPHONOHISTIDINE L-peptide linking C6 H10 N3 O2 1 156.162 y HISTIDINE L-peptide linking C6 H13 N O2 131.173 y ISOLEUCINE L-peptide linking C6 H13 N O2 131.173 y LEUCINE L-peptide linking C6 H15 N2 O2 1 147.195 y LYSINE L-peptide linking C5 H11 N O2 S 149.211 y METHIONINE L-peptide linking C9 H11 N O2 165.189 y PHENYLALANINE L-peptide linking C5 H9 N O2 115.130 y PROLINE L-peptide linking C3 H7 N O3 105.093 y SERINE L-peptide linking C4 H9 N O3 119.119 y THREONINE L-peptide linking C9 H11 N O3 181.189 y TYROSINE L-peptide linking C5 H11 N O2 117.146 y VALINE L-peptide linking US Protein Sci. PRCIEI 0795 0961-8368 6 2107 2119 9336834 Phosphorylation on histidine is accompanied by localized structural changes in the phosphocarrier protein, HPr from Bacillus subtilis. 1997 US Biochemistry BICHAW 0033 0006-2960 33 15271 Structural Consequences of Histidine Phosphorylation: NMR Characterization of the Phosphohistidine Form of Histidine-Containing Protein from Bacillus Subtilis and Escherichia Coli 1994 US Protein Sci. PRCIEI 0795 0961-8368 1 1363 Solution Structure of the Phosphocarrier Protein Hpr from Bacillus Subtilis by Two-Dimensional NMR Spectroscopy 1992 US Biochemistry BICHAW 0033 0006-2960 29 7191 Sequence-Specific 1H NMR Resonance Assignments of Bacillus Subtilis Hpr: Use of Spectra Obtained from Mutants to Resolve Spectral Overlap 1990 10.2210/pdb1jem/pdb pdb_00001jem 1.000000 0.000000 0.000000 0.000000 1.000000 0.000000 0.000000 0.000000 1.000000 0.00000 0.00000 0.00000 9115.053 HISTIDINE CONTAINING PROTEIN M51V 1 man polymer HPR no yes AQKTFKVTADSGI(HIP)ARPATVLVQTASKYDADVNLEYNGKTVNLKSIMGVVSLGIAKGAEITISASGADENDALNAL EETMKSEGLGE AQKTFKVTADSGIHARPATVLVQTASKYDADVNLEYNGKTVNLKSIMGVVSLGIAKGAEITISASGADENDALNALEETM KSEGLGE A polypeptide(L) n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n Bacillus Escherichia sample 1423 Bacillus subtilis 562 Escherichia coli GM-1 database_2 pdbx_database_status pdbx_struct_assembly pdbx_struct_oper_list struct_conn struct_ref_seq_dif repository Initial release Version format compliance Version format compliance Database references Derived calculations Other 1 0 1997-07-23 1 1 2008-03-24 1 2 2011-07-13 1 3 2021-11-03 _database_2.pdbx_DOI _database_2.pdbx_database_accession _pdbx_database_status.process_site _struct_conn.pdbx_leaving_atom_flag _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_ref_seq_dif.details Y BNL 1997-04-01 REL REL LOWEST