1.000000 0.000000 0.000000 0.000000 1.000000 0.000000 0.000000 0.000000 1.000000 0.00000 0.00000 0.00000 Barbault, F. Landon, C. Guenneugues, M. Meyer, J.P. Schott, V. Dimarrcq, J.L. Vovelle, F. http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic C3 H7 N O2 89.093 y ALANINE L-peptide linking C6 H15 N4 O2 1 175.209 y ARGININE L-peptide linking C4 H8 N2 O3 132.118 y ASPARAGINE L-peptide linking C3 H7 N O2 S 121.158 y CYSTEINE L-peptide linking C5 H10 N2 O3 146.144 y GLUTAMINE L-peptide linking C2 H5 N O2 75.067 y GLYCINE peptide linking C6 H10 N3 O2 1 156.162 y HISTIDINE L-peptide linking C6 H13 N O2 131.173 y ISOLEUCINE L-peptide linking C6 H15 N2 O2 1 147.195 y LYSINE L-peptide linking C5 H9 N O2 115.130 y PROLINE L-peptide linking C3 H7 N O3 105.093 y SERINE L-peptide linking C11 H12 N2 O2 204.225 y TRYPTOPHAN L-peptide linking C9 H11 N O3 181.189 y TYROSINE L-peptide linking C5 H11 N O2 117.146 y VALINE L-peptide linking US Biochemistry BICHAW 0033 0006-2960 42 14434 14442 10.1021/bi035400o 14661954 Solution structure of Alo-3: a new knottin-type antifungal peptide from the insect Acrocinus longimanus. 2003 1.000000 0.000000 0.000000 0.000000 1.000000 0.000000 0.000000 0.000000 1.000000 0.00000 0.00000 0.00000 1 SINGLE WAVELENGTH M x-ray 1 1.0 3881.415 ALO3 1 syn polymer no no CIKNGNGCQPNGSQGNCCSGYCHKQPGWVAGYCRRK CIKNGNGCQPNGSQGNCCSGYCHKQPGWVAGYCRRK A polypeptide(L) n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n repository Initial release Version format compliance Version format compliance 1 0 2003-12-23 1 1 2008-04-29 1 2 2011-07-13 RCSB Y RCSB 2003-07-30 REL THE PEPTIDE WAS CHEMICALLY SYNTHESIZED. The sequence of the peptide is naturally found in Acrocinus longimanus (giant harlequin beetle). sample This structure was determined using standard 2D homonuclear techniques. structures with the lowest energy and the least restraint violations 100 10 2D TOCSY DQF-COSY 2D TOCSY 2D NOESY 2D TOCSY kinetics exchange 5.2 ambient 293 K 5.2 ambient 303 K Determination of disulfide pattern was done using ambiguous disulfide restraints. simulated annealing with torsion angle space 4 lowest energy peptide at 1.2mM, acetate buffer at 40mM, 90% H2O, 10% D2O 90% H2O/10% D2O peptide at 1.2mM, acetate buffer at 40mM, 100% D2O 100% D2O Delaglio, F. processing NMRPipe 2.2 Johnson, B.A. data analysis NMRview 5.0 Nilges, M. structure solution ARIA 1.1 Brunger, A.T. structure solution CNS 1.1 Koradi, R. data analysis Molmol 2k1 Brunger, A.T. refinement CNS 1.1 600 Varian INOVA CYS 1 n 1 CYS 1 A ILE 2 n 2 ILE 2 A LYS 3 n 3 LYS 3 A ASN 4 n 4 ASN 4 A GLY 5 n 5 GLY 5 A ASN 6 n 6 ASN 6 A GLY 7 n 7 GLY 7 A CYS 8 n 8 CYS 8 A GLN 9 n 9 GLN 9 A PRO 10 n 10 PRO 10 A ASN 11 n 11 ASN 11 A GLY 12 n 12 GLY 12 A SER 13 n 13 SER 13 A GLN 14 n 14 GLN 14 A GLY 15 n 15 GLY 15 A ASN 16 n 16 ASN 16 A CYS 17 n 