1.000000 0.000000 0.000000 0.000000 1.000000 0.000000 0.000000 0.000000 1.000000 0.00000 0.00000 0.00000 Penin, F. Brass, V. Appel, N. Ramboarina, S. Montserret, R. Ficheux, D. Blum, H.E. Bartenschlager, R. Moradpour, D. http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic C3 H7 N O2 89.093 y ALANINE L-peptide linking C6 H15 N4 O2 1 175.209 y ARGININE L-peptide linking C4 H7 N O4 133.103 y ASPARTIC ACID L-peptide linking C3 H7 N O2 S 121.158 y CYSTEINE L-peptide linking C5 H10 N2 O3 146.144 y GLUTAMINE L-peptide linking C5 H9 N O4 147.129 y GLUTAMIC ACID L-peptide linking C2 H5 N O2 75.067 y GLYCINE peptide linking C6 H13 N O2 131.173 y ISOLEUCINE L-peptide linking C6 H13 N O2 131.173 y LEUCINE L-peptide linking C6 H15 N2 O2 1 147.195 y LYSINE L-peptide linking C5 H11 N O2 S 149.211 y METHIONINE L-peptide linking C9 H11 N O2 165.189 y PHENYLALANINE L-peptide linking C5 H9 N O2 115.130 y PROLINE L-peptide linking C3 H7 N O3 105.093 y SERINE L-peptide linking C4 H9 N O3 119.119 y THREONINE L-peptide linking C11 H12 N2 O2 204.225 y TRYPTOPHAN L-peptide linking C5 H11 N O2 117.146 y VALINE L-peptide linking US J.Biol.Chem. JBCHA3 0071 0021-9258 279 40835 40843 10.1074/jbc.M404761200 15247283 Structure and function of the membrane anchor domain of hepatitis C virus nonstructural protein 5A. 2004 10.2210/pdb1r7e/pdb pdb_00001r7e 1.000000 0.000000 0.000000 0.000000 1.000000 0.000000 0.000000 0.000000 1.000000 0.00000 0.00000 0.00000 1 SINGLE WAVELENGTH M 1 1.0 3770.423 Genome polyprotein Nonstructural protein NS5A (P56)(residues 1973-2003 OF SWISS-PROT SEQUENCE P27958) 1 syn polymer no no SGSWLRDIWDWICEVLSDFKTWLKAKLMPQL SGSWLRDIWDWICEVLSDFKTWLKAKLMPQL A polypeptide(L) n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n database_2 pdbx_struct_assembly pdbx_struct_oper_list repository Initial release Version format compliance Version format compliance Database references Derived calculations 1 0 2004-08-10 1 1 2008-04-29 1 2 2011-07-13 1 3 2022-03-02 _database_2.pdbx_DOI _database_2.pdbx_database_accession NMR structure of the membrane anchor domain (1-31) of the nonstructural protein 5A (NS5A) of hepatitis C virus. (Minimized average structure, Sample in 50% tfe) NMR structure of the membrane anchor domain (1-31) of the nonstructural protein 5A (NS5A) of hepatitis C virus. (Ensemble of 51 structures, sample in 50% tfe) NMR structure of the membrane anchor domain (1-31) of the nonstructural protein 5A (NS5A) of hepatitis C virus. (Ensemble of 43 structures, Sample in 100mM SDS.) NMR structure of the membrane anchor domain (1-31) of the nonstructural protein 5A (NS5A) of hepatitis C virus. (Minimized average structure, Sample in 100mM DPC) RCSB Y RCSB 2003-10-21 REL REL The peptide was chemically synthesized. The sequence is naturally found in hepatitis C virus. sample 1 2D NOESY 2D TOCSY DQF-COSY 1H-13C HSQC 6.0 ambient 313 K distance geometry, simulated annealing, molecular dynamics, energy minimization 1 minimized average structure 1.2mM NS5A[1-31], 10mM DTTd10 100mM SDS in H2O/D2O 95/5 (v/v) Varian collection VNMR 6.1 Varian processing VNMR 6.1 Varian data analysis VNMR 6.1 Brunger structure solution X-PLOR 3.85 Brunger refinement X-PLOR 3.85 500 Varian UNITYPLUS SER 1 n 1 SER 1 A GLY 2 n 2 GLY 2 A SER 3 n 3 SER 3 A TRP 4 n 4 TRP 4 A LEU 5 n 5 LEU 5 A ARG 6 n 6 ARG 6 A ASP 7 n 7 ASP 7 A ILE 8 n 8 ILE 8 A TRP 9 n 9 TRP 9 A ASP 10 n 10 ASP 10 A TRP 11 n 11 TRP 11 A ILE 12 n 12 ILE 12 A CYS 13 n 13 CYS 13 A GLU 14 n 14 GLU 14 A VAL 15 n 15 VAL 15 A LEU 16 n 16 LEU 16 A SER 17 n 17 SER 17 A ASP 18 n 18 ASP 18 A PHE 19 n 19 PHE 19 A LYS 20 n 20 LYS 20 A THR 21 n 21 THR 21 A TRP 22 n 22 TRP 22 A LEU 23 n 23 LEU 23 A LYS 24 n 24 LYS 24 A ALA 25 n 25 ALA 25 A LYS 26 n 26 LYS 26 A LEU 27 n 27 LEU 27 A MET 28 n 28 MET 28 A PRO 29 n 29 PRO 29 A GLN 30 n 30 GLN 30 A LEU 31 n 31 LEU 31 A author_defined_assembly 1 monomeric 1.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 1_555 x,y,z identity operation 0.0000000000 0.0000000000 0.0000000000 1 A ARG 6 0.280 SIDE CHAIN minimized average NMR structure of the membrane anchor domain (1-31) of the nonstructural protein 5A (NS5A) of hepatitis C virus (Minimized average structure. Sample in 100mM SDS). 1 N N A TRP 4 A TRP 4 HELX_P A LYS 26 A LYS 26 1 1 23 MEMBRANE PROTEIN Membrane anchor domain, HCV NS5A protein, peptide., MEMBRANE PROTEIN POLG_HCVH UNP 1 1973 P27958 SGSWLRDIWDWICEVLSDFKTWLKAKLMPQL 1973 2003 1R7E 1 31 P27958 A 1 1 31