ENERGY 50 25 6.9 303 K BRUNGER refinement X-PLOR 3.0 structure solution X-PLOR 500.13 Bruker DMX-500 ALA 2 n 1 ALA 2 A GLN 3 n 2 GLN 3 A LYS 4 n 3 LYS 4 A THR 5 n 4 THR 5 A PHE 6 n 5 PHE 6 A LYS 7 n 6 LYS 7 A VAL 8 n 7 VAL 8 A THR 9 n 8 THR 9 A ALA 10 n 9 ALA 10 A ASP 11 n 10 ASP 11 A SER 12 n 11 SER 12 A GLY 13 n 12 GLY 13 A ILE 14 n 13 ILE 14 A HIP 15 n 14 HIP 15 A ALA 16 n 15 ALA 16 A ARG 17 n 16 ARG 17 A PRO 18 n 17 PRO 18 A ALA 19 n 18 ALA 19 A THR 20 n 19 THR 20 A VAL 21 n 20 VAL 21 A LEU 22 n 21 LEU 22 A VAL 23 n 22 VAL 23 A GLN 24 n 23 GLN 24 A THR 25 n 24 THR 25 A ALA 26 n 25 ALA 26 A SER 27 n 26 SER 27 A LYS 28 n 27 LYS 28 A TYR 29 n 28 TYR 29 A ASP 30 n 29 ASP 30 A ALA 31 n 30 ALA 31 A ASP 32 n 31 ASP 32 A VAL 33 n 32 VAL 33 A ASN 34 n 33 ASN 34 A LEU 35 n 34 LEU 35 A GLU 36 n 35 GLU 36 A TYR 37 n 36 TYR 37 A ASN 38 n 37 ASN 38 A GLY 39 n 38 GLY 39 A LYS 40 n 39 LYS 40 A THR 41 n 40 THR 41 A VAL 42 n 41 VAL 42 A ASN 43 n 42 ASN 43 A LEU 44 n 43 LEU 44 A LYS 45 n 44 LYS 45 A SER 46 n 45 SER 46 A ILE 47 n 46 ILE 47 A MET 48 n 47 MET 48 A GLY 49 n 48 GLY 49 A VAL 50 n 49 VAL 50 A VAL 51 n 50 VAL 51 A SER 52 n 51 SER 52 A LEU 53 n 52 LEU 53 A GLY 54 n 53 GLY 54 A ILE 55 n 54 ILE 55 A ALA 56 n 55 ALA 56 A LYS 57 n 56 LYS 57 A GLY 58 n 57 GLY 58 A ALA 59 n 58 ALA 59 A GLU 60 n 59 GLU 60 A ILE 61 n 60 ILE 61 A THR 62 n 61 THR 62 A ILE 63 n 62 ILE 63 A SER 64 n 63 SER 64 A ALA 65 n 64 ALA 65 A SER 66 n 65 SER 66 A GLY 67 n 66 GLY 67 A ALA 68 n 67 ALA 68 A ASP 69 n 68 ASP 69 A GLU 70 n 69 GLU 70 A ASN 71 n 70 ASN 71 A ASP 72 n 71 ASP 72 A ALA 73 n 72 ALA 73 A LEU 74 n 73 LEU 74 A ASN 75 n 74 ASN 75 A ALA 76 n 75 ALA 76 A LEU 77 n 76 LEU 77 A GLU 78 n 77 GLU 78 A GLU 79 n 78 GLU 79 A THR 80 n 79 THR 80 A MET 81 n 80 MET 81 A LYS 82 n 81 LYS 82 A SER 83 n 82 SER 83 A GLU 84 n 83 GLU 84 A GLY 85 n 84 GLY 85 A LEU 86 n 85 LEU 86 A GLY 87 n 86 GLY 87 A GLU 88 n 87 GLU 88 A author_defined_assembly 1 monomeric A HIP 15 ND1-PHOSPHONOHISTIDINE A HIP 14 HIS 1.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 1_555 identity operation 0.0000000000 0.0000000000 0.0000000000 A O LYS 4 A O LYS 3 A N ILE 63 A N ILE 62 A O LEU 35 A O LEU 34 A N VAL 42 A N VAL 41 1 A ARG 17 0.315 SIDE CHAIN 2 A ARG 17 0.296 SIDE CHAIN 3 A ARG 17 0.294 SIDE CHAIN 4 A ARG 17 0.317 SIDE CHAIN 5 A ARG 17 0.250 SIDE CHAIN 6 A ARG 17 0.273 SIDE CHAIN 7 A ARG 17 0.291 SIDE CHAIN 8 A ARG 17 0.308 SIDE CHAIN 9 A ARG 17 0.307 