17 CYS 17 A CYS 18 n 18 CYS 18 A SER 19 n 19 SER 19 A GLY 20 n 20 GLY 20 A TYR 21 n 21 TYR 21 A CYS 22 n 22 CYS 22 A HIS 23 n 23 HIS 23 A LYS 24 n 24 LYS 24 A GLN 25 n 25 GLN 25 A PRO 26 n 26 PRO 26 A GLY 27 n 27 GLY 27 A TRP 28 n 28 TRP 28 A VAL 29 n 29 VAL 29 A ALA 30 n 30 ALA 30 A GLY 31 n 31 GLY 31 A TYR 32 n 32 TYR 32 A CYS 33 n 33 CYS 33 A ARG 34 n 34 ARG 34 A ARG 35 n 35 ARG 35 A LYS 36 n 36 LYS 36 A author_defined_assembly 1 monomeric 1.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 1_555 x,y,z identity operation 0.0000000000 0.0000000000 0.0000000000 A N GLN 9 A N GLN 9 A O GLY 31 A O GLY 31 A O TYR 32 A O TYR 32 A N HIS 23 A N HIS 23 1 A ILE 2 70.60 158.03 1 A LYS 3 78.47 149.03 1 A CYS 8 -140.88 -50.72 1 A ASN 11 -147.12 24.47 1 A HIS 23 -164.56 118.58 1 A PRO 26 -69.73 57.45 2 A ILE 2 74.66 147.50 2 A LYS 3 74.94 148.53 2 A ASN 11 -162.64 -31.93 2 A GLN 14 176.59 -46.23 2 A SER 19 -173.77 -35.87 2 A TYR 21 72.81 115.08 2 A TRP 28 -158.75 12.12 2 A VAL 29 31.26 44.54 2 A ALA 30 -179.09 106.05 2 A ARG 34 -83.70 -144.35 3 A LYS 3 -153.55 24.68 3 A ASN 4 59.08 121.73 3 A GLN 9 -154.79 64.55 3 A GLN 14 -169.46 -142.32 3 A SER 19 -153.71 45.93 3 A TYR 21 67.31 74.08 4 A ASN 11 -160.67 36.47 4 A PRO 26 -66.37 48.03 5 A ASN 4 -67.75 67.43 5 A GLN 9 -154.36 77.19 5 A ASN 11 69.38 -57.06 5 A CYS 22 -68.62 80.09 5 A LYS 24 -141.85 44.98 5 A ARG 34 -90.68 47.69 5 A ARG 35 -177.19 -147.53 6 A LYS 3 -86.54 45.14 6 A ASN 11 -158.41 56.68 6 A ASN 16 -177.12 149.57 6 A TYR 21 -96.80 56.94 6 A PRO 26 -69.03 32.01 6 A VAL 29 -85.85 -79.58 7 A ASN 11 75.30 -56.22 7 A SER 13 -159.03 -58.51 7 A GLN 14 -171.33 133.65 7 A ASN 16 -177.20 146.74 7 A TYR 21 -160.33 117.97 7 A GLN 25 -121.34 -62.84 7 A PRO 26 -85.24 -156.67 7 A TRP 28 27.07 50.41 7 A VAL 29 70.75 -57.45 7 A ALA 30 -171.73 146.60 7 A ARG 35 72.01 -51.10 8 A ILE 2 70.16 120.83 8 A ASN 11 -158.49 55.36 8 A GLN 14 69.85 -59.80 8 A ASN 16 -176.75 -138.65 8 A CYS 18 -38.28 -38.70 8 A ARG 35 64.78 -98.79 9 A ILE 2 67.71 72.47 9 A ASN 11 -159.69 40.29 9 A GLN 14 179.41 -60.99 9 A TYR 21 58.90 92.72 9 A PRO 26 -67.67 52.53 9 A TRP 28 -151.31 28.80 9 A VAL 29 67.80 -53.27 10 A ASN 11 58.81 71.06 10 A GLN 25 -147.39 -51.98 10 A ARG 35 -84.72 -154.38 ALO3 Solution structure of ALO3: a new knottin-type antifungal peptide from the insect Acrocinus longimanus 1 N N disulf 2.031 A CYS 1 A SG CYS 1 1_555 A CYS 18 A SG CYS 18 1_555 disulf 2.030 A CYS 8 A SG CYS 8 1_555 A CYS 22 A SG CYS 22 1_555 disulf 2.026 A CYS 17 A SG CYS 17 1_555 A CYS 33 A SG CYS 33 1_555 ANTIFUNGAL PROTEIN knottin, cystine-knot, ANTIFUNGAL PROTEIN ALO3_ACRLO UNP 1 1 P83653 CIKNGNGCQPNGSQGNCCSGYCHKQPGWVAGYCRRK 1 36 1Q3J 1 36 P83653 A 1 1 36 3 anti-parallel anti-parallel A GLY 7 A GLY 7 A GLN 9 A GLN 9 A GLY 31 A GLY 31 A CYS 33 A CYS 33 A CYS 22 A CYS 22 A HIS 23 A HIS 23