SIDE CHAIN 10 A ARG 17 0.310 SIDE CHAIN 11 A ARG 17 0.312 SIDE CHAIN 12 A ARG 17 0.291 SIDE CHAIN 13 A ARG 17 0.227 SIDE CHAIN 14 A ARG 17 0.306 SIDE CHAIN 15 A ARG 17 0.290 SIDE CHAIN 16 A ARG 17 0.315 SIDE CHAIN 17 A ARG 17 0.309 SIDE CHAIN 18 A ARG 17 0.296 SIDE CHAIN 19 A ARG 17 0.258 SIDE CHAIN 20 A ARG 17 0.236 SIDE CHAIN 21 A ARG 17 0.315 SIDE CHAIN 22 A ARG 17 0.315 SIDE CHAIN 23 A ARG 17 0.271 SIDE CHAIN 24 A ARG 17 0.303 SIDE CHAIN 25 A ARG 17 0.247 SIDE CHAIN 1 A ILE 14 -109.52 58.34 1 A HIP 15 -85.32 -146.96 1 A LYS 45 -90.92 53.83 1 A ALA 68 -80.96 -74.14 1 A ASP 69 -91.78 50.08 2 A ILE 14 -113.76 77.81 2 A HIP 15 -100.01 -146.01 2 A TYR 37 -116.40 74.16 2 A ASN 38 48.30 85.18 2 A THR 41 -150.10 75.93 2 A LYS 45 -90.71 56.10 2 A SER 46 -150.21 89.87 2 A ALA 68 55.88 -89.75 3 A THR 9 -140.24 24.81 3 A ILE 14 -113.66 79.87 3 A HIP 15 -102.12 -163.59 3 A ASN 38 48.13 85.07 3 A LYS 45 -88.47 48.73 3 A ASP 69 -104.83 45.86 3 A LEU 86 -140.50 -50.71 4 A HIP 15 -108.37 -155.21 4 A ALA 31 -63.20 -179.78 4 A LYS 45 -87.67 49.98 4 A ALA 68 -81.90 -73.05 4 A ASP 69 -90.31 51.90 5 A HIP 15 -100.11 -152.72 5 A TYR 37 -160.38 115.27 5 A LYS 45 -90.28 56.57 5 A SER 46 -150.37 86.55 5 A ASP 69 -96.28 42.41 6 A ILE 14 -114.69 59.56 6 A HIP 15 -84.76 -142.78 6 A LYS 45 -88.55 48.26 6 A ASP 69 -93.77 46.53 7 A HIP 15 -106.17 -159.71 7 A ASP 32 -102.75 76.03 7 A TYR 37 -155.36 87.54 7 A LEU 53 -64.31 -72.98 7 A ASP 69 -104.44 52.65 8 A HIP 15 -101.67 -157.16 8 A TYR 37 -106.16 72.32 8 A ASN 38 48.45 85.49 8 A LYS 45 -86.92 49.14 8 A ALA 68 -80.58 -71.23 9 A HIP 15 -104.37 -143.26 9 A TYR 37 -160.28 115.82 9 A LEU 53 -69.15 -76.04 9 A ASP 69 -96.08 42.07 10 A HIP 15 -107.48 -156.95 10 A LYS 45 -87.63 48.93 10 A SER 46 -150.61 84.09 10 A ASP 69 -98.39 44.44 11 A THR 9 -140.49 22.27 11 A HIP 15 -104.94 -159.99 11 A LYS 45 -88.28 48.56 11 A ALA 68 -96.95 -62.92 11 A ASP 69 -96.64 51.51 12 A THR 9 -143.93 22.04 12 A ILE 14 -109.02 66.92 12 A HIP 15 -89.76 -148.81 12 A ASN 38 73.92 -81.40 12 A LYS 45 -90.56 57.93 12 A ALA 68 -76.20 -73.49 12 A ASP 69 -95.32 45.47 13 A HIP 15 -104.51 -162.85 13 A TYR 37 -107.37 57.91 13 A SER 46 -150.19 87.71 13 A ASP 69 -98.73 47.50 14 A HIP 15 -103.03 -163.05 14 A ASN 38 73.29 -81.99 14 A LYS 45 -90.92 59.45 14 A SER 46 -150.10 89.53 14 A ASP 69 -101.30 45.59 15 A GLN 3 -49.94 155.20 15 A HIP 15 -85.30 -153.00 15 A SER 46 -150.24 86.20 15 A LEU 53 -72.53 -76.54 15 A ALA 56 -133.03 -158.68 15 A ALA 68 -75.09 -71.18 15 A ASP 69 -98.91 52.73 16 A ILE 14 -107.44 78.90 16 A HIP 15 -102.76 -159.36 16 A ALA 31 -58.51 172.66 16 A ASN 38 47.66 85.57 16 A SER 46 -150.44 86.79 16 A ALA 68 -90.20 -70.07 16 A ASP 69 -93.14 49.54 17 A ILE 14 -106.74 78.23 17 A HIP 15 -106.06 -156.46 17 A ALA 31 -68.87 -178.44 17 A ASP 32 -106.96 75.84 17 A LYS 45 -90.63 57.07 17 A ALA 68 -87.06 -72.76 17 A ASP 69 -96.26 55.84 17 A LEU 86 -132.46 -60.84 18 A HIP 15 -100.27 -142.68 18 A ASN 38 74.04 -81.20 18 A ALA 68 -90.58 -69.74 18 A ASP 69 -98.67 49.17 19 A HIP 15 -103.65 -141.18 19 A LYS 45 -88.10 48.72 19 A SER 46 -150.54 82.36 19 A ASP 69 -95.14 44.34 20 A ILE 14 -114.15 56.66 20 A HIP 15 -85.57 -143.68 20 A ASN 38 72.37 -81.27 20 A LYS 45 -90.02 51.50 20 A ASP 69 -97.13 47.96 21 A HIP 15 -103.51 -141.07 21 A ASP 69 -96.72 48.30 22 A THR 9 -149.60 27.23 22 A HIP 15 -100.28 -164.46 22 A LYS 45 -88.70 48.79 22 A ASP 69 -96.63 42.83 22 A SER 83 -75.20 -70.22 23 A HIP 15 -103.57 -140.90 23 A LYS 45 -88.22 48.36 23 A SER 46 -150.27 84.64 23 A ALA 68 -88.86 -74.12 23 A ASP 69 -90.34 53.00 24 A HIP 15 -105.57 -158.81 24 A TYR 37 -160.29 108.48 24 A LYS 45 -90.61 54.58 24 A ALA 68 -91.02 -65.28 24 A ASP 69 -97.97 53.83 24 A SER 83 -71.46 -70.66 25 A THR 9 -142.50 21.57 25 A ILE 14 -106.94 78.42 25 A HIP 15 -105.40 -157.75 25 A LYS 45 -88.26 49.68 25 A ASP 69 -97.63 41.21 model building X-PLOR 3.0 refinement X-PLOR 3.0 phasing X-PLOR 3.0 NMR STRUCTURE OF HISTIDINE PHOSPHORYLATED FORM OF THE PHOSPHOCARRIER HISTIDINE CONTAINING PROTEIN FROM BACILLUS SUBTILIS, NMR, 25 STRUCTURES 1 Y N A ARG 17 A ARG 16 HELX_P A LYS 28 A LYS 27 1 1 12 A ILE 47 A ILE 46 HELX_P A LEU 53 A LEU 52 1 2 7 A GLU 70 A GLU 69 HELX_P A GLU 84 A GLU 83 1 3 15 covale 1.310 both A ILE 14 A C ILE 13 1_555 A HIP 15 A N HIP 14 1_555 covale 1.315 both A HIP 15 A C HIP 14 1_555 A ALA 16 A N ALA 15 1_555 PHOSPHOTRANSFERASE HISTIDINE CONTAINING PROTEIN, PHOSPHOHISTIDINE, PTS, PHOSPHOTRANSFERASE PTHP_BACSU UNP 1 1 P08877 AQKTFKVTADSGIHARPATVLVQTASKYDADVNLEYNGKTVNLKSIMGVMSLGIAKGAEITISASGADENDALNALEETM KSEGLGE 1 87 1JEM 2 88 P08877 A 1 1 87 1 HIS modified residue HIP 15 1JEM A P08877 UNP 14 14 1 MET engineered mutation VAL 51 1JEM A P08877 UNP 50 50 2 2 anti-parallel anti-parallel A GLN 3 A GLN 2 A VAL 8 A VAL 7 A ALA 59 A ALA 58 A SER 64 A SER 63 A ASN 34 A ASN 33 A TYR 37 A TYR 36 A LYS 40 A LYS 39 A ASN 43 A ASN 42 1 